GenomeNet

Database: RefSeq
Entry: NC_027016
LinkDB: NC_027016
Original site: NC_027016 
LOCUS       NC_027016             226084 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Papio ursinus cytomegalovirus isolate OCOM4-52, complete genome.
ACCESSION   NC_027016
VERSION     NC_027016.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Papio ursinus cytomegalovirus
  ORGANISM  Papio ursinus cytomegalovirus
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Cytomegalovirus.
REFERENCE   1  (bases 1 to 226084)
  AUTHORS   Blewett,E.L., Sherrod,C.J., Texier,J.R., Conrad,T.M. and
            Dittmer,D.P.
  TITLE     Complete Genome Sequences of Mandrillus leucophaeus and Papio
            ursinus Cytomegaloviruses
  JOURNAL   Genome Announc 3 (4), e00781-15 (2015)
   PUBMED   26251484
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 226084)
  AUTHORS   Blewett,E.L., White,G., Saliki,J.T. and Eberle,R.
  TITLE     Isolation and characterization of an endogenous cytomegalovirus
            (BaCMV) from baboons
  JOURNAL   Arch. Virol. 146 (9), 1723-1738 (2001)
   PUBMED   11699958
REFERENCE   3  (bases 1 to 226084)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAY-2015) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 226084)
  AUTHORS   Blewett,E.L., Sherrod,C.J., Texier,J.R. and Dittmer,D.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-2015) Microbiology and Immunology, University of
            North Carolina at Chapel Hill, 450 West Dr, Chapel Hill, NC 27514,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to KR351281.
            
            ##Assembly-Data-START##
            Assembly Method       :: 454 Assembly Suite v. 2.9; CLC Genomics
                                     Workbench v. 7.0.4
            Sequencing Technology :: 454
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..226084
                     /organism="Papio ursinus cytomegalovirus"
                     /mol_type="genomic DNA"
                     /isolate="OCOM4-52"
                     /host="Papio ursinus"
                     /db_xref="taxon:1667587"
                     /country="South Africa"
                     /collection_date="18-Nov-1996"
     gene            complement(5506..6000)
                     /locus_tag="AA805_gp01"
                     /db_xref="GeneID:24284890"
     CDS             complement(5506..6000)
                     /locus_tag="AA805_gp01"
                     /codon_start=1
                     /product="US6"
                     /protein_id="YP_009137417.1"
                     /db_xref="GeneID:24284890"
                     /translation="MKPLCTPWVDGTILCSLLFLLAFSGVSSAWSNDTKLPQRRSGHL
                     RDHAETRPLSGSSSSPTCDRQCPLRDDSPACNAFLESYERAVQLLGCDPQLKHRHVLG
                     PRGLFGCPKAPRGVLVLLEHYGGLTLLVYMALILFAVVFTSLMLYVMDECDIARHARR
                     CGSH"
     gene            complement(6276..7076)
                     /locus_tag="AA805_gp02"
                     /db_xref="GeneID:24284807"
     CDS             complement(6276..7076)
                     /locus_tag="AA805_gp02"
                     /codon_start=1
                     /product="US6A"
                     /protein_id="YP_009137418.1"
                     /db_xref="GeneID:24284807"
                     /translation="MLRYPWLQLLATFLLFEVSLCCFFSKKGLTTSYNRRFHYRWIQL
                     NRYCKKEPVIPRMYHEFSNTCELKNDHLYASGIITGNFTDTAWLHVQIIQKRYDNLFF
                     VLSTDAQHPPIIMDSKKYRYGIPPKALVSEAQWQNEFGITKEVRVENQRLFYYAFQLP
                     AYEHDVHITMHIEPETKPLFIKCHPTYGLNWNPKLFKNYMIEMWLQFTYGFLGHIAMM
                     AMAWIVMMLMFRYAWRLLYKDAMEHAARCRVLVKLHRERYRRIDHKVL"
     gene            complement(8104..8457)
                     /locus_tag="AA805_gp03"
                     /db_xref="GeneID:24284808"
     CDS             complement(8104..8457)
                     /locus_tag="AA805_gp03"
                     /codon_start=1
                     /product="US6C"
                     /protein_id="YP_009137419.1"
                     /db_xref="GeneID:24284808"
                     /translation="MKRLVVVTLVALLGVLAVSAEPCSSANRSVTVSPNFNETQWLNE
                     MADIYAEAETKAIGNAESPRCFVWLNWRWNMYLARRADSYPVVRPFYRLPCPFSANAS
                     SANEIVKVELPAFWI"
     gene            complement(9817..10563)
                     /locus_tag="AA805_gp04"
                     /db_xref="GeneID:24284809"
     CDS             complement(9817..10563)
                     /locus_tag="AA805_gp04"
                     /codon_start=1
                     /product="US12"
                     /protein_id="YP_009137420.1"
                     /db_xref="GeneID:24284809"
                     /translation="MGRQDTSREGNEDYEDIMRWVRRFVWLTRVYTVLAVQMAVTLAF
                     CLVCIMCAWRIHAPYVRETLPIWIMIVPSILRFKLRKKTYHATSVKTAVLYTVINSCA
                     LAIWSMCLERNVLWQAYLLSLVLELGCTIMACVLASTRPRGSIIAAFLILALPLFCAI
                     VYYQPWTPAQKWLAVLTATVVDLITLALLHDTLLVLCHAPRSLFDRHAVRAALLLYVD
                     QVLVLMMTVVPLTADGWYPDYFLSPQQPVV"
     gene            complement(10641..11396)
                     /locus_tag="AA805_gp05"
                     /db_xref="GeneID:24284810"
     CDS             complement(10641..11396)
                     /locus_tag="AA805_gp05"
                     /codon_start=1
                     /product="US12A"
                     /protein_id="YP_009137421.1"
                     /db_xref="GeneID:24284810"
                     /translation="MEVLRFQVRFTESIIWIQRFKILIQLYSYWLLQVTVTSTLSTLM
                     WLAYPQWQNLCQTDPAPILIIIIPVLNLACLVVRWEKHASDLLTMTGYVFWITSVITL
                     FGFCVTFSTTITAHIASVVLFAMVTCGAFFERGGSGYTRRYALAGIWTIASVAALLII
                     ACASQSSNLTTHIMLSVYVVFLTCFIILNFWVTQQHQKHLHPEQLIRGALTLYVMYFV
                     LFQVTLLMLNSKIWDVSFSKIFSSFTTRNATVS"
     gene            complement(15724..16521)
                     /locus_tag="AA805_gp06"
                     /db_xref="GeneID:24284811"
     CDS             complement(15724..16521)
                     /locus_tag="AA805_gp06"
                     /codon_start=1
                     /product="US18"
                     /protein_id="YP_009137422.1"
                     /db_xref="GeneID:24284811"
                     /translation="MDHRSYADAELAESWMHENLVQWIDRFRSVVAIYSNALFEVAGT
                     LSVCVLFWFAYPGVTEKCLACVVPTASILVPTLCLAIACCCQKELLRYSGSSTIACVA
                     IETGVTVMTGFCCHRTSLGLGFALTMLALIVCNTVTFYAGRNATRWRIFFCGYGWCLL
                     CFFFFITFAKAAIIYKIFTVMYFCLVSGVAYLLVYQLLQIMYPSPSETLTEAAELARS
                     LAVYTAVIAMFNALTMVFSVNQWMGKIIAAMNQTAGSSWSWLLMNKP"
     gene            complement(17476..18228)
                     /locus_tag="AA805_gp07"
                     /db_xref="GeneID:24284812"
     CDS             complement(17476..18228)
                     /locus_tag="AA805_gp07"
                     /codon_start=1
                     /product="US20"
                     /protein_id="YP_009137423.1"
                     /db_xref="GeneID:24284812"
                     /translation="MVQQENAEMEASDSPLLVSVDEAIAWFKQFVLWMRIYGIFVFAL
                     SMTFGVSGLIWLGYPQTQNFCVVNHGVVLTMFIPILCMLTLYTLGAQHPSNLTTLFFY
                     MAVNLVPATMFDICSDGYAISTAYIMSVAIFVSFTGLTYIGGLDAKRWKCIAGIYTIL
                     FLLFLISTGLQSVPWYTKLVVIISAFSITFFSFILCYDTSVVIYQASYLYCIRSALRL
                     YVNTVSIFLAILFMLSMPKWVERATNSTQTKS"
     misc_feature    complement(17524..18126)
                     /locus_tag="AA805_gp07"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:294323"
     gene            complement(18276..18965)
                     /locus_tag="AA805_gp08"
                     /db_xref="GeneID:24284813"
     CDS             complement(18276..18965)
                     /locus_tag="AA805_gp08"
                     /codon_start=1
                     /product="US21"
                     /protein_id="YP_009137424.1"
                     /db_xref="GeneID:24284813"
                     /translation="MQVQSDEIETVRSMFLLRVYILIWFHNLLLLSACAVCWLMFPER
                     VAQLLPSIRMTLFCLMLSIICLGVLHWAEPEFPKEMYMLLTYTFLIAVAVIASGFQFQ
                     NRSIAYATLSIVLLFIVLSVSTHRFDNNVEFHRPFVIGSSNLLICLSVIFYYFPGEVG
                     ELSVMFGGLLALVASVMCDSQNMLHRIDYESYIPGAICLYLDMMYLFLTLVYFLSTPN
                     SQEVSNVVYKS"
     misc_feature    complement(18321..18935)
                     /locus_tag="AA805_gp08"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:294323"
     gene            complement(19130..20860)
                     /locus_tag="AA805_gp09"
                     /db_xref="GeneID:24284814"
     CDS             complement(19130..20860)
                     /locus_tag="AA805_gp09"
                     /codon_start=1
                     /product="US22"
                     /protein_id="YP_009137425.1"
                     /db_xref="GeneID:24284814"
                     /translation="MALLSRAAAEAWGTYLKQRDDRPEDVIRCDYGVFNLRNIVFQRA
                     MTMLQGIFLRQYDHVCLRDYVKKHSGTMIPLRNPSTWFLIFRCGADIPQVEGRQFGTD
                     YMCCDEKLEAVGILAVKLPDGDRKRVQETTCVLLIGHYGFVYVYDWDTDGLFQVTNTV
                     KELAQYGLLMCETVYRHPHTPFSTTEPRYQVEKFLCLDPTDARAVANVAEEFHGMNLV
                     IKTPGRAEADPLLLLGSVENLRATYPFAKMRPSNFEELLKYINQRLCCRWYVLGITGR
                     YAAFGVLMTCGVILLDECGVCYALRIDESDVYRIADNLHMLFKCGFLKLRGMLRFDRG
                     MRGESRLERAPTCDHFNRQEDLSWCSMLGTVSRQQLDSAHDWLTRNSRCYDKVPTSPW
                     WGRTDLLPTGVLQENQNWCFPWTSVLSLAAPQHGGWEDHDEITTKVPHHRVFRVHKGY
                     PPRTIRGDQDTDEEEEEDDEDDENEPQENDENQTQSPSPPLVNGSLGDSDDETSSLSG
                     DEASSQQPPPELLDLIKKEWQNEDEPVTCERELWLRRARRADAMVTCSCRLQRVSIYD
                     PLNIGIDYFE"
     misc_feature    complement(20336..20701)
                     /locus_tag="AA805_gp09"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(19883..20266)
                     /locus_tag="AA805_gp09"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(21061..22950)
                     /locus_tag="AA805_gp10"
                     /db_xref="GeneID:24284815"
     CDS             complement(21061..22950)
                     /locus_tag="AA805_gp10"
                     /codon_start=1
                     /product="US23"
                     /protein_id="YP_009137426.1"
                     /db_xref="GeneID:24284815"
                     /translation="MWRTRWEDGAPVFTRTDDFPYCHTKYETYLRVMADFRDLFLRQA
                     SIDWVRTWVREHIDQVMCLGIPCNWFVHVRPGGHLPELRDQLLDDITCCRERMAVIGK
                     CIVWVHDRFVETELVMCMAGDTKMYIYEPSQDILILAAEHLDELARYGLLHAECVYRQ
                     PHTPYATQVPRDVVEALLQSAGDAESLAECVGAHHDQDINLHTPGRHAETLKLLTNFG
                     CLSELWPFEAIDPYHLTECQMYLSLRLRCRWYIMGAVGSYRPGGFFEVSSVIFFDRFG
                     RIYAVIVRPYTDRTSHVCLAPGNVYRLADNLSEFFKGGLMKLYVRRRHEHHLRQLARL
                     ERGVRCIHLDETYRLHFTAFDHGVSRDFGRQYRWLCRPDRFRADMFTTWDGWDAFTIW
                     HSRVMRGDFVDRRRRHENVDEDAPPRRRRMFDPANLPPPPPPPPPPSPPPPAERAPTP
                     PPEAPAPQPAPEAPANQQAPTPPPSPPPALPPPPPPPPAPAVPALPDVVLQAPPPPPI
                     PRVPENNNNFDEVHEDDIEVLGRDNEAFEMNGEDEDDEDDGEDLGFDLDEDGMFDLKD
                     LDEWHAEREAAQAHRWRLGQTLMNAYNTETHVLEAEVEARRIHLNRDLSPDWIHSFDF
                     RAFFQ"
     misc_feature    complement(21064..22950)
                     /locus_tag="AA805_gp10"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     misc_feature    complement(22477..22827)
                     /locus_tag="AA805_gp10"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(21985..22410)
                     /locus_tag="AA805_gp10"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(23024..24469)
                     /locus_tag="AA805_gp11"
                     /db_xref="GeneID:24284816"
     CDS             complement(23024..24469)
                     /locus_tag="AA805_gp11"
                     /codon_start=1
                     /product="US24"
                     /protein_id="YP_009137427.1"
                     /db_xref="GeneID:24284816"
                     /translation="MAARHCERDAAGDNDGLNFYRQVLTDFRDLFFCMETSQIEQYVR
                     HNHGRRLCLGPPEGWYVQLQRDQQLLQAQQAARKLVCCDEPLCALGYAIKLVPEPHRD
                     QDRDHLRTDYVILLGRFCRLYAFEPRENYMVIVAHRLEDLAKYGLVRSEFIYRDTIHN
                     QLRRMSPSLIRSGPRPSRTMHILFLNETTPDSFYVTAERIVEHDVKLYTPGYGAVILR
                     LMKTVAELRAVWPFSSLTETEAKRWWWGIRANLATPWYLLGATGRPRQGRTFVAEVLV
                     MLDWFGAVYAIQLDEPNHHIRRVANTITEFFRMGLLKLVFGYRRFEPERQKKIRMEHQ
                     CICPHADEREMDHHHELLAPYEREERRMHCLIKHYDWLCLTDRFDPHQGAWERLDPNT
                     LVLHRYDTVSQTYVLESEIVGVEAAEREAASHQEDTGPRLHCLVSTKSTTRERCTERV
                     LVALVHQSRLVTYSDPFPFKSLTGLREFISV"
     misc_feature    complement(24008..24373)
                     /locus_tag="AA805_gp11"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(23516..23860)
                     /locus_tag="AA805_gp11"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(24919..26808)
                     /locus_tag="AA805_gp12"
                     /db_xref="GeneID:24284817"
     CDS             complement(24919..26808)
                     /locus_tag="AA805_gp12"
                     /codon_start=1
                     /product="US26"
                     /protein_id="YP_009137428.1"
                     /db_xref="GeneID:24284817"
                     /translation="MLRQSYRYASGSDIRRTLCALKDVFTHQDSQTALRTLVSVKAEC
                     RVSVPVSAPPGWRLVFASFPSIFGSSTPCHGPHSPWGKLICCEEPLEVLGFLQFWNSA
                     HHPQQNDGLSDEDDDDSDDEYCDDSCLYAEDLRPPCKARRVVMMGRYESMWLLDRDQE
                     VLYYLASGLDDFARHGLVHCESIYTGKFRMPMLTTDPDDIISMLRMNDHSTSHLKAAM
                     ANYRWQCIPLRTPGEMTRPLMICGETDDLRSCWPFLCMDECMFNNLIQFFRDRLCCEF
                     LTFGVLGEVLPSGVFHSEWVVLMDVFGEFYAFDVFRREMWRLADDLDSLLTIGMLKIY
                     QAGRRFSGAVSDAERLEVPAHCPHGTYQFWDRYLYMDRGTAQHSFFTRYKWLTRRDRF
                     KKKAVGGCHVRNSYHEVAGAADASWEPHLRCDFPKATEVEAAHNFWRRVSEHVQSSEV
                     RQGVRCYSIWTQLTPQLEREIARLRATLTDENGRSSSSSRDLLTEQTVTPTASPSGTL
                     TRPHKKQPAQKTPKPHKSERYHDDDDDLLEIDGPSSSRRHHRHQKEEHETSDDTESND
                     SGAGREQEADDEGGDTDEEDKEPTCDYYTEVLIQRTAKAALLEGRPFPRPAVPRPGSY
                     LPPWL"
     misc_feature    complement(26257..26730)
                     /locus_tag="AA805_gp12"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(25798..26187)
                     /locus_tag="AA805_gp12"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            26977..27948
                     /locus_tag="AA805_gp13"
                     /db_xref="GeneID:24284818"
     CDS             26977..27948
                     /locus_tag="AA805_gp13"
                     /codon_start=1
                     /product="US27A"
                     /protein_id="YP_009137429.1"
                     /db_xref="GeneID:24284818"
                     /translation="MNSSVRNVTALTPLGPGPILAGYTCVFLFGLTGHFYLGFKNSQR
                     RHHAGAFSDILFRHLMITEGVFTLAIPMWTYHLSTGGHLPDPWCRGLTFVFYLTAFAR
                     ATFYLLLAWDRYSVIVCRQPLPVHASYNQVVGLSVWLIAVLAASPFAIFSGDVQQCLG
                     NMGVMPTRSSAILNMEVHLCTFWLPLIMIAACYYHAKRRAAADQIADLHRCALLVTII
                     MVFAIVWFPFHLVLLIDAMASLSHVEPSSAIHWLPIVVMCESLAFAYAGVSPLVYFVA
                     CPVVRHEFIVSLRPFFWRISGKQWGGYVPVATQPPTKLDEEEAASPE"
     misc_feature    27124..27795
                     /locus_tag="AA805_gp13"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            28143..29222
                     /locus_tag="AA805_gp14"
                     /db_xref="GeneID:24284819"
     CDS             28143..29222
                     /locus_tag="AA805_gp14"
                     /codon_start=1
                     /product="US27B"
                     /protein_id="YP_009137430.1"
                     /db_xref="GeneID:24284819"
                     /translation="MANNSTNSTCKLNETLSEFGIDHSATIVVYSVFLIVGLFWNFVL
                     VIVLTTKRKIKFASDVYFLNAAIADMFCICMLPAWVHYALQSVTLNQFACITFSYGFY
                     VSLFLQSWMLILIALERYSYLIHLTPVKKNTAIKRCVWAWFMAVFLALPYSIFRKINP
                     SDECLLGNYASHVAEPYHGILSGVITILTFMIPVPIVFAYSFKMSRSFWGSRKLNNKN
                     SLILLQLAIVALCFWGPFHLFTVVDHIIQIVYNLSRCHIRHLIGLLTESLVFLRSVWN
                     PIVYLIISQKFRTQVCNLFRRVPYSEIDTEGTHRQPAPETESETETVQLTGKGGKNKR
                     AKDGEDITLIIQGADVTPRDYTCFL"
     misc_feature    28260..28982
                     /locus_tag="AA805_gp14"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            29341..30336
                     /locus_tag="AA805_gp15"
                     /db_xref="GeneID:24284820"
     CDS             29341..30336
                     /locus_tag="AA805_gp15"
                     /codon_start=1
                     /product="US27D"
                     /protein_id="YP_009137431.1"
                     /db_xref="GeneID:24284820"
                     /translation="MTGEVCHVNDTMKAYGMTPDLTISLYSLGMILGIGGNMLILCVI
                     CLTRRPWFAHDILFMNMIFADLLMLLTIPAWVYYLLNYTQVSRLECVGLSFAFYVPLF
                     LHSDMIVAIAVERYQNLVRNTPVSCKTAVISCTLLWTTVTLVTSPYYMLRETQEPDSC
                     ILGNYTWHVSSPYRTVMDVAINLWTFVVPAGVILFLSIRIHSCSWGNRKLNTRTSRHL
                     DAMAINMLFFNGLFNLVMFRDIVTDFSSGLSCHYLRQEHFFRMMGIAFVFARPIFNPI
                     LYVSISKKLLRSIFLLFMRVPYDTLDSEHAELMVQGKINNEQVPDPFPRECESML"
     misc_feature    29446..30174
                     /locus_tag="AA805_gp15"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            30456..31487
                     /locus_tag="AA805_gp16"
                     /db_xref="GeneID:24284821"
     CDS             30456..31487
                     /locus_tag="AA805_gp16"
                     /codon_start=1
                     /product="US27E"
                     /protein_id="YP_009137432.1"
                     /db_xref="GeneID:24284821"
                     /translation="MNNSSCGFDNPRTVGPLRYVEIILYSVAIFVGLTGNILLLLVFV
                     KRRGLRFASDVYFMHTTLVDVIITGTLPLWIYYELSYTAFDRATCIGLSVTFYVPLFM
                     QAWFLISIAMERYSNLVWMVPIGTKAAMKNCLGTWVVCTFVASPYYAFRNAHDGHTCI
                     LGNYTWHFNEPAHTLLDFLMIACVFISPVGIVLTVSYKMRKATWGNRKLNSETGDMML
                     LIAIIAILFWGPFHVVLIIDNILQRIYGSSDCTIEEIKHLISMGSATAVYLRAVVNPI
                     IYFGISDKVREQVYSLFRYHPYDELDLEAAKNTVELRVRERNTKGKKRKKRVTWFDQT
                     FPKSYECFL"
     misc_feature    30558..31289
                     /locus_tag="AA805_gp16"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            31641..33134
                     /locus_tag="AA805_gp17"
                     /db_xref="GeneID:24284822"
     CDS             31641..33134
                     /locus_tag="AA805_gp17"
                     /codon_start=1
                     /product="US28"
                     /protein_id="YP_009137433.1"
                     /db_xref="GeneID:24284822"
                     /translation="MTATTSTTMSVTTNATATTSSTSATTTLTSKSSTPANNTTTSTI
                     RTSSTSANVTSLSTSTSKSTVTSSLASTLTTSRNATSNLTTTLSSTSSLTSSNITSTL
                     SSTISTIVSKSTPNITTSLTATVSNATTSLTTVSTALTTTFFESSTPFEYDYDAEVCN
                     MTDIVHMSKSVTVTFYTIIFILGLLGNFMVLMTIVWNRRITFASDIYFLNLAISDLLF
                     VCTLPFWIMYLLDHDIMSHVSCVIMTAIFYCALFASTVFLLLIILDRCYAILWGVDRA
                     DYRSLRNATGGCVLMWGLCIVLALPHFVFLRKGKNVCVAEYQELTNFYVIFINTEVNL
                     CTLILPTAAIIYWYLKLTKLTKSYQRLRHRLTSLNIILAVAIVFAIFWLPYNLLLFVH
                     SLEHMQIPWGCASAKVVRRGLIVTESIALCHCFVNPFIYVIFGHRCRSEFCYLLRALL
                     NKLCPSRSWGSLRPDAVSLDLSHMQVAVACTYESEDCEQTDELQFLI"
     misc_feature    32196..32933
                     /locus_tag="AA805_gp17"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            33327..34427
                     /locus_tag="AA805_gp18"
                     /db_xref="GeneID:24284823"
     CDS             33327..34427
                     /locus_tag="AA805_gp18"
                     /codon_start=1
                     /product="US29"
                     /protein_id="YP_009137434.1"
                     /db_xref="GeneID:24284823"
                     /translation="MPAPPWHTAAWWITLGCASAANVAVFLTSPTVGAQSIVVHKTSS
                     SSSLPSSPLPPSRLSSAVPFHSPTRRSPRTTGPTRSRISAFGRRSRRQRQKPYSYCVT
                     ETHWTTDLAFSDCTNSPSFVKLEGVRRWTLKGQVLGETSYYGSCCRLSHGENAYIIFA
                     HGYGPAVHGHALRVDYAATNCSRPRVPFPSRLEITFTAEIPSRCGARRLYFYGLQCSS
                     QLAFSASGMVDAHRCPPVLSIRSLPLRFFLLDERLRTTLYLDVFLCLVLIIILSVELI
                     PRQVVRHPVLYWRHWIESGFQYLWPSSPRYASLEKKKSPSHVCHITYTAPFPCVYTDL
                     SRPSPRTLRRPAFGYILWLTTSRSQCQPPERS"
     gene            36187..36756
                     /locus_tag="AA805_gp19"
                     /db_xref="GeneID:24284824"
     CDS             36187..36756
                     /locus_tag="AA805_gp19"
                     /codon_start=1
                     /product="US32"
                     /protein_id="YP_009137435.1"
                     /db_xref="GeneID:24284824"
                     /translation="MSRQARDLIPRLGDSCAQTELRWRTVLSESHALWCPCGDWTPHV
                     ECVEEPHFQLRWRNRCERAALRWRRQMHRLHNLWCMCGNWREHALYRRGRLTDSSSGS
                     SASSSGESAENSFAWWKCLRRWNVLWRQSYEFFQMPVPPASERMSPTFSDSDSEDGTP
                     CPADEVEIWRPEDCPIVMDVRPAYRETAV"
     gene            36906..37235
                     /locus_tag="AA805_gp20"
                     /db_xref="GeneID:24284825"
     CDS             36906..37235
                     /locus_tag="AA805_gp20"
                     /codon_start=1
                     /product="O24"
                     /protein_id="YP_009137436.1"
                     /db_xref="GeneID:24284825"
                     /translation="MWHAAILLYEPTLTASAALALGNAISAIHHRFSMLCARCRRRPA
                     TESDSNNARSSQSEASQRRQTRENQKEPSPKNNNTSLVGRALVIIGQQLIAANLGACP
                     PPVTLFR"
     gene            complement(37855..39942)
                     /locus_tag="AA805_gp21"
                     /db_xref="GeneID:24284826"
     CDS             complement(37855..39942)
                     /locus_tag="AA805_gp21"
                     /codon_start=1
                     /product="TRS1"
                     /protein_id="YP_009137437.1"
                     /db_xref="GeneID:24284826"
                     /translation="MSGHRPPRAWSQKRYAGLSCSPSAQSGLLPPPPRHWHPGNFAHN
                     MDMSSLAAALPATNPAPTSAPMHNPPHAPGAPTAHAPCTAAQQQLLTQVPAQRHALTR
                     DEFLVMASAWSGCFLANSTSRATRRWCQRESGQLLPLGKPCGYYALVTPRAQMRDVGA
                     TDLRQLSPTDDWIVLMATIVHEVCPEPGQSPTLCHHEGLFMAVASRFRVFLFDLPRMT
                     LHLVAADADEFFRYGFGDCCRLYVCSVLPPLTTQPPDVVELLTRSWPTPAAAAAAINH
                     TAGGQTVHLETPGRLPQPWLLTTCWEELERWDPFRKWSYPGSIVAAVRNYIIQRLCCT
                     CHLLGVVTTSPWLHTIKEWSAAKNNYYATRSRGPGGGVGRRPPDVQGVETATVKRRPK
                     SNKGRHGAPGAQHQQQPHAGAQKSPAKATQAKQSEVDEDGLLTASHPMIMVVVIMDEL
                     GSIFGYCTQDGLIYPLAEDLSHFLRVGLLNVLTIGRIATTDDQAAMRMIPDRDPLVWE
                     RPRADALYLWPRSGGGPHDLPSQLSFLMRSGRWRSQPIGECGGEGYKPQTSSPDEDGW
                     RARDAQALGLPPNAGCDTPLSDQAQLSLALRNDNRYWKLCSAPEEDENPGEDGHFNEL
                     PYTTWAPTDYNPQWNHPPTAFGANTIVSRRMCHYHARAGRPHRRPLPVQPSDRDPSHY
                     PMYTSDGDLVVQF"
     misc_feature    complement(39220..39591)
                     /locus_tag="AA805_gp21"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(38488..>38616)
                     /locus_tag="AA805_gp21"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            52357..53664
                     /locus_tag="AA805_gp22"
                     /db_xref="GeneID:24284827"
     CDS             52357..53664
                     /locus_tag="AA805_gp22"
                     /codon_start=1
                     /product="UL141"
                     /protein_id="YP_009137438.1"
                     /db_xref="GeneID:24284827"
                     /translation="MRPVRFPRGSARNGTEDETAQLITERGRCSKRPAYVGLGRERTI
                     QDRFPSVEFSVPRPMVPRVAAMPVRRAVAALAVVLISSLAPGARSTDIDHLSWDQCYE
                     DNSPAPLIMPLGSQITIPCTFLPHSWPMVSIRARFCQSEYAGHELMVNVTNGTLVRDD
                     LTGRLSNASWSFVDLGLAHYIALTLNVTNNTTAMFDCVLRNASHGRIEKRFTVITFVE
                     TLQRPGEPDCQPKLGFNADGDKIWTAGYNEWQRHTCGTFYGFDRVFYYLATTNRSNHK
                     PPCPPSAPDRCWPVVQQYILDGDCFRIQVPRRRKIHPHLFPDDGQEDDFIELPWVTLG
                     LTVFLIGALCAALMLIIRMTCGKCYRRYERFQKKKHGYRPVSGLFVRAAEYDELYCSV
                     DDDDYDDECSKSYEALFECESPEPPYPDDNDDPPLYSEIKRRL"
     misc_feature    52525..53523
                     /locus_tag="AA805_gp22"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            58027..58230
                     /locus_tag="AA805_gp23"
                     /db_xref="GeneID:24284828"
     CDS             58027..58230
                     /locus_tag="AA805_gp23"
                     /codon_start=1
                     /product="UL147A"
                     /protein_id="YP_009137439.1"
                     /db_xref="GeneID:24284828"
                     /translation="MKILLYCFGLLSLHCICYASQEVCGAGSPDLVTTSCAISTHHDP
                     SYLAILVSAVFILWMFVVSCVVL"
     gene            59294..60001
                     /locus_tag="AA805_gp24"
                     /db_xref="GeneID:24284829"
     CDS             59294..60001
                     /locus_tag="AA805_gp24"
                     /codon_start=1
                     /product="UL132"
                     /protein_id="YP_009137440.1"
                     /db_xref="GeneID:24284829"
                     /translation="MTTSTSTTVTTNSSASTNGTASSIATSTASTTNSTATTTSSTVN
                     ATTVATAAAAATSVPFPLGDFLGIVIYCASTVALLCLLVVLVAALYGAFHSRHAANSY
                     LGTKEEAAKLLKSERMSTKKRNRYENEYQPLRQSHSDTESMTDEDPAENHVMYFDKKG
                     DLISLVNPNYGRPSSIMIDCQPDDDENIHYYMSIYKELATQAMTEPSDSWVLPASNVM
                     QVSTQEVTLKEPECDDN"
     misc_feature    <59648..59986
                     /locus_tag="AA805_gp24"
                     /note="Glycoprotein UL132; Region: gpUL132; pfam11359"
                     /db_xref="CDD:288251"
     gene            complement(65063..65425)
                     /locus_tag="AA805_gp25"
                     /db_xref="GeneID:24284830"
     CDS             complement(65063..65425)
                     /locus_tag="AA805_gp25"
                     /codon_start=1
                     /product="UL124"
                     /protein_id="YP_009137441.1"
                     /db_xref="GeneID:24284830"
                     /translation="MERRVSLCYLGLNLITHLNKAAPGGTITTGENGAGSLTSSASTH
                     HDHQPPGSAEALSPLSTVLTTVLALSGMLLVVLVVIGLNIGSTYWSREVEDELEETPS
                     RLDTATTSIGVYTVDLCA"
     gene            67882..69060
                     /locus_tag="AA805_gp26"
                     /db_xref="GeneID:24284831"
     CDS             67882..69060
                     /locus_tag="AA805_gp26"
                     /codon_start=1
                     /product="UL122"
                     /protein_id="YP_009137442.1"
                     /db_xref="GeneID:24284831"
                     /translation="MLAASEIKTEPGEDCLQLKYKHKSSRKPTSPSGFIVISDSEDEE
                     EHSVSQESSSQPGVKLTMTTQTTGSLGQMSVESSSSSSSSDSECCDECGGGSSPSTLA
                     SPISPLPPTPPPPVVMPSTSSGITTSAKKPKTPKTKTTKRMASLDCEKVRSAMREKAG
                     IVFTTPTVETKRGRVKAGEVSRMFRATSRSLEYKNLPFTLTNVHQVLSETVNICKSMQ
                     VNNRGIMLIYTRTHEVKEAVDQARVRLGRICNLAISTPFLMEHTMPHVHSADATRKTA
                     EACQQGIRSAWDIKTVHTNELCPRSSDYRTVIVHAATPVDFLGAIQVLIPLNQQFPKQ
                     VAIRIFSAENTNSFMLPIYDNASKMYAVGQFDEPKDEELENLSMAIEKAIEDMNQESQ
                     "
     misc_feature    68470..68955
                     /locus_tag="AA805_gp26"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            69917..70522
                     /locus_tag="AA805_gp27"
                     /db_xref="GeneID:24284832"
     CDS             69917..70522
                     /locus_tag="AA805_gp27"
                     /codon_start=1
                     /product="UL120"
                     /protein_id="YP_009137443.1"
                     /db_xref="GeneID:24284832"
                     /translation="MLRFSDAVWLCLGCGLVVVTLVCGTPFYRGDLYAPTVKMAYIYY
                     NATNLTIYCNTSARQSRFLASGIMITTRYNTTFIKSGYKYHRRPTLFYLKLNKTLEAP
                     YGFYKNSIVTCWGSNGTYGVKSYIIRRITNVSSSAGVSRMSPIIVNDTDLVETPEVAL
                     QWWPKRRQNQIVMGVIVSQFVFVLFIINVCLIWSYKFKRHK"
     gene            71946..73115
                     /locus_tag="AA805_gp28"
                     /db_xref="GeneID:24284833"
     CDS             71946..73115
                     /locus_tag="AA805_gp28"
                     /codon_start=1
                     /product="UL117"
                     /protein_id="YP_009137444.1"
                     /db_xref="GeneID:24284833"
                     /translation="MYSNISIVHSSHRVSKSLAPANKRKTHRTIVVVPQKRFLRIPPD
                     NQDVNHVRIMHPRPSTSRDVSQPTAAPKLIKSVYPYGTSLIRKCSRDVKQQKRLIVFN
                     TAPPASQSDTPSGPSNRMEDMDDILDTFQREMYLAPNCNGGEQAIQEINIHINTPYSL
                     DDDEETASCPGPVSPLSPSPSASEVSEEQPAVPTIDLTDHRVLLESTDLPEEFHNSPY
                     FLPTDCRFAPSCVIKYRYIFEELSRVSRVYDSTAIQIQVSAACGNAFQNLKITLLKLH
                     NITVLAGPQIITQTVPHTPQAIAAFKYCHANSHNVLDTVRSVFPRSVSYYETGVHQLY
                     VSGATKKDLFDAATLCAAVAERQPDIFNINICALSYPSIAAPHLPLYNSFTESHP"
     misc_feature    72642..73100
                     /locus_tag="AA805_gp28"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            73118..74185
                     /locus_tag="AA805_gp29"
                     /db_xref="GeneID:24284834"
     CDS             73118..74185
                     /locus_tag="AA805_gp29"
                     /codon_start=1
                     /product="UL116"
                     /protein_id="YP_009137445.1"
                     /db_xref="GeneID:24284834"
                     /translation="MQEAMKTWVLLVALFAITRDSACNNTSTASSSSTSSNTVTSSKA
                     NNTTSISSSTVSSTSPSGSSSATSNTTKATTSPATTNLSSASPASSPATATTNSTTTT
                     PTPTSSKNTSAGSSTPTNTSNKTSPPASNTSTPSATKTANSTTTNNSAAENTTNITPT
                     FSTENVTVDSNFTTGYPNDTFNATTDPYEVMQIVDLCNATISIIFTDSDEETEESDEQ
                     SSEEQQSFDSIDDNTYYPVNPSYSLLSDSDDVMYFYANCERNDTLSNTSCNYTNQRLT
                     SWSLVSSVSFYPAELTNCNKPVAVIEVGNSSLVVSAEATSNLVDGIYKVLGVPDLNSS
                     FLKELAKFQQLIIQGQNKPQK"
     misc_feature    73448..>73705
                     /locus_tag="AA805_gp29"
                     /note="bifunctional 2',3'-cyclic nucleotide
                     2'-phosphodiesterase/3'-nucleotidase precursor protein;
                     Reviewed; Region: PRK11907"
                     /db_xref="CDD:237019"
     gene            74206..74979
                     /locus_tag="AA805_gp30"
                     /db_xref="GeneID:24284835"
     CDS             74206..74979
                     /locus_tag="AA805_gp30"
                     /codon_start=1
                     /product="UL115"
                     /protein_id="YP_009137446.1"
                     /db_xref="GeneID:24284835"
                     /translation="MQKILAVSLLVTLTSAYLPKNFTCLELTRRCFIGETFPPEDESW
                     TKPLVHVNHPDGNLSQLLRFTASTKHASPLISLDDNFMDYLTLLHNNPQQLRVLLALL
                     KSDAAPVWMTLMQGYSECGDTGPIYTCIDNVCRAYDLRQLTYQRSIFTEHVLGFEFGD
                     EGQFSIILALRNLDSKVHRPIRIPVSTKAQKDGLPLFFAIYNYLKEFFIRHDLETALI
                     DRLDKYYHDLSDEWKQPLSNNPALLHNGLKTVDVRKHSR"
     misc_feature    74206..74940
                     /locus_tag="AA805_gp30"
                     /note="envelope glycoprotein L; Provisional; Region:
                     PHA03302"
                     /db_xref="CDD:223038"
     gene            74939..75685
                     /locus_tag="AA805_gp31"
                     /db_xref="GeneID:24284836"
     CDS             74939..75685
                     /locus_tag="AA805_gp31"
                     /codon_start=1
                     /product="UL114"
                     /protein_id="YP_009137447.1"
                     /db_xref="GeneID:24284836"
                     /translation="MALKQWMLENIPDNKPCVLSYDEQTRILSLNKEWLVFLSIPSSD
                     LALLQETVTAVQQARRRETVYPPAEHVHRWSQLCAPNDVYVVIVGQDPYCDGSASGVA
                     FGTFAEQVAPPSLQNVYRELSRTMSGFQRPVGGCLDDWCRRGVLLLNTVFTVARGQPG
                     SHRHLGWQLLSERVIMRLSDCREHLVFMLWGTEAQSLEYLIDKNRHLILKSCHPSPKN
                     TTKSFVGNDHFVLCNEYLEKHHKINIDWSL"
     misc_feature    74939..75682
                     /locus_tag="AA805_gp31"
                     /note="Uracil-DNA glycosylases (UDG) and related enzymes;
                     Region: UDG_like; cl00483"
                     /db_xref="CDD:294330"
     misc_feature    order(75203..75217,75242..75247,75278..75280,75383..75385,
                     75575..75577)
                     /locus_tag="AA805_gp31"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    order(75206..75211,75215..75217,75272..75280,75509..75514,
                     75572..75577,75581..75592)
                     /locus_tag="AA805_gp31"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    order(75206..75208,75215..75217,75218..75220,75272..75280,
                     75410..75415,75509..75514,75575..75577,75581..75589)
                     /locus_tag="AA805_gp31"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    order(75209..75211,75575..75577)
                     /locus_tag="AA805_gp31"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(82776..85406)
                     /locus_tag="AA805_gp32"
                     /db_xref="GeneID:24284837"
     CDS             complement(82776..85406)
                     /locus_tag="AA805_gp32"
                     /codon_start=1
                     /product="UL105"
                     /protein_id="YP_009137448.1"
                     /db_xref="GeneID:24284837"
                     /translation="MSMTVSSSRPVKYEDALILNLSSAAKIERIVDKVKSLSNVRFEP
                     EDFSYQWFKSISRVERCADQDVRVPCTDQWPFFPFRVLLVTGTAGAGKTSSIQVLAAN
                     LNCVITGTTVIAAQNLSAILNRTRSAQVKTIYRVFGFNSKHVPLAEGGNDTLKQYRIC
                     EPRDETTIQRVQVNDLLAYWPVIADIVEKHLNMLERKASLEDVSEMCESNIIVIDECG
                     LLLKHMLQVVVFFYYFYNAVCDTRLYRERRVPCIICVGSPTQTEALESRYDHTTQNKN
                     IRKGIDVLSALIQNQVLMEYCDIADNWVMFINNKRCTDLDFSDLLKYMEFGIPLTEEH
                     ITYVDRFVKPPSSIRNPSYASDMTRLFLSHVEVQAYFKRLHEQIRQSERHRLFDLPVY
                     CVVNNRAYQELCDLSDPLSGSPQPVDIWFRQNLTRIINYSQFVDHNLSNEILKEPLYG
                     EDMTDEASETLLTLRITYIQGSSVGVNSKVRACVVGYHGTFEQFVEILQKDTFIERTP
                     CEQAGYAYSLVSGLLFSAMYLFYSSPYTDEDSLRELARIDLPHIASLCVDDNNKGVVG
                     VDVDGEEVAAAASTVVVSGSGSGITRVPVTGYEGDNDNALILGIDEDTYDIPCMAEEV
                     SDSDLLAQTSLYEDPFFAKYVKPPSISLLSFEDTVQIYTTFREIFLKRYQVMQRATHG
                     RFAALPMITYNRRNVVVKSNCQIASQTGSFVGMLSHVSPAQTYTLEGYTTDNILSLPG
                     GHRIHPEVAQRGLSRLVLKDALGFLFVLDVNVSRFVESTQGKSLHVCTTVDYGITSRT
                     AMTIAKSQGLSLEKVAVDFGDHPKNLKMSHIYVAMSRVTDPEYLVTNVNPLRLPYEKN
                     TTITPYICRALKDRRTMLIF"
     misc_feature    complement(82779..85403)
                     /locus_tag="AA805_gp32"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     misc_feature    complement(82779..85376)
                     /locus_tag="AA805_gp32"
                     /note="Helicase; Region: Herpes_Helicase; pfam02689"
                     /db_xref="CDD:280797"
     gene            85243..87210
                     /locus_tag="AA805_gp33"
                     /db_xref="GeneID:24284838"
     CDS             85243..87210
                     /locus_tag="AA805_gp33"
                     /codon_start=1
                     /product="UL104"
                     /protein_id="YP_009137449.1"
                     /db_xref="GeneID:24284838"
                     /translation="MDLNHWYEKSSGSKRTLDKDLTLSTIRSILAADDRLRIKASSYL
                     TGRDDDTVIDIFPTTQTLGYIRLLHGFTGTCRGKSIHQVLRDPCVLRKQLLYGLCKTI
                     FDTITIKQVSDEWKIHSALFPYRALDDEDLENYLAVWSASVRQSVQTGVLGALRDILY
                     QFADNDEYGLYVDWCVTVGIIPLMDVKSKPADLAQRAAFVRAAIHKSTEAHPLAQDLL
                     NANLPLLHQVVTHLCAVRIVNSPELRIFKRIKSEKIEAQLKERATGSYVVTEPLAYER
                     DRLFFTTPIAHLHEEILRYDSLCRHQKICQLLNTYPVKAVTTSRHEMNCKKIVEMMDK
                     HDRGSDAKKAIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQSRLMPSRASGGTP
                     SAPGGISAAGAAPDRDIRDLFKKQMIKCLEEQIQAQVDEIQDLKSLNQTWESRVRELR
                     DLLTRYARQRSGRPFERDPKLYHLSVTEAIRKAQEVSFTPLAVEDNRVVANSFFSQFI
                     PNTEKLETLLTELWENEYFRTFRMKRIVTAQGAEEAIVYSNYTVERVTLPYLFSVLSL
                     STLEPIPEDYLNLSFGEIVAAAYDDSKFRQYVELICNREKARRRQMTSQPVAHRPPNA
                     ERPNPHPDAAGGPLRFRHGHPHDPRGAGSPY"
     misc_feature    85429..87057
                     /locus_tag="AA805_gp33"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            complement(87934..90144)
                     /locus_tag="AA805_gp34"
                     /db_xref="GeneID:24284839"
     CDS             complement(87934..90144)
                     /locus_tag="AA805_gp34"
                     /codon_start=1
                     /product="UL102"
                     /protein_id="YP_009137450.1"
                     /db_xref="GeneID:24284839"
                     /translation="MSAGTTHVGASCHLSWYGILESAVPVVQCLFIHLARGQSEPRLQ
                     TFIVRADPLPPADLRAVHRGGYANLAATTDGDERQQSLDRRSAVLARVLLEGSAVIRV
                     LAHPFSPVQIRTDHNGLEIVEAVPALDVDSAALSNALSLFHVAKLVVIGSYPELPEPR
                     AVPVGEERVSEEYGTHANKKMRRGYYAFDVAMSFRVGSHKYVLERDDEAVVSRLFEIR
                     EVSFLRTCLRLVTPVGFVAVAVTDEQCCLLLKSAWTRLYELLFRGFAGQAPLRDYLGP
                     DLFEAGGTRSFFFPGFPPVPVYSVNSLAVLLRETAIDAAGEIMSWCGLPNIVGAAGKL
                     EVQPSALSLGVPDDEWRIFGGELTLPMRLNGTAFREASDSLCTQLWMRAGDEDELTAH
                     VHARDSTLHHLVIVDLVECVLSKCIRTRDFNPHLRFSNRLHAKTVCKQFIENLRYRSG
                     CAFRQIQSLLGYISEHVTSACASAGLSWILSRGHCEFYVYDGNLPHGPVSAEACVRTV
                     MECYWRKLFGDAPGPTCRLQASAPGIMLVWGGERVVSPFGSSGDDDWWCVVGKVLGRV
                     PALLRERPTAADLEAVYREVLFRFVSRRNDVEFWLLQCQPGEHEVRPHAGVIDCAPFY
                     GVWSEQGQIIVQSRDSALSAEVGYGVYLKRAFAMVTACVEAMCSEASPAVPPCSTGSS
                     CSSSSSSAWPGSATTTATTTTDDREDWTKALGGEARQAAERVAADGLRFFRLNA"
     misc_feature    complement(89281..89505)
                     /locus_tag="AA805_gp34"
                     /note="Herpesvirus DNA helicase/primase complex associated
                     protein; Region: Herpes_HEPA; pfam03324"
                     /db_xref="CDD:281336"
     gene            90370..91446
                     /locus_tag="AA805_gp35"
                     /db_xref="GeneID:24284840"
     CDS             90370..91446
                     /locus_tag="AA805_gp35"
                     /codon_start=1
                     /product="UL100"
                     /protein_id="YP_009137451.1"
                     /db_xref="GeneID:24284840"
                     /translation="MAPSKVDSVNSRIWGISVFLAFLTFANICGHTTMMNVPGVGYPC
                     SYYNVVDHTETNLSLYNVMHLFTPMLYMDAVQTILYVIFSMLVFLCVIIYYVCCWLKI
                     TYRKEEGLSLNQRTRDIAYMGDSMSIFVFILVMDTYELMTLAMTFRLPSVIAFMTCVH
                     FFCLTIFNINMVTNYQSYRNSLFQLQRIHPMLQGTVQYRTIIVNLVQMLLGFNTAVIA
                     MSLCLGFGNNFFVQTGHMVIAVFFVYAFIVIIYFLMLEVVFWRYVKVQFGYHAGTFFG
                     LCGMIYPIIKYDLAYTPDYTSQVATAFALCFIIWAGFTACRCIRYFRARHTIKYKSLT
                     TSEEISSLKDGLVTSDADDTDEMA"
     misc_feature    90370..91371
                     /locus_tag="AA805_gp35"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     pfam01528"
                     /db_xref="CDD:279822"
     gene            complement(91998..93680)
                     /locus_tag="AA805_gp36"
                     /db_xref="GeneID:24284841"
     CDS             complement(91998..93680)
                     /locus_tag="AA805_gp36"
                     /codon_start=1
                     /product="UL98"
                     /protein_id="YP_009137452.1"
                     /db_xref="GeneID:24284841"
                     /translation="MWDETGDANEDLARLLALRDDEPLSLFIMNTFLLRQEGFRNLPY
                     SILRLAYAYRLFTRAGRTHGVAVAEEFVSAVAALARDELLRDILGNRYADSREEIQTA
                     LDRLVRCQDRDRDDGDEMIDVSEDYVWLSKLLDLAPNYRQLELYQLLEKESRGQSRNV
                     VWHVLRLDSVSATKIYEAFLSGFPPSPVHQPSRAGASPGIQFGLRHEGVVKTMVEFHV
                     THGREPVRDGLGLLIDPTSGLIGASIDLCFGVRKSSSGDARSSLRISPCASVYEIKCR
                     YKYLRSKTDPFVQSVLQRADAASVAKLLLSHPVPGVEFRHDAEVPSAREFLLSHDPLF
                     KATLKRGRPIKPPDALRDYIHDLLYLNKTERSEVIVFDAKNVDDTINASLSPTGPVAD
                     DAVETGSDSQSSLHDENTPDLLGKLTIYEVARFALPAFVNPRHQYYFQLLIQQYVLSQ
                     YYIKNHPDPERIDFRDLPSAHLVSAIFRERDEGEVGRPLHLGGRVFHCDHIPLLLIVT
                     PVVFDPNFTKHVVCTVVDRWSRNLSRKTNLPVWVPNAANEYVVSSVPRPVSP"
     misc_feature    complement(92043..93623)
                     /locus_tag="AA805_gp36"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     cl09232"
                     /db_xref="CDD:298855"
     gene            complement(93749..95644)
                     /locus_tag="AA805_gp37"
                     /db_xref="GeneID:24284842"
     CDS             complement(93749..95644)
                     /locus_tag="AA805_gp37"
                     /codon_start=1
                     /product="UL97"
                     /protein_id="YP_009137453.1"
                     /db_xref="GeneID:24284842"
                     /translation="MATRSKVKSRPRSVSAESGRPWQPAPLRRSRASHRRAWMRQAVA
                     ATTTLENQAALVCSSSSTSATQDAAVSTSAASAQSQKAAAAVVASPPSPPTPLTSRGR
                     AGSRKSSVDTLVNCNEQQLQCREDASHWSFEYETADLLGGAGGRGGEGVQTRAPLRSH
                     ASHDGVTTPQQHEEYDNYPASSQTSEASVAADDDHEAVHCTCSNDQVITTSIRGLVCD
                     ASFFARITQPELCEMAVTYLLVYVPKDEQFCQRVCYAVDMSDSHKRIGCGSFGEVWPL
                     SRHHVVKIARKHSETILSAYMSGLIRTRAGPRAEEADGVYHGLMTATGCCLMHNITLY
                     TRFHTDLFHYEDWDMTSIASYRRAFHHLAEGIKFLNHTCKVCHFDISPMNVLVNVNPH
                     YPSEILHAVLCDYSLSEPYPVCNDRCVVVFQETGTARRIPNCTHRVRECYHPAFRPLP
                     LQKLMISNPHARFPDSSLLRRFCMAELAALGNVLGFCLVRLLDRRGIREVQGGPEAML
                     FKHASTACRALESNRLTACSDACMLIMAAQLAYHAGLLGDEGLPIVNRTVNFVENKLS
                     SCRVRAFRRYYHECLGHLPHDYVRKNLERLLAVPDGVYLYTSFRRTANISAEEDLDGD
                     CRQVFAD"
     misc_feature    complement(<94421..94861)
                     /locus_tag="AA805_gp37"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(<94421..>94576)
                     /locus_tag="AA805_gp37"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:304357"
     misc_feature    complement(93947..94495)
                     /locus_tag="AA805_gp37"
                     /note="UL97; Region: UL97; pfam06734"
                     /db_xref="CDD:284210"
     gene            complement(95680..96063)
                     /locus_tag="AA805_gp38"
                     /db_xref="GeneID:24284843"
     CDS             complement(95680..96063)
                     /locus_tag="AA805_gp38"
                     /codon_start=1
                     /product="UL96"
                     /protein_id="YP_009137454.1"
                     /db_xref="GeneID:24284843"
                     /translation="MTSANKDLLKAVMRLELEKKQNLFLRRAYGPQHRVTKHHHLKVM
                     QTAAREQTRYSQVAVTQVAANVVRERESLKKELQRARALQKATDADELLDSLMELKDT
                     VEDVCETFVDSVSNTCEVDLVGEED"
     misc_feature    complement(95758..96027)
                     /locus_tag="AA805_gp38"
                     /note="Protein of unknown function (DUF2664); Region:
                     DUF2664; pfam10867"
                     /db_xref="CDD:287800"
     gene            complement(96060..97382)
                     /locus_tag="AA805_gp39"
                     /db_xref="GeneID:24284844"
     CDS             complement(96060..97382)
                     /locus_tag="AA805_gp39"
                     /codon_start=1
                     /product="UL95"
                     /protein_id="YP_009137455.1"
                     /db_xref="GeneID:24284844"
                     /translation="MATATNSSFSSPNDSSSPPPPPPPSEMPLSVEEEDDEEEGGCHR
                     QPRRQPRQQQQPRPTAATAAASCSSISTSLCAVERMVELSTQTPPSDFEVQETLRFDE
                     AVNMALIACEAVSPYDRFRLIETPNENFLLVTNVVPREPAEMPAIGAEAAERGFPSRS
                     QDVLDRFACTSATPLPALGVRDYALHNADRLTYEGDLVYGSYLMYRKSHVELSLSSNK
                     AQYVEAVLRQAYTPGLLDHHNVCDLEGLLYLLYCGPRSFCSRDTCFGREKHGCPFPAL
                     LPKIFYEPVRDYMTYMNLAELYVYVWYRGYDFPSASDSPAGAGDDELRLPLKAVSLDR
                     LQEVLKAVRGRFSGREVPTWPASSRTCLLCALYSQNRLCLDLARDEARTVHYSPIVIQ
                     DCAAAVTDVTLSHILPGQTAVTLFPVYHVGKLLDALTETEAGIVSLNL"
     misc_feature    complement(96087..97145)
                     /locus_tag="AA805_gp39"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            complement(98329..99366)
                     /locus_tag="AA805_gp40"
                     /db_xref="GeneID:24284845"
     CDS             complement(98329..99366)
                     /locus_tag="AA805_gp40"
                     /codon_start=1
                     /product="UL94"
                     /protein_id="YP_009137456.1"
                     /db_xref="GeneID:24284845"
                     /translation="MASGGITSNDSRCLRQFLQGECCWREVGRGLKFREFQCIACRSA
                     IFSVEGDNACMACQLYLFKRGGENIICFACNGHFMGVYSCPRVQRMRQEIVGLPATYK
                     LLFLGPLGPARIDFVPGFSPMMSVVPRCSITPQLIYDVCTLVPPEEAERIRVKGCTGS
                     YEPGVEKAISLGGAGAWLVNRSGGYALYFYLLCYDLFTVCGNNEELPSMARLMALATA
                     CGQMGCNYCKDHGGHIDPTGCYVGCIPDRGNCLCYTLCNSPSMNPITNENPVAFFCDV
                     ERATYLCSVGSKSKGKITLAEGLDYHIGAKNADGDWVPLNANAWQLVKLEDPIARMIV
                     CACPVLKNLVH"
     misc_feature    complement(98332..99366)
                     /locus_tag="AA805_gp40"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03352"
                     /db_xref="CDD:223053"
     gene            complement(99242..100822)
                     /locus_tag="AA805_gp41"
                     /db_xref="GeneID:24284846"
     CDS             complement(99242..100822)
                     /locus_tag="AA805_gp41"
                     /codon_start=1
                     /product="UL93"
                     /protein_id="YP_009137457.1"
                     /db_xref="GeneID:24284846"
                     /translation="METHLFSDLAFEQEFDEELQFPLHVVLDPVDLSFEEAKTVRYVY
                     YRSDPDPVENWRRAAFRVFLRPFELLTYLREAGVTVPPIGQRVALHHALFTTLGIRCL
                     ERRISGAQMLYLRVVWEDEHGGGGGHGDRRRFRDWEFLVRDLLQGELEVSEAEEANAE
                     SNVSSLITDSAVEIAKAKSAATPFFEMPTRSGEGEDAQASEAERRAVHFLRGDSEFTY
                     HAGPLEPPSKIRGHEIVQPRLEVNPDVIYASGPHDDDRVSKTDEWQQGGLLRLRSVWD
                     VQQRLRLHVLWYAHSFWRSRGLRYEDREEDLRLTLDAYFDSVAVEYELAREVYREIKA
                     VVRTDRMLPQKFSCHLSIETSWLLVWELFDCALDIWRDRADVNSCIIKALTHRLRTGK
                     QVHGDSVAVDKTNNTCETWYADVVRCVRAEVDLGVEVRVETCPHSHLWITRGRDGQLR
                     KWVTQPDTYVLYVTPGLVFHWVLPGGFTVSSRVRLDGVGRDHFERFQMSAPVLARRVL
                     LERGGPRPKVPGVSVYSL"
     misc_feature    complement(99368..100822)
                     /locus_tag="AA805_gp41"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:282425"
     gene            complement(100788..101564)
                     /locus_tag="AA805_gp42"
                     /db_xref="GeneID:24284847"
     CDS             complement(100788..101564)
                     /locus_tag="AA805_gp42"
                     /codon_start=1
                     /product="UL92"
                     /protein_id="YP_009137458.1"
                     /db_xref="GeneID:24284847"
                     /translation="MTFWTRVAAAAAAAMSSHHHQQPPQPQPQPQPPQHPRLARGRPP
                     KSGTLGTTSAVPDSCDVSGACDMRHVQNVFTEEIQLHSLYVCTRCFRTHLCDLGSSCA
                     LISTLEGSVCVKTGLVYEALYPMAREHALEPIEETSLDDVNVIGAVLTEVYRYLMSHA
                     ARYADVIQEVVERDRLKKQVEDSIYFTFNKVFRSMQNVNRISVPIISQLFIQLIIGIY
                     SKQTKYDSCVIKVSRKKREDALLKQMRSEYGNAPVFGPGV"
     misc_feature    complement(100812..101372)
                     /locus_tag="AA805_gp42"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            complement(101386..101748)
                     /locus_tag="AA805_gp43"
                     /db_xref="GeneID:24284848"
     CDS             complement(101386..101748)
                     /locus_tag="AA805_gp43"
                     /codon_start=1
                     /product="UL91"
                     /protein_id="YP_009137459.1"
                     /db_xref="GeneID:24284848"
                     /translation="MNALLAELNRLGVAHLTTEDVFTFAENVFHNFGFLFQTEESGPR
                     KIDLVSSLFEHLTVECVNDILDACSSSGGSGDEQSPSPATTTATAAAATAAAPKTGAG
                     PAAKERDARHHVGRAGQL"
     gene            complement(103007..104203)
                     /locus_tag="AA805_gp44"
                     /db_xref="GeneID:24284849"
     CDS             complement(103007..104203)
                     /locus_tag="AA805_gp44"
                     /codon_start=1
                     /product="UL88"
                     /protein_id="YP_009137460.1"
                     /db_xref="GeneID:24284849"
                     /translation="MSTPSANGDGRAADELPGPGWRDAALVLPNGLVREHMIRHPDVA
                     DMVRRTIPSPPDAEEGCVFASELAFYASGRFNRVCSIFSIYWQNHSQLIYALTGITHC
                     TKIVIECGQVGGPKGDEKFYDHPGIYVIRPSDGTVTSRNVVWPGTGVHWLDEVEIRVV
                     QRRLTVARSFVNYFRDSMFWMDQRPNDDLCPCPVEVEERLFPLLNLSRGDVKVFDQRV
                     GAAYDRLSTNNLPRGGRRLLDHCVNLAASKKLLLLDLPRLENFFLCQVCLYELDEDEV
                     GEELLGMLCGKVSDADSKFLLHRKAMKVAACVAFILNCLHKHQERLPEVNQRVDECDL
                     VTIALRRYYRHHAGVQSRVVAAACKFLEYYGDSFSPFSSLTRLGVHIPLDANVTRKQL
                     IAILRT"
     misc_feature    complement(103013..104155)
                     /locus_tag="AA805_gp44"
                     /note="Herpesvirus U59 protein; Region: Herpes_U59;
                     pfam04529"
                     /db_xref="CDD:282397"
     gene            complement(104200..106734)
                     /locus_tag="AA805_gp45"
                     /db_xref="GeneID:24284850"
     CDS             complement(104200..106734)
                     /locus_tag="AA805_gp45"
                     /codon_start=1
                     /product="UL87"
                     /protein_id="YP_009137461.1"
                     /db_xref="GeneID:24284850"
                     /translation="MASSPTVFGCRAAQDALIVDSVAEPQVVNVPVHVNSYNLTQELS
                     SVEDARFCQTRPVDAERVRAVFGALYRSASPHMREESDRIKLILGRLLLGPVAVPCYC
                     DEWEANDYMVESPQFCAGPLLYVHRRCHCPNAGRSLAFTVMEGHIATHVFRGLLSLTE
                     WNQHLLDMFCPCGTVSRRDRYSMACLPRHLTLYISDYPYFMVEIGRVLTVSEVDDYVN
                     LMTNYLGDAVTPRLQVHYKLLFGVNVRPLAPLALSSTCEFFLLELQKMWLAVEYHNEV
                     TADFFGRVFTELHRDRGRVMMALRVPDQTVCHLNHFALGRFKRQVLYFKLSIIYGKYK
                     AGVARNTLCYRRLSLTFGDNDTVWRNMFYVYYEIGRGEPMSRSRQPPQITPPPRWASG
                     ACLVAARVPPSVAAAANRRDSTGDRLKRYVCIISRLMFVRYGQLWRREKQQSAFDFTG
                     HTLRQAALEHHRQKQLSAQRYAASRRKFIGGMEFSEITGVSLDRVAVNAFNTNRVINM
                     KAALSGRVGCRVNRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYTNSLNVNIRGS
                     YPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQTVIRSERSKVYWTTNFP
                     CMISHTNNVNVGWFKAATAIVPRVSGSDLENILLQELSCIKSMRDVCIDYGLHRVFTK
                     MELRNSYQIPFLSKQLILFIRACLLKLHGPDKRLYLDRLVFEAVQRGVFDYSKNITAH
                     TKIKHTCALIGSRLANNVPKILARNKKIKLDHLGRNANVLTVCRHLEVNKISRARLKV
                     LVDVLSTLQALSETAHTRNVIRHTLLRLCGSLSATAAAASSSSVSI"
     misc_feature    complement(104251..106725)
                     /locus_tag="AA805_gp45"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03375"
                     /db_xref="CDD:223064"
     misc_feature    complement(106081..106692)
                     /locus_tag="AA805_gp45"
                     /note="Protein of unknown function (DUF587); Region:
                     DUF587; pfam04532"
                     /db_xref="CDD:282400"
     misc_feature    complement(104314..106065)
                     /locus_tag="AA805_gp45"
                     /note="Herpesvirus UL87 family; Region: Herpes_UL87;
                     pfam03043"
                     /db_xref="CDD:281093"
     gene            106752..110783
                     /locus_tag="AA805_gp46"
                     /db_xref="GeneID:24284851"
     CDS             106752..110783
                     /locus_tag="AA805_gp46"
                     /codon_start=1
                     /product="UL86"
                     /protein_id="YP_009137462.1"
                     /db_xref="GeneID:24284851"
                     /translation="MENWTAVELLPKVGIPADFLTHVKTSAGEEMFDSLRIYYGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLQTALATAAHAIKFDDLNKMTTGKMLFHIQVPRVAS
                     GAGMPTSRQTTIMVTKYSEKSPITIPFELSAACLLHLRETFENTILDKILNVEAMHTV
                     MRALKNTADAMERGLIHCFIQVLLRKAPPYFVVQTLVENATLCRQALNRIQRSNILQS
                     FKTKMLSTMFLLNRTSDRDYITKLLTKMVEATTGSILENPSTYVTGSGKQLRGVLVST
                     AQVVQTLMSVLKSSISKQNVTAPATYGNFVLSPENAVTAIAHHSILADFNTYTAHLTS
                     GNPDLTGSSLEKAGQNSHTSLAMDVIQLGEHAVALEHHRDVYKNTDTKNPLERNVDLT
                     FFFPVGLYLPEEKAYTTVENKVKLAETKANALPTSAFLLNRERTLQRLDFVDALATLC
                     HPVIHESNACLQTFIERGVPTDPAVARLTECRFQQEQMGGMARRLVHFYRVRREVPRT
                     TNEIKQDYTVTDFYKIGNLALYTEVHPFFDFTHHQLNGETAALCTPRIVIGNIPDGLA
                     PSGFQELRAAHIAEMVRLRPPPDYEATLQLFRSTVTCPTYPELFYLVDALVHGNVDAF
                     LTIRPFIARCIVNMFQNRQLLAFGHSYAMIAMIVEHLGDGLIPSNIHAHYRMIIVLLR
                     LVTRVSSLPGLNNGQLVDEPLSAYANALHDHRLWPPFVSHLPRNQEGVQIVTDRQPLN
                     NTNIESRHHGVSDIPRIAAMDADEPLFIDEHRATDDEWTMQKIFYLCFLPAMTNNRAC
                     GIGLNLKTLLVDLFYRPAFTMPAEPEALGEMLPQLVQDIGTSDDVNLYEACRELFLVL
                     QYVPEHAKLLEVRAPLDPAQRHGSPDFTSLQHVLYNGCCAINAPKILAEYCIAIPFHR
                     FYSDPTICSAISDDIKRYVTEFPHYHRHDGGFPLAPALWHEYWNWLRSPFSRYTAGCP
                     NTLQSVLTIACMLYKISPVSIALMAKAGVHPGFALTAVRTDTFEVDMLLYSGKSCTSL
                     IINNPQVTKEERDINTTYHVTQNINSVDMGLGYTSTTCVAYLNRSRSDMGVHVQNLFR
                     VFPMHVHRHDEVDRWIRHAAGVDRPQLLDTEAISMLTFGSMSEKNSAANLHGQKAICE
                     LIITPVSMDINYFKIPNNPRGRTSCMLGVDPYDTDAAMKTLYDHTEPDAQTFSSTHNP
                     WASNRGSLGDVLYNIRNRERLGYNSQFYSPCAQFFNTDDIISANKTLFKTIEEYLLRA
                     KDCIRGETDTQYICVEGTDQLIENPCRMLQEALPILSTTTQALMETRLKNSSASFASS
                     ETHFGNYVIGECIPLHQRMLFNS"
     misc_feature    106788..110771
                     /locus_tag="AA805_gp46"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     gene            110844..111755
                     /locus_tag="AA805_gp47"
                     /db_xref="GeneID:24284852"
     CDS             110844..111755
                     /locus_tag="AA805_gp47"
                     /codon_start=1
                     /product="UL85"
                     /protein_id="YP_009137463.1"
                     /db_xref="GeneID:24284852"
                     /translation="MADFSIFCTFEQKLSLTDVGKLTKLTGAIIPVPSRHHLIKHHHL
                     GLHQYIDHTRGYVRLRSLLRNMTPTILRRIEGNQLAMQVPTHGHLYTVLNTGPVTWEK
                     GDKLCVLPPLFQGPVAREYPVSVGSWNLVLPWLLPSQLAVEINQRILIMALFSLDRSY
                     EEVKAAVHQLQHITFRDATFTIPDPVTDNHHLLLDMKTACLSLSMVANLASDLTMNYV
                     RKLALEDSSMLLVKCQELLLRMDREHAADGLRGRPNNVSPDEEISRLSALFVMLRQLD
                     DLIHEQPVFTVCDVSPDNKSATCIFKG"
     misc_feature    110856..111752
                     /locus_tag="AA805_gp47"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03259"
                     /db_xref="CDD:165517"
     gene            111784..113202
                     /locus_tag="AA805_gp48"
                     /db_xref="GeneID:24284853"
     CDS             111784..113202
                     /locus_tag="AA805_gp48"
                     /codon_start=1
                     /product="UL84"
                     /protein_id="YP_009137464.1"
                     /db_xref="GeneID:24284853"
                     /translation="MPRADKTMRNGPRGRPRKASVLLQSDETILTLTDQHHIKNPLTR
                     HGTFRLIQLHVDFQPADLQHPFQILLSAPLKLESITPHRDPEERGLLCAVANGDSDIF
                     PNLTLFPAQAGSCNIIRALVDEHMTQMSIIRLSLNIFALKIMPPLRHQLPLRRKITQH
                     TTLHDCVSLHMPDLDFTTDENHNNSNNGNDNTSTPELTIRVKSALCWHTAEGGISGPR
                     GLTSRISVKLSENAIQNMGPAIFGQLYTDEGSPELVLSSLILYQDGLLRFNVTYRSAQ
                     HQLPSNPIVSFRLRLRRHTVARPFFSDTPLPYFLPRHDENGGLDVCLPYDLSLKSSHL
                     IRIYRRFYGPFLGLFLPHNRQDLVMPVTLWLPRTWLEINVVGENAHIPKNTVLGQLYF
                     ISSKHTLNRGRLSALTHQVKSAVHNVPHQLSLLGASLSLQDLVPIQVSRPDPEAGQQQ
                     QQASQKPVTFAMVCDHQTVSPL"
     misc_feature    111856..113175
                     /locus_tag="AA805_gp48"
                     /note="Cytomegalovirus UL84 protein; Region:
                     Cytomega_UL84; pfam06284"
                     /db_xref="CDD:283854"
     gene            complement(118503..120296)
                     /locus_tag="AA805_gp49"
                     /db_xref="GeneID:24284854"
     CDS             complement(118503..120296)
                     /locus_tag="AA805_gp49"
                     /codon_start=1
                     /product="UL80"
                     /protein_id="YP_009137465.1"
                     /db_xref="GeneID:24284854"
                     /translation="MADPVYVGGFLVRYDEPPGEAELFLPSAVVDRWLRDCRGPLPLN
                     VNHDESATVGSVAGLQNVKAGLFCLGRVTSPKFLEIVQKASEKSELVSRGPPSQSSLQ
                     PDGVVEFLSGSYSGLSLSSRRDINAADSAAGDSETACFKHVALCSVGRRRGTLAVYGR
                     QPDWVMERFPDLTEADREALRAQVLGSGEAADANKVDDSSSSAADPFQSDSYGLLGNS
                     VDALYIQERLPKLRYDKRLVGVAGRESYVKASVSPGEQEPCDIKADQERSKEPEQSHV
                     PAETMSHPLSAVATPAASSVAPSQASLALAPDGVYLPKDAFFSLIGASRPMAEASGAR
                     AAYPAAHPPPAYPVMSYEDPSRHYDYGAWLRRPGYDAGPSLPPPAAIPLPYRRRDPMM
                     DEVERAAWERGYAPSVYDHYGAASGGNGSWSRARGGALKRRRERDAASSDDDEDMSFP
                     GEADHGKARKRLKAHHARGDNSAAADSKGGDRYDEIREALQELKREMLAVRQVAPPAL
                     LTPTQLATPVVSSPTTTSHQPEVVATSEPPSKTPSVAAPSAVSAHSSKSADRGVVNAS
                     CRVAVPGEGIPPKDMVDLNRRLFVAALNKME"
     misc_feature    complement(<119346..120284)
                     /locus_tag="AA805_gp49"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03160"
                     /db_xref="CDD:165431"
     misc_feature    complement(119322..120233)
                     /locus_tag="AA805_gp49"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     gene            complement(118503..119456)
                     /locus_tag="AA805_gp50"
                     /db_xref="GeneID:24284855"
     CDS             complement(118503..119456)
                     /locus_tag="AA805_gp50"
                     /codon_start=1
                     /product="UL80.5"
                     /protein_id="YP_009137466.1"
                     /db_xref="GeneID:24284855"
                     /translation="MSHPLSAVATPAASSVAPSQASLALAPDGVYLPKDAFFSLIGAS
                     RPMAEASGARAAYPAAHPPPAYPVMSYEDPSRHYDYGAWLRRPGYDAGPSLPPPAAIP
                     LPYRRRDPMMDEVERAAWERGYAPSVYDHYGAASGGNGSWSRARGGALKRRRERDAAS
                     SDDDEDMSFPGEADHGKARKRLKAHHARGDNSAAADSKGGDRYDEIREALQELKREML
                     AVRQVAPPALLTPTQLATPVVSSPTTTSHQPEVVATSEPPSKTPSVAAPSAVSAHSSK
                     SADRGVVNASCRVAVPGEGIPPKDMVDLNRRLFVAALNKME"
     misc_feature    complement(119322..>119456)
                     /locus_tag="AA805_gp50"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     gene            complement(121175..122257)
                     /locus_tag="AA805_gp51"
                     /db_xref="GeneID:24284856"
     CDS             complement(121175..122257)
                     /locus_tag="AA805_gp51"
                     /codon_start=1
                     /product="UL78"
                     /protein_id="YP_009137467.1"
                     /db_xref="GeneID:24284856"
                     /translation="MIAFTGTMSLNLLNMMMGASSFMAFAFVLMCLLILRRARLPTSV
                     TIFVWNLIGIQFVAICVMMLSRYIAADKNAAAANFCRLTVLFDHGCVYITSIMFMFLI
                     LDRLAAFLHDRYSWKHQTKYNKELSYYAVVFSYIMGLVAAIPTASVAIPSGRSGFGCQ
                     IPAGYTAVEVALKVVFLFLAPVVTVVALIIQISYHRNRDFMWRYASRALVFYTVLFFL
                     LFPINYVKAVRSGLFSVNNTAVINPYPDYVDYILFCCEVLADFRLTVFSMFILALCDM
                     DPLKRVEQAIDQSALDLQVSESLLRKWLHVMDKLSAMVTWRFTKRDDTAHLTTHEEPM
                     ATSDSAVEVTVTPSCSAVFSSGSSPA"
     misc_feature    complement(<121688..122176)
                     /locus_tag="AA805_gp51"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cd14964"
                     /db_xref="CDD:320095"
     misc_feature    complement(122063..122125)
                     /locus_tag="AA805_gp51"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    complement(121949..122017)
                     /locus_tag="AA805_gp51"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    complement(121823..121873)
                     /locus_tag="AA805_gp51"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     gene            complement(122382..124163)
                     /locus_tag="AA805_gp52"
                     /db_xref="GeneID:24284857"
     CDS             complement(122382..124163)
                     /locus_tag="AA805_gp52"
                     /codon_start=1
                     /product="UL77"
                     /protein_id="YP_009137468.1"
                     /db_xref="GeneID:24284857"
                     /translation="MSLLQPYFRLPIVVAFEPHADNILKCPPHVLQRLVDDSFAGLHK
                     EEVVANRVRKRYLREELSALNEKVQTYCEDLETRVSEAEALLKQQCEVEPPPPCQEPP
                     GQAGRESYSAGNGSEAAPQVTRDRGQTATWVAQCSDQGKDVLFFGITKNDPFIRFHTD
                     FRGELVNTMFENASTWTFTFGVWYYRLKRSLYTQPRWKKTFRLAQMENFSISQELLIG
                     AVNALENVTVYPAYDCVVSDLEAAMCLLAAYGQNHWDGRDLPSSIQAVLTELPHLLHK
                     LSDEVSREIATWEGAPTVNYYAYRDPADLKYYMPLSSGRHYSPGTFDQNVLVRVFHRR
                     QVIQHLPGYEAQTATMVQERLSGQMSDDSLTLWCRRLLASKVGRDVPIFVHEQQYLRS
                     GITCVATLLLIWKVVNSESVFAPRSGKFTLADILGHDAFPRSSQDDGGYGYGNRVRNF
                     EFFLEHYIIPWYNRDSTVTVSQLFPGMALLAITESVRSGWDPSRRGDSQAGDGGGTVL
                     MQISKVNPVADFMFAQSSKQYGDLKRLELHDALLFHYEHGLGRLLSVALPRLRVFALG
                     TALFNVNDIYECIYFLVLGFLPVVAVM"
     misc_feature    complement(122385..124163)
                     /locus_tag="AA805_gp52"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03252"
                     /db_xref="CDD:223024"
     gene            complement(123832..124716)
                     /locus_tag="AA805_gp53"
                     /db_xref="GeneID:24284858"
     CDS             complement(123832..124716)
                     /locus_tag="AA805_gp53"
                     /codon_start=1
                     /product="UL76"
                     /protein_id="YP_009137469.1"
                     /db_xref="GeneID:24284858"
                     /translation="MSVRSGVITSLDALPSFCKRNGQKKHLDIYRRMLRAFPSFAAFN
                     RLLGGLFPAYCQNYRRWLFFEVRLTQRIPDCVLVFVSPDTPRRALCYVIEFKTTCSDA
                     TGQSVREHATHNLQYVQGLKQLKGALTDFDALKVPRGDSWAIIPTIIFFQQQAAQPSF
                     ARAFRSAPFTLRTDSVIDYLRRRQHESVTALLSAAYRRRLRASRRQHPKVSSSRAAKA
                     GGRLLRGAPQRGSGRQSSAKAVSARGAQRAQRKGANLLRRSGNARVRSGGAAQTTVRG
                     RAAAAVPGASRTGRKGVL"
     misc_feature    complement(124144..124677)
                     /locus_tag="AA805_gp53"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; pfam01646"
                     /db_xref="CDD:279917"
     gene            124848..127004
                     /locus_tag="AA805_gp54"
                     /db_xref="GeneID:24284859"
     CDS             124848..127004
                     /locus_tag="AA805_gp54"
                     /codon_start=1
                     /product="UL75"
                     /protein_id="YP_009137470.1"
                     /db_xref="GeneID:24284859"
                     /translation="MLRSLLLGCAVTWLIMQAVLCTDVFPRMTLELNRRPIKFLRENS
                     TKCDNNGTEKNITTVKESAITFNFYKDKRYTSFQLPRCLFTGTLAESFLNQVDLSKTL
                     KQYFDTLNTYATVSEGNLRYKYYGQNLTEQDHLKDQPSTIPPPANINLQNTLFYGGDI
                     ATINASGFHKPMFNGTCDLFQDSELLFTVKETCLYQAFYTEENDYMQITLTDQFLVLT
                     VVMRGTPLVLIFGNITRLAFKAPYRPENFILRKTSKHTLILIVKKEHLIYHTYVNQKD
                     FLDLILSSNYQNLETALLIWNQYAVHVLQHGHCHTMTPQTVQTAFTYGLLLYIASTSA
                     NDKASVSRVIDQHASILLAQDFVTSCMSRMQPRTTLLLYPTAVELANITMKNGKISSV
                     LTLSRLIYILSKQNQHNLITLKDMEHLRDLILSIHKSHLASFISRFARQELYLASGII
                     HSMLNYSNARREIFVLETGLCTLAELSHWSQLIGSEEHVHVSDLYSPCAGSGRRDHAL
                     EHLSAMFPKATNSKTLRTALSVLNTLRPQTFTTFPEVSCISTEKSFAVLTVSPTITYT
                     ISSEYIVKGVSFPVVTTVVGRSIIITRVIANATCSSSSSKHESLPIVMIRNITLEQCD
                     FCQSAMVEYDDSQGIVNVLYIHDRQDLLFALDSSNQIFQKHPRTHYLMLLKNGTTVEV
                     TEAVVDMTDTHIALIVIYALAAIFGLYLLYRVIRLL"
     misc_feature    124947..126998
                     /locus_tag="AA805_gp54"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03295"
                     /db_xref="CDD:223036"
     gene            complement(127049..127219)
                     /locus_tag="AA805_gp55"
                     /db_xref="GeneID:24284860"
     CDS             complement(127049..127219)
                     /locus_tag="AA805_gp55"
                     /codon_start=1
                     /product="UL74A"
                     /protein_id="YP_009137471.1"
                     /db_xref="GeneID:24284860"
                     /translation="MTSLTTSLLVCFVYALMLTTLLLVSYRCLVGFQDDVVTRSLMVF
                     KACYQGLYNTSY"
     gene            127218..128405
                     /locus_tag="AA805_gp56"
                     /db_xref="GeneID:24284861"
     CDS             127218..128405
                     /locus_tag="AA805_gp56"
                     /codon_start=1
                     /product="UL74"
                     /protein_id="YP_009137472.1"
                     /db_xref="GeneID:24284861"
                     /translation="MGSGITKWYILVMTITLTCTAKTKTSKPKTQQTNRNIASALARN
                     PSFRYFEYTLPMPHFPDKNIILAGPIRNTSITYFWYDFYSPILRKPNKYVMCKYNHTN
                     SSMTLVPPPCGSVPSMECLSSMLNISMQNDTGEEPCKLNTTFNPMLYNIPRWTTIIYV
                     GADRVTINSEDIYFLGLGEIIFRNLLRHNCTKSFHVTNAISRHLFRVPRVSLWKLKQT
                     MRRLKRRQTEKDTHKQKRSQKAGNTTTAPPTTQTTYNYTNATILPENISETFYFKPPV
                     IITQLKTMITWLYTGLRYKQKPFCKESRNKKRQSAWANHSRQILYNDTVWTIHGKMNF
                     TDLYYTLPPYTTNTTINSSLFITPLWDHIDSLSFIEEIRRNKSHLETRQRPTNLSLSI
                     LPP"
     misc_feature    127359..128336
                     /locus_tag="AA805_gp56"
                     /note="Herpes UL74 glycoproteins; Region: Herpes_UL74;
                     pfam07982"
                     /db_xref="CDD:285256"
     gene            complement(128386..128697)
                     /locus_tag="AA805_gp57"
                     /db_xref="GeneID:24284862"
     CDS             complement(128386..128697)
                     /locus_tag="AA805_gp57"
                     /codon_start=1
                     /product="UL73"
                     /protein_id="YP_009137473.1"
                     /db_xref="GeneID:24284862"
                     /translation="MRNKTAMRLFLWTWMAVLCVANSSTSSPTSTSTTATTTLKPIRK
                     HHNDDFFSAQCTSHMYEVSMKSFAAVWICLNILLLVISFAVVLRHCCFQNFTTTTVAG
                     Y"
     misc_feature    complement(128398..>128565)
                     /locus_tag="AA805_gp57"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            128728..129717
                     /locus_tag="AA805_gp58"
                     /db_xref="GeneID:24284863"
     CDS             128728..129717
                     /locus_tag="AA805_gp58"
                     /codon_start=1
                     /product="UL72"
                     /protein_id="YP_009137474.1"
                     /db_xref="GeneID:24284863"
                     /translation="MLSVLTDKLDQQLIVSQPHKSRFQRLWQKASLIKNGERQEPQEN
                     QSLNLRYCLLFASNLNFQNAFRHPPVDIFSPRRNIPYKWSPSSFIVRQQNTQLTFFNK
                     HIIWLSEQPHTCTPLGIGLYIPLGYFGITFYKCLDAQFVCMPDLIEPGLRNLSMEVIN
                     LSYTFQAITPGSIEGDICIFPSFCPEPWQMMNMLPPNENNFFFLRLPQRTTIQPYHSH
                     TVYLDAAYVHAPTTCALIVGTRQMAQLGLITRPTIWLPGTVASVTLVNTSNTAVHVSS
                     SATIAKVVFTTRTFAYLILETHPIGHLLVPPIPDTGFTHTPEHHILQQLMPPE"
     misc_feature    128728..129714
                     /locus_tag="AA805_gp58"
                     /note="dUTPase; Provisional; Region: PHA03128"
                     /db_xref="CDD:165400"
     gene            130501..133203
                     /locus_tag="AA805_gp59"
                     /db_xref="GeneID:24284864"
     CDS             130501..133203
                     /locus_tag="AA805_gp59"
                     /codon_start=1
                     /product="UL70"
                     /protein_id="YP_009137475.1"
                     /db_xref="GeneID:24284864"
                     /translation="MTLVLFATEYDSAHIVANVLSKSAADHCVFPLLVKHHASNLVYF
                     CLQTQKCTDSQRVSPVFVVNNDVLNLAHYLHARQPIPLSALVDSLNEDETRPIYNHLF
                     RTVISPEHGGEVREFKHLVYFHHSAIVRYLNLIFLCPTSPSWFISVFGHTEGQVLLTM
                     SYYLLERQYSTISTVEEYVRSFSHDLGAIIPTHATMSEFTRLLLGSPFRSRIPQFVRY
                     AMARNQRDYDELVHVDTQINTFREHARLPDTVCVHYIYLAYRTALSRSRLLKYREVVA
                     YDDKTASEEQCQKQPLFLGRHLEEDLLNVMNKYFSLPNYLQEYIESRLMCIEPNQHLR
                     LSGYSYRTDGPALTGFFGTSSQAMRKVDHINSMSDSVFPPLERSLSGLLRLCASMKTA
                     NTYATDTLTRYSQRQFLLPREAQSEYPIPLFRVQLPSGHHVFCAVASENWNESMFPSD
                     LLKHVPDSHFTDEALTDMVWLHDDDVACSNPETQFYYARHEIFNDRLPTHNFVADFDL
                     RLRDGVVRGLSKEVVFEICRGLRRVWVTVWQSLFGDTDPERHPVYFFKSACKTASPDF
                     YDDDNPPPSYEARTDYCKCTDKLGLRIITPFPERTLVINPSVLRAIAQVLNHAICLDI
                     PLHQHLDPISHPENSLDTGIYHHGRSVRLPFMYKMNQEDGYFMHRRLLPIFIIPEGLR
                     DHPLNFVRAQLDVRNLLHHHPPRYPPGSATTPPQSGGGLRVVLSVRDKLCPSPDINFM
                     ETRSVNVTRYEKRSLSDVISYHLHGTVGRPPSHNDSDDTNDLQRLVVTRVWPLLLEHL
                     TQHYEAKVSEQFTSPHTLTFQPHAPHCVSVKRLDGSRTRDFRCLNYTHRNPQETVQVF
                     IDLRTEHSYALWASLWSRCFTKKCHSNAKNVHISVKIRPPNSDQ"
     misc_feature    130501..133173
                     /locus_tag="AA805_gp59"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03139"
                     /db_xref="CDD:165411"
     misc_feature    130621..133152
                     /locus_tag="AA805_gp59"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03146"
                     /db_xref="CDD:177543"
     gene            143558..145882
                     /locus_tag="AA805_gp60"
                     /db_xref="GeneID:24284865"
     CDS             143558..145882
                     /locus_tag="AA805_gp60"
                     /codon_start=1
                     /product="UL56"
                     /protein_id="YP_009137476.1"
                     /db_xref="GeneID:24284865"
                     /translation="MNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLVESSPFRRNAL
                     AIAYLYRRIYPEVVRQNRTQTSLLSLYLEMILKALYEDTELLDRALKEYSRKPDRMEY
                     YRTILRLDRCDRHHTVELTFTDRVKFSVSLATLNDIERFLCKMNYVYAILSPESGLEV
                     CSQLLQMLRRLCGVSPVACQEAYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNHI
                     VVHRPSSQCDVNIQTVEQDLLELTQRIPSLSGVLTALKNLFSSSSVYHSYIQEAEEAL
                     KEYNLFTDIPARIYSLSDFTYWSRTSEVIVKRVGISIQQLNIYHHLCRVLMNTLSNYL
                     YGEDVEDIFVVGEKALSREERLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKLHES
                     NEMYTKIKSLLDEIRRPAADGAAVAAAEAGGGSAIRGQDPQNMSNNSDGAAAQDEDED
                     FLDYLDARTRAHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIG
                     TVCLDFISRLMNGFIYRTQYRENPDVVDVSQMFSYDEHLYVVNNIIHKSLPAESLPLL
                     GQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEGTVHPSEW
                     MVVKYQSFFNFSNCSDLNMLQKEMWKHVRELVLSVALYNETFGKQLTIACLRDEFATE
                     EDLILTYNKEWPLLLRHEGTLYKSKDLYLLLYRHLARPDEQREVFREPDSACVPTSVS
                     RRVRVSRKRPRNASLLLDLVRDQDEQELVPASLC"
     misc_feature    143567..145501
                     /locus_tag="AA805_gp60"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            145848..148478
                     /locus_tag="AA805_gp61"
                     /db_xref="GeneID:24284866"
     CDS             145848..148478
                     /locus_tag="AA805_gp61"
                     /codon_start=1
                     /product="UL55"
                     /protein_id="YP_009137477.1"
                     /db_xref="GeneID:24284866"
                     /translation="MNKNWSRLLYVSLWAACVVSVSSGTNTSNASVATSTHAASSNSA
                     SQLSSTTPKPTINTTTGALIENTTLRTHEVIKANISKFPYRVCSIAKGTDFLRFEQNI
                     QCESFKPTKDDFDEGIMVVYKRDIRAHTFKVNVYQKVLTQRQSYSYIYMNYMLGQTVE
                     RLPIPMWEVHYVNRINRCYNSVKRHIAGQWYEVYHKDSYVNETMLLLEDYSNTHSSRF
                     VTVKELWHKPGSTWLYTTSSNVNCMVTVTTARSKYPYDYFVTSSGEVVDISPFYNGSN
                     GKHFGENRDKFHIMKNYSMVQYYGRENVPLVAHDLVAFFERADSMMSWDVLDEGNSTC
                     QFTFWEKSERTIRSEADDTYHFTSNSMTATFLTKKDPVNDSDSALDCIKQQAENKIEE
                     IFNATYNSTYVKAGNVTIYETTGGLIVFWLPVKEKSIWDMKKLADGYANMTNASTSSR
                     TKRSTSDSTLLNNTEVIHNIVYAQLQFTYDTLRNYINRALRQIAEAWCKDQRRTLEVL
                     KELSKINPTAMLSAIYDKPVAARYAGDVISLAKCVEVNQTTVQVLRDMHVKDDRELCY
                     SRPVVLYRFYNSSHVQYGQLGENNEILLGRHRTEACEIPSVKIFIAGNTSYEYVNYLF
                     KREVSLGSIPVVETMISLDIDPLENTDFKALELYSEDELRASNVFNLEEIMQEFNAYK
                     QRVVHVEGKVFDTVPTYLRGLDDLMSGLGVAGKALGVAIGAVGGAVASFVEGIVGFIK
                     NPFGSLTVILFLLAVLGVIYLIYMRQKRVYQQPIQQLFPYIAPPPAPAKETPPPPSYE
                     ESVYASIKEKSSSSVKEFSSEEAFQMLLALHKLDAEKRQKLKEESEQAASQSGKVGLL
                     DRVRNRRRGYKPVEENEYEV"
     misc_feature    145998..148472
                     /locus_tag="AA805_gp61"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     gene            148501..151623
                     /locus_tag="AA805_gp62"
                     /db_xref="GeneID:24284867"
     CDS             148501..151623
                     /locus_tag="AA805_gp62"
                     /codon_start=1
                     /product="UL54"
                     /protein_id="YP_009137478.1"
                     /db_xref="GeneID:24284867"
                     /translation="MFFNPYLGGARKSPAWAVKRPVQKTFLEIVPRGAMYDGQSGLIK
                     HKTGRAPIMFYKNIKHVLSDDMAWPCPLPSSSPPLETFLKRASGPLKFHTYDQVDGVL
                     PHDTSEGISPRYRHHITPSGNVLRFFGATEQGHSICVNVFGQRSYFYCEYQDADLLRD
                     LLASASELVSEPRMSYALTIVQVTKTSIYGYGTRPVPNLYQVSMSNWTMARKIGEYLL
                     DQGVAVYEIRVDPLTRLVIDKKMTTFGWCCVNRFEWRLKNKSSTCDLEIDCDVADLMA
                     IPDDASWPVYRCLSFDIECMSASGGFPAAEQVDDIVIQISCVCYETGGTGNEASTVYG
                     TSGMHLFTIGDCGRVGTADVYEFPSEYEMLVGFLIFFRRYSPCFVTGYNINAFDFKYI
                     LTRLDTVYKISANHYGKLASNGRFHTYTPAKKHHAITAATKVFISGCVVIDMYPVCMA
                     KTNSPNYKLNTMAELYLKQQKDDLSYKEIPVKFIAGSEGRADVGKYCMQDALLVRDLF
                     NVINFHYEAGAIARLAKIPMRRVVFDGQQIRIYTSLLDECACRGFILPNHKGAAAADS
                     SDAPEVSSYQGATVFEPAIGYYNDPVAVFDFASLYPSIIMAHNLCYSTLIMPDGESPP
                     EGQVFTVELENGVTHRFAKSTARLSVLSELLTKWVSQRRAVRETMKGCQDPVKRMLLD
                     KEQLALKVTCNAFYGFTGVINGMMPCLPIAASITRIGRDMLTSTSKFVEENLAEPCLL
                     HNFFNREDYSGDPVEVKVIYGDTDSVFVCYRGITATALIHRGSSLADYITQCLFIDPI
                     KLEFEKVFVSLMMICKKRYIGKVAGESTLSMKGVDLVRKTSCEFVKNVTRDVIQLLFD
                     DPEVSRAAVQLSHLTFEELKTQGVPSGFWRILQRLCKARDDLYTSRARVEELVLSSVL
                     SKDISLYKQAHLPHIAVIKRLAARSEELPTVGDRVFYVLTAPHDGRTTGVCNYEIAED
                     PTYVREHGVPIHADKYFDQVVKAVTNVLSPVFPPGALKKDKFLVGILPRRVYLESSFL
                     PYCVKANAHC"
     misc_feature    149356..150816
                     /locus_tag="AA805_gp62"
                     /note="DNA polymerase type-B family; Region: POLBc;
                     smart00486"
                     /db_xref="CDD:214691"
     misc_feature    149356..150039
                     /locus_tag="AA805_gp62"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:299142"
     misc_feature    order(149374..149385,149644..149649,149656..149664,
                     149998..150000)
                     /locus_tag="AA805_gp62"
                     /note="active site"
                     /db_xref="CDD:176647"
     misc_feature    order(149374..149376,149380..149382,149662..149664,
                     149998..150000)
                     /locus_tag="AA805_gp62"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176647"
     misc_feature    order(149377..149385,149644..149649,149656..149661,
                     149998..150000)
                     /locus_tag="AA805_gp62"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176647"
     misc_feature    150103..151515
                     /locus_tag="AA805_gp62"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:278562"
     misc_feature    150220..151518
                     /locus_tag="AA805_gp62"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both synthetic...; Region: POLBc;
                     cl10023"
                     /db_xref="CDD:271693"
     misc_feature    order(150286..150288,150295..150303,150484..150486,
                     150565..150567,150577..150579,150790..150792)
                     /locus_tag="AA805_gp62"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    order(150784..150786,150790..150795)
                     /locus_tag="AA805_gp62"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            complement(151601..152467)
                     /locus_tag="AA805_gp63"
                     /db_xref="GeneID:24284868"
     CDS             complement(151601..152467)
                     /locus_tag="AA805_gp63"
                     /codon_start=1
                     /product="UL53"
                     /protein_id="YP_009137479.1"
                     /db_xref="GeneID:24284868"
                     /translation="MFSGVRSTERRSALRSFTRKRRPRRGSLVSPTTQNKKPNPATAI
                     SAPRPRLTLHELHDIFKDHPDLELKYLNMMKMAITGKESICLPFNFQSHRQHTCLDIS
                     PYGNEQVSKIACTSCSENQVLPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLRMS
                     TNQPSIFQIYYIIHAANHDIVPFMHAERERLHMHIIFENPDVHIPCECVAQMLSAARD
                     DYHVTLDIIKGHVVISVVCHNLVANSVKIDVSVLQRKIDEMDIPNDVSESFERYKDLL
                     NELCHVNSARSP"
     misc_feature    complement(151637..152362)
                     /locus_tag="AA805_gp63"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     pfam02718"
                     /db_xref="CDD:280816"
     gene            complement(152460..154121)
                     /locus_tag="AA805_gp64"
                     /db_xref="GeneID:24284869"
     CDS             complement(152460..154121)
                     /locus_tag="AA805_gp64"
                     /codon_start=1
                     /product="UL52"
                     /protein_id="YP_009137480.1"
                     /db_xref="GeneID:24284869"
                     /translation="MNHPHPQQQQPQPPQPQLSSRSYIYGGWETELTQPLNELTNELL
                     WHAHPRQVAVDMAGASQSGSSAAGGGGGGGGESRALHNFLFSQSQTTDHLTGPGGLQF
                     CDLDSELANFEFSDTERLKRLCTPLDIDTRCNLCAIISICLKQDPDQAWLLDYSLLCF
                     KCNSAPRTALSMLVTMSELIHLLRQYFPDLRVDQLFRQHILTVFDFHLHFFINRCFEK
                     QLGDAVENENITLSHLAVVKALVMGDEAVPYTKHRRFSHHKQKIVVKIPEAPKQLLQT
                     FREHSTPSPDRFAYLLFYMWAGTGVMASTPMTELTQSKHHLLDSVADADDPEINKDVG
                     PIYLSPVPVFQVKNQTTTVCLLCELMACSHYDNLVLRNLYERITSYCENNVKMVDRIQ
                     LALADMLRECSVPAGPQSDDLSRFTRLPIPTDYLAVHNVRPDPVFCTILRQAGVTGIY
                     KHFFCDPQCAANIRITREEVLFGKIHLEHLAELKVLICHDNYYISQMPRRVWMYITTF
                     KAFQITKRSYKNKTQLSDFMREFTQLLEACEIKLVDQSFVVDKYV"
     misc_feature    complement(152463..154061)
                     /locus_tag="AA805_gp64"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03233"
                     /db_xref="CDD:223016"
     gene            154572..155465
                     /locus_tag="AA805_gp65"
                     /db_xref="GeneID:24284870"
     CDS             154572..155465
                     /locus_tag="AA805_gp65"
                     /codon_start=1
                     /product="UL50"
                     /protein_id="YP_009137481.1"
                     /db_xref="GeneID:24284870"
                     /translation="MEISKGLHHDLVSATRRILKLGPAELRVTDAGLICKNPNYSVCD
                     AMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPLKLLSSRHVGEF
                     NVLKVNESLIVTLKDIEDIKPSAYGVLTKCVVRKSNSPSVFNIELIAFGPENETEYEN
                     LIKELCAKKAAAAGGAVLRTSRLVHSRYQSSSGGHKRLHSPRMTIAPPFPPATPPPPP
                     PGGFYGVCRCRTSDHGCCSARREEEQQQLQQPRYGAVARGSNSSFAQVRLGVTRLVDV
                     RWLLIGVAMGIVFFLLYRYVQ"
     misc_feature    154572..>155180
                     /locus_tag="AA805_gp65"
                     /note="nuclear egress membrane protein; Provisional;
                     Region: PHA03326"
                     /db_xref="CDD:223045"
     gene            155455..156930
                     /locus_tag="AA805_gp66"
                     /db_xref="GeneID:24284871"
     CDS             155455..156930
                     /locus_tag="AA805_gp66"
                     /codon_start=1
                     /product="UL49"
                     /protein_id="YP_009137482.1"
                     /db_xref="GeneID:24284871"
                     /translation="MSSDFHRALRRLFVPLCVHDEHFHVQMVIGRGAWHADERVCALQ
                     LFVTDKRFLNRELGDRLYQRFLHEWLACEPGEREAVTTLFQRMVMTKPYFMFLAYVYG
                     MSCFHGVSRVVSFLRFERYDAHFVYVRLQQYPVEKLSALLDGMTSSALGDLHRFLFGV
                     DLRLPVLNQTSSPCLSLLRAKRFDGRNDLAVYHRNQWTRRGKPRSAQLGLLVAALRRH
                     AGPVPCGNPLYVMARQAMQMFCDTCPRYLVPLRALGLNDEIRAYKQPRPLEPTKIVMY
                     GLAAALRGGLIGSVLELPLWCMCRLKCERHLDDRSLIAVVCRHCGHCLNLGKEKLHCE
                     QNFPLNSMFYYRDRQEKSVIFNTNAELVHCSLCGSQRVIKERVYEIVSETICGHRCLR
                     VGWKAVLGLNAACAVYDHVVTFDIILPCAARTCDSTVVVRSVTIPRLFKLTSHGNGPV
                     CSRCQTGEYRDSCLELEDCESLCRGCALVKQTACHGSHHHV"
     misc_feature    156085..156819
                     /locus_tag="AA805_gp66"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     gene            156923..157144
                     /locus_tag="AA805_gp67"
                     /db_xref="GeneID:24284872"
     CDS             156923..157144
                     /locus_tag="AA805_gp67"
                     /codon_start=1
                     /product="UL48A"
                     /protein_id="YP_009137483.1"
                     /db_xref="GeneID:24284872"
                     /translation="MSSSSNTGAAAKKDEEKRRHVCLNVLDLPQESMEHPVVGTMLTK
                     YVRMSSFFTDKSAFKLDLLRMLAVARTRR"
     misc_feature    156923..157141
                     /locus_tag="AA805_gp67"
                     /note="Small capsid protein of Herpesviridae; Region:
                     HV_small_capsid; pfam17086"
                     /db_xref="CDD:293691"
     gene            complement(157191..163742)
                     /locus_tag="AA805_gp68"
                     /db_xref="GeneID:24284873"
     CDS             complement(157191..163742)
                     /locus_tag="AA805_gp68"
                     /codon_start=1
                     /product="UL48"
                     /protein_id="YP_009137484.1"
                     /db_xref="GeneID:24284873"
                     /translation="MKIYQARSDQTHSRFGPRAGSQCVSNCFLYLHALHLKGAHTTLN
                     TDTLDLILTEGARLDSEVEALLKTKRPGERLPVFRLGEDIPNIITSSFGKTAHALSRP
                     FNGTAETRDLDGYTCYGIFDFLMHAYQKPRPTYILVTVNALARAVILLEHDIFVFDPH
                     ATERSSNAAVYQCDSLYDVVMLLTYFGTRLADFYYDALFVYMIDLSIQQVPESEINGI
                     IISLFRDPDIALPASVLPALPGSPVTILPSLPPPDTATPKKTPEKRKATPNVSHGGKK
                     KATAAKDKGSSRVTTTAPYDCSDALTALTRYNRLITQAEHEIQNVTLKAPATSGWILF
                     SHSGLPFDEAFLTDRMEQIVMSHIEHTCCLHIRWRTSSPMYQQVRLLRGFSEDIDRFL
                     NMLLHHQLHIIDVYNTMKNFAPSHLTPLQRAMLDKLRAIFQHYGSIHGPKVLTWVKNI
                     LKAIEKTKYTHLPMRLMEYAEQNPLDVDETFVCLRQQDLSAVSNAVNSRRQLTNQQQE
                     QVQLALQQLSAAIYGIDSHDLERTSFDNKDTKQMLATLDSQARTTLLQRGNTKITELL
                     DDLKRQVSALLHKRYNQIISGSLPVEEIQAMQKRLNQAANLAHEMAGLNLCDVNLSTP
                     FRDMNEQLSYLITGHTSANSMSFSDELMQLRSQFLFATQLKEDTESKIHDLMVGIETA
                     VQDPVARNSNIAMALVQEQLNELRQLGGAEIADIAGRLDAVQKTLQSLYQEEQAARLF
                     VYELSYDNLPNDQALKRQGRLQPLLREDDGLHEQYIQKILDIFNDLLDRLSEKTFPKA
                     QVFDIMNSLINQLPNTSAVVKELHTANAALCQLAKQLEALTKAPRDKRMEILTELVQY
                     FVSNSTLLSHLMNLQVGKTTLPLLYENLKMELQDKHKQQAEAAWLQEAKKLTVTSVEM
                     VQQFLQTAPSPTAAELARPELQAKLQAFLEQEAKKQEEDRKTIIKEQQGMVASELARI
                     TDAVKAQTLSVIPTLKLESIQDVINSLGADGRDILEKFNRNLLASLSTLMKLMEERVS
                     LCIRDLLTGQDTHYLQYQEEARTMRQALNHVWMMMESQLSQETIRALSGLVRRSMFIE
                     KCQLRDPTTVFFDTDYAEDYKRYRNAQKQLELQLTQTRMELYQQSAMAQQTLHQPTAR
                     ITPQTLTVGKNLEDKLETESAGPFQRPVFQDVLDQQLDAYKKIIKDETELTNTKLKSE
                     NELRQAKLTSLSEQWGDLVTRLKMDAMEITTPDAKVLIQDPVGAITQLLAKASTQMPY
                     LEAKKTLQWCLLFLREAYTQIEGNLGHPCYAQLPNFPTLMQQAQSRLDVVSVHVNNNA
                     SCENFVAQHDSASSAADREVIETIESVWATLEAKRVAGGEARYKKVQELLLRAKQSLS
                     DVELQDTLTTEYYNLLTAIQAFGYSLDFSTPLQKIRDLKMRFNDLIKQQHLNASEQVP
                     LPMALLSGDTANTSPVSFVRGLEALERYVLAGYQYLTECINRQPLVCQRIDDIPAVLP
                     STDLDHKRAAMDRLKRLAFSKKNDTVYEVVDVFGLHQFMTRTGVPLHLIMSYGNVFFK
                     YLALHHDDKHLAKKFAQTKNVVTGRYKVVMVNVAVAQTLKTFWSQISQYDLKPLLSGQ
                     AMIGLGETNSLVNLKIFIYIVVSAWNLQLDMTLQDYNGPVIRMNIEDLCIAITTVYPE
                     YIYGIVKHPIQTTLSSLARHLKKDIMHEAINNVVQMPPAYNADEMKGFCINPKTWPSV
                     NLSRVMWDQNLVRQLCDVGPRKNGAQKLWQYGVAIVIFPQDLLQCLWLELRPKFAEEF
                     ATLFDFFQTLFVMFTHQYDITRESNAQSHLATGEPITQTVGVRRKDYTDKTLLDVFIE
                     TDTAIDYVLGSWVFGIPVCCAIYVSEILGGNRLLLARHIEYTNRDPDFMHVQRAKDLN
                     LNHMVTQTWTNTPLEQCWFQAQIQRIRESLRTPMELDFIPLIIYNSNDRTVHSVVRPP
                     TSSERDTSRIVVENPFPTLPLVDVPESDLVSFDRVPINTDFLREDPPPVTRPRGRGSG
                     SGNVSRGGGKDRKILKAVSKKKTVAQASAAVPQEARVSRPTSSLAAAADVSDVTEEEV
                     TTSEDEEEVLAALEERRPSEEEQQSLPSTRTFVEPVFQQSAVQTIVRREDVITVSPAA
                     ATSSFQNPPITTLTQNVINAIQILRSVRVDLRSMARSVNETINRLRFLYLL"
     misc_feature    complement(163194..163715)
                     /locus_tag="AA805_gp68"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:282670"
     misc_feature    complement(161409..>162278)
                     /locus_tag="AA805_gp68"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell
                     wall/membrane/envelope biogenesis]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     misc_feature    complement(<160356..>161807)
                     /locus_tag="AA805_gp68"
                     /note="DNA repair exonuclease SbcCD ATPase subunit
                     [Replication, recombination and repair]; Region: SbcC;
                     COG0419"
                     /db_xref="CDD:223496"
     misc_feature    complement(<160767..160976)
                     /locus_tag="AA805_gp68"
                     /note="Peptidase M16C associated; Region: M16C_assoc;
                     pfam08367"
                     /db_xref="CDD:285556"
     gene            complement(163763..166645)
                     /locus_tag="AA805_gp69"
                     /db_xref="GeneID:24284874"
     CDS             complement(163763..166645)
                     /locus_tag="AA805_gp69"
                     /codon_start=1
                     /product="UL47"
                     /protein_id="YP_009137485.1"
                     /db_xref="GeneID:24284874"
                     /translation="MMRKRTIHFQTFLSELKQNSTDNQTVLNTLSQIEIGAIDVETIN
                     ATIIQQFLQLLPKDGYHFPFIRQNAVYYLLSHTTLRTARDPLAAAEDLYKELQKHTQR
                     KNVTSPCEILNNQATLSSFKKFLEKVQELQTSFNTNQFLAATLPDRKTKKSQRDLSDN
                     GTQYLVRNVFTQIETITEETRPYSNCRLIAELLDILYHSTLQWASALMQYHAFANPND
                     GELDIMLKMNYFYRYYKSVNNDLNNEFQTFVTSEKRNLAAFMVSEADGDQQIGAEHIK
                     DFSFKIFNANLNDRDTTGLAFPILLTSLPVLNHMGVENVFFHQGLIFRLLSDESKLST
                     SEVTRLDLVSQMCTHMTNEFFRAAAHKPMKLRDLMTRIRTFTALGLNRETSKIYAQMA
                     LLQPSRIAPKQGGEMWFEIRQQLLIMIYNTYVFFMCLWVYSPTFLFLHRRKMILEQQK
                     STLIGSRHELQFIWDNVTRNIYQDFNVMFTEEEFNVCTQGTTEAEKDYLYRDLITKWG
                     DILFVLKPQLLIPDAQSPPLEDVTTADVIKRCAMINLSETSVPYESLLPLIHHPNFLD
                     TFMNLVIVPEFLQILTIPYNQFISIGSPRLLRLIHACRLLAPDQMTLYNKLVSLYNLI
                     TFVSEIDAGVFRTVYSLTLEISAILENLCGEPVSPELDLLVELMAQSLSHNLENTVNP
                     LLEEVMQNNSASIANYLEHTHLCYCFAHTTGQLSPDMVTVELSLQSKLIAKIPMTQFL
                     ELTKALITKDQRLTENLQRIEERLQYVNQRMKQIKEDFTQLNEYSKTHPLAVDMIKSL
                     KKTTRTLKNLEQRLLTILEQAKKSNRLIVNSLKRVEKTCTALSNSNIQDHGIRYCIAE
                     ARGLLRTHQGMAAIPPSALEHIPSNAESKLRAFLRAFREGNVEHSPLQMSPLTDSQQQ
                     IPIPDVLTNRYQPSNQTNDLLNWYITSKDQAQMDILTSIHPEGRHA"
     misc_feature    complement(164048..166615)
                     /locus_tag="AA805_gp69"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            166644..167516
                     /locus_tag="AA805_gp70"
                     /db_xref="GeneID:24284875"
     CDS             166644..167516
                     /locus_tag="AA805_gp70"
                     /codon_start=1
                     /product="UL46"
                     /protein_id="YP_009137486.1"
                     /db_xref="GeneID:24284875"
                     /translation="MDVREVAKRPRDPNDEDNELVLATKLKREVNTLAVHYLYEADHQ
                     AITSRFFVPEGLVEFEVHPGSLMFRMVTGAESPRYLYISMYLLAIKASNVSVAARCQL
                     EGIYTSGPAKAALTWLDMGNKLLHHRLRTIGCVKSVSLGITSLLTCVMQGYVYNTLKT
                     QIFSLSIPKDMYMTLEETHERLQNVYLIIVYDHEPLETKAAIYVATSSISNRHTLTDV
                     VRQKFTRERCSFVSRRITRPRHIPLCTGVIQRLGWCLNDDIHASVVTHQEVKLSTFRL
                     DNFNVELGEFLEFV"
     misc_feature    166731..167513
                     /locus_tag="AA805_gp70"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03262"
                     /db_xref="CDD:223027"
     gene            170302..171468
                     /locus_tag="AA805_gp71"
                     /db_xref="GeneID:24284876"
     CDS             170302..171468
                     /locus_tag="AA805_gp71"
                     /codon_start=1
                     /product="UL44"
                     /protein_id="YP_009137487.1"
                     /db_xref="GeneID:24284876"
                     /translation="MDRKARLPEPPTLALRLKPYKSAIQQLRSVIRTLKENTTVTFLP
                     TPALVLQTVRNQLVSKITFNSACLYITDKSFQPKTINNCTPMLGNFMYLTSSKDLTKF
                     YVQDISDLSAKIHMCAPDFNMEFSSPCVHGQDLMRESDNAAVHVDFDHAVVSELIKWI
                     SPHTRVKRSVKKTPCPTGTVQILVHSAPPAIKFILSSGSELEFTANTKVSFHGVKNMR
                     VHVQLKNLYQTLMNCAVTKLPCTVRIVTEHDTVLHISSHNGLFAVDNFLTEEPFQRGD
                     LSFDKSFKQQRAVAVPNSGSMHDDGSGMDSEMLSEPVGRKHERLSSRKMNEHEHNAKE
                     KYEQHKITSYLTSKGAPNSGERNSGYFNDAKEESDSDESVNFEFVPSNKKQKCT"
     misc_feature    170647..171462
                     /locus_tag="AA805_gp71"
                     /note="Herpesvirus polymerase accessory protein; Region:
                     Herpes_PAP; pfam03325"
                     /db_xref="CDD:281337"
     gene            171588..172613
                     /locus_tag="AA805_gp72"
                     /db_xref="GeneID:24284877"
     CDS             171588..172613
                     /locus_tag="AA805_gp72"
                     /codon_start=1
                     /product="UL43"
                     /protein_id="YP_009137488.1"
                     /db_xref="GeneID:24284877"
                     /translation="MIVSDMDRYEMLARQAFDCSVSSKDPSGRLMKFVRKVNGETFPI
                     AWPAGWCFTFCSFLRQTFFGHLNIKELEKKYLCCDNYLLPVGTVSDSDKLARVRRVLV
                     ILVGEGGSVFVHDPCHDSVHLISRTGLHALRTEGLINYCPLREKCGPVRYSIGESVAF
                     DFQKDHSFMGLFRLCKKYEGREFAWACNEDLMSALIVSVLAYENPAHQDWIKSTGSIN
                     VLQVFLLLAQWKQKWREITIFVNQQLRVFGVNPETGRPEYLALNLPAFFRVGLLRLGN
                     QHQYWRDCFNSKKDRDAAPAYRPTGCPRELFCRKLVHKKGHRCEQKRGSFKDRFLCLG
                     SKHVSDE"
     misc_feature    171681..172019
                     /locus_tag="AA805_gp72"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    172080..172421
                     /locus_tag="AA805_gp72"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            172597..173004
                     /locus_tag="AA805_gp73"
                     /db_xref="GeneID:24284878"
     CDS             172597..173004
                     /locus_tag="AA805_gp73"
                     /codon_start=1
                     /product="UL42"
                     /protein_id="YP_009137489.1"
                     /db_xref="GeneID:24284878"
                     /translation="MSATNEQQQQQPRRPQQQQQQLPQHQQPTNDDAPPSYEEALGMA
                     TVSFTAMGHGAPTFSDDSAPPPYCLVVGEVPPRPDNFQMDMSDFPPTSHPPIEAYYED
                     GWKWTVGVFIIAILGIILLAVLVSVLMQMKSRN"
     gene            174634..175509
                     /locus_tag="AA805_gp74"
                     /db_xref="GeneID:24284879"
     CDS             174634..175509
                     /locus_tag="AA805_gp74"
                     /codon_start=1
                     /product="UL38"
                     /protein_id="YP_009137490.1"
                     /db_xref="GeneID:24284879"
                     /translation="MAACLEYEQERERQQAQLNIGYLVQASIMGPTALRAQVKKLMAR
                     ETRIRHEFGVTVCVCDCTYPFLCITVSKIACLERNCPPLQHGLTMFGVIEAWEEAAPR
                     PSRQVVLFMSDNYDIFAYDAGILFYMAPTMSDFWTAPIVFEYWNGIFPVEIRHRVRQY
                     ARTIDDLIVIFHQVYHQRDVLEARRLKNHNSPRTFARFLCGYVRALLDAERRVREGKI
                     PVPFVDRDSLMLNVIAPPTPKQDSPEPGNTPGKKALTRQCSLPTSNPKKRAEADPDSS
                     DEEIIDLTMEGVDAL"
     misc_feature    174718..175044
                     /locus_tag="AA805_gp74"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(180234..181094)
                     /locus_tag="AA805_gp75"
                     /db_xref="GeneID:24284880"
     CDS             complement(180234..181094)
                     /locus_tag="AA805_gp75"
                     /codon_start=1
                     /product="UL34"
                     /protein_id="YP_009137491.1"
                     /db_xref="GeneID:24284880"
                     /translation="MDMNIIITTRDFSNDESTEETADLHNSNVASNLSKAYRGTIRAE
                     GKKKLLIRNLPATFGCTRRNSNLFIFCNDRDYRKLHQGIVQLKRTRTQVDPSEIVNVT
                     KNIKCRLQPHTQDPPLTGGQLQTTISHICTLFNQLVFTAQLRHYCEHHELVVLYTRDE
                     LTRRCGERSALGTNIHRLISLLDHNQHHALCSVLVGLLHQTPHMWARSIRLIGRLRNF
                     LQQRFLHVLVESGLQVDSIFESCYHSEAYRLLFQIDKTNQTAGSLPCSSTVLPVSENE
                     TEDTPVPPCI"
     misc_feature    complement(<180306..181088)
                     /locus_tag="AA805_gp75"
                     /note="nuclear-egress-membrane-like protein; Provisional;
                     Region: PHA03325"
                     /db_xref="CDD:223044"
     gene            182660..185005
                     /locus_tag="AA805_gp76"
                     /db_xref="GeneID:24284881"
     CDS             182660..185005
                     /locus_tag="AA805_gp76"
                     /codon_start=1
                     /product="UL32"
                     /protein_id="YP_009137492.1"
                     /db_xref="GeneID:24284881"
                     /translation="MGLKFIGLSPKHVASINKFLETLSKRPNVDLECNAKILRRCGEK
                     TLHRRSVIFNKLVLWLAYYRELRYHAPDLSSLLSEFEVQVSEVSRRAHTYPFRKPGDA
                     RSHLRTIEVTSFGDDARTDLQVIQSAMESSTALARLSECQSMTVGEVAFIQLREKDVM
                     MLEESLRDICNNMFEIRPAQLNLERPCNSSLVNATNKLVYLGRVISMVRICWDSLTDK
                     CLINIKDLCKSLMKELKTCKSFESNYCSNIIKHGVHNGETADMLLEMLMEDFHIYEDI
                     FPRSSTSGDSIGALEYDDQELRMEWEKWLKGARRDDSPTYEKWDIKKPTPTKADRQMA
                     FSMLSPTDDSKADFWEKPTRTTAAPWEKPSSGTVAPWEKPVSTTIPWSKPATSNAPST
                     SKRVTFWPDDEDKDWKNVESDNVKVDSLVDIGSGLEGLKLDSSTEHTPAYKFEPPKLT
                     QSTEYNPFIQPIRPLDSTVPLFKPVTMDTSQLIDWNNKALGSQLDTTPTIVPVIPPDS
                     DLETGKSAASDLSDVDFTDPNSNFSPAKRRDPSETEASDDDDAKSEAADLFSDDGSDA
                     ESVASVVSVQEAPPSKAKRKLITDAVSKIKPQPKPRPSLGPFPPVDPLASIDARRILK
                     PVVKPVVKPAAVKPPIPAKPVVLKPATLQVPATTITSSVKPPVTAPPASTKIPKESGV
                     KATASAPIQLPATSVKEKVAKPQTVSSTQVLIPAAEKSQAKMLVSPATSPFKSADSST
                     KPIPLPTPSPSKDSDISTRDSQSAISAIIQKIKGDARENEE"
     misc_feature    182660..>183541
                     /locus_tag="AA805_gp76"
                     /note="Herpesvirus large structural phosphoprotein UL32;
                     Region: Herpes_UL32; pfam06070"
                     /db_xref="CDD:283680"
     misc_feature    <184355..184924
                     /locus_tag="AA805_gp76"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(185018..186646)
                     /locus_tag="AA805_gp77"
                     /db_xref="GeneID:24284882"
     CDS             complement(185018..186646)
                     /locus_tag="AA805_gp77"
                     /codon_start=1
                     /product="UL31"
                     /protein_id="YP_009137493.1"
                     /db_xref="GeneID:24284882"
                     /translation="MSSPVGPDENSQSATSSTAPSTSTVACPDASSTTVAVPASPPQT
                     TQKIDLLSQLLPPAPRPEAFVVVPAPGPEPDYRLPDIRVVQLWLETLKNADRDNFGRC
                     VRHAKAHRSSYHLTAYEPYLVALTEQYNAAPCVTEKASYLHGCLFMSFPVVYNNTQGG
                     VYKHDWSNIVVPRTMVRELFFLLCSTGESPAIFQPIITKGGLCSSMVVYPDETAKNFT
                     NPQHIGFVYSQLAMIPFVPHAFPSYGVPFLTLPTHVSYCWIEEIPFGRATLTRQGDHL
                     IIHAEQLTWTSKRITNHGHKKMARYTAQFKGTLPDDFLNGSQVWKSSKNVQYEFMGLL
                     FTVNIDTLCLDLHHKQCIGSISTSHCHRVADNKLTARNMPRSFAFYLLLENQQQCNLQ
                     FNRNPYLFFSGDGLNSPLLNEPNPFYLTVHAPYDISFSQHPRQTIEVDIRYVQSGSRC
                     FLVANVPHEDSFYTGMCLWRSEALKITLWSRLHTTIIPQGTPIAALYQINETDGNLYA
                     YNHNTVFRRVHYADTTTFYLNDLKLPTNNFLTSP"
     misc_feature    complement(185150..186385)
                     /locus_tag="AA805_gp77"
                     /note="Protein of unknown function (DUF570); Region:
                     DUF570; pfam04489"
                     /db_xref="CDD:282358"
     gene            186973..187227
                     /locus_tag="AA805_gp78"
                     /db_xref="GeneID:24284883"
     CDS             186973..187227
                     /locus_tag="AA805_gp78"
                     /codon_start=1
                     /product="UL30"
                     /protein_id="YP_009137494.1"
                     /db_xref="GeneID:24284883"
                     /translation="MESGGHASERRRHLESLKRMMRGHAAVIDLQRMLEYYHTLSSED
                     QPVFWKTAQEEVEAELNKDDMADDQKVCCRLFRLCRMGYK"
     gene            189509..191263
                     /locus_tag="AA805_gp79"
                     /db_xref="GeneID:24284884"
     CDS             189509..191263
                     /locus_tag="AA805_gp79"
                     /codon_start=1
                     /product="UL27"
                     /protein_id="YP_009137495.1"
                     /db_xref="GeneID:24284884"
                     /translation="MATGGVIAEDLYSNPRTAFEFVEDCPDDDFCHNFMRTYLAPVRD
                     RRQAVLMGLCKAPGPKKKSKEEKPKEKRTGASQRPKNTSNNNKSPIVYVRRSFLANSA
                     FATAHGKYNIRGLCLQADLAVWGLLRGVSSRPEPGNFCWMNVSQFRRVVAAGPFLPEI
                     SRSAKRIAVAVATGQYAVCTLLNYKVFGTKTHYVRQLCVLTDELFRRLSGTMCLFLNP
                     DERELIDRCSPVSLCKKLSLNYRAQKNAVFFHPRFHVKAEEALKALYAKFCTCGDCHE
                     SPLPNGSDATAATATESPRPRLEDAELRLLNYTQLGKFHLPAIRHLTASEQLRVQQSV
                     ARDLGFADWSNTLVDDFFLLPVGMSCGTPCQGYAMYLMSNTVLALRVIRLLYITVRHE
                     QNACVRALCRDVDCLIKMFRYESFSIRKGLVQNAAQRMEVSRFRRHVQDLKQIKFTVS
                     DLVETFCEFMKIVNRIPDYQCVSMNIKRELVLLHLLKLRRVYDFSSPETRKSERLAWY
                     YLRHGDVPLDAGLLMTFSSLLADCELSNNANRCRRKVPFEIPASAAVTVRYQGHLEKL
                     SRLHVRRFRPHEVGGCAI"
     misc_feature    189740..191260
                     /locus_tag="AA805_gp79"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03166"
                     /db_xref="CDD:177548"
     gene            191217..191933
                     /locus_tag="AA805_gp80"
                     /db_xref="GeneID:24284885"
     CDS             191217..191933
                     /locus_tag="AA805_gp80"
                     /codon_start=1
                     /product="UL26"
                     /protein_id="YP_009137496.1"
                     /db_xref="GeneID:24284885"
                     /translation="MFVVFDHTKWAVVQYEIDQRQDEVIDTTTIRMATSRETGCVFNV
                     EEYVRRNRGRHFDVMWPRGYTLFVCDADDTILTPRDYDYWRLLPIMKGQLRVIGTLGT
                     EEMFSWDRPVAAIGGGGEVFCYEVGNTNYVVKAADSLSALFKEGVRPGYFDDVRRARA
                     GDLQQAQRRGLRRSSQPPVDVSASLVPRPRLSRQNAVVEGEELSHDMFMEGLLPSSLF
                     TPGTGQPDFRPSDSDETSPQ"
     misc_feature    191343..191660
                     /locus_tag="AA805_gp80"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(191985..193739)
                     /locus_tag="AA805_gp81"
                     /db_xref="GeneID:24284886"
     CDS             complement(191985..193739)
                     /locus_tag="AA805_gp81"
                     /codon_start=1
                     /product="UL25"
                     /protein_id="YP_009137497.1"
                     /db_xref="GeneID:24284886"
                     /translation="MHRRREHQYRPSELSGRLYTYGDGDNDVFSQSDSRRPTNEMDAI
                     NRMEAGLLTPSDVSDHTKSSFELVSDTNSDSEAEVERGRRGGLATHRGRAPSSQYSRH
                     QQYVSAHRRVSRGSAASLPSSEEHELVSHSSDEQDYCQETDDFRRRSIPLFDKLCFEK
                     SVTRNLGFEPNVISPPNTEFMKLLLYEFSIQHISRVNHCIPMPTFALISLIDPVVKIA
                     SAGERDLTISIVTHAVLVNYYYNSKVKIRSMQHSLAATVKAPTVRNITAYVTNLTPAG
                     RAAALALHFLTHEKVVYEPQYQVCLRRLHDELRKRRSSESPSTGEIYECIRDYNLIFL
                     SAPYTTRGALYTYRNNLQKLTNGYKSDLKLLCSEKLNEEHFLNDLTFLIAAQIMLIQF
                     QRNLDILRLYLIHHLQNLSNLIYLIYIQFPSLRSDYLQATEAIYRTTNSPDDELLFQV
                     NTWLFDFLRAVRHLDAFVSPDYVMCALRQWTMGRDDESRTADTMLRDAALQDPLTKHG
                     NVHSKCLTRDVCLMRLHSRPTSRHTHVEHIMVPFPTIQKLYQDNISADERECDSRRQA
                     ALRTFLELNGNHPASRFT"
     misc_feature    complement(191997..193739)
                     /locus_tag="AA805_gp81"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03249"
                     /db_xref="CDD:223023"
     gene            193829..194752
                     /locus_tag="AA805_gp82"
                     /db_xref="GeneID:24284887"
     CDS             193829..194752
                     /locus_tag="AA805_gp82"
                     /codon_start=1
                     /product="UL24"
                     /protein_id="YP_009137498.1"
                     /db_xref="GeneID:24284887"
                     /translation="MSYTVLSDLGSLSMTADFGPGCLNAYVRLNSGQRISVPWPRGWY
                     VVLQELEADEDYNEEDIKRLGQYPCCEVKLTFVGRVVGDPVLVYGQQKKTLIVLAAED
                     GQVFAYVEEDAALYFVARTFCELERVGFRAVDVLYCPRYLRSSAVKRAFRGLCRSGNV
                     GPEAVARYVTRHQGECLHMAYPEGAFLRLCNLKCFENSSNGGHMLRSLRQLFGDEVVC
                     LGTVDLRGEMPSSPPALRWSATRVPIVMADGGRVFCMDLMNLRYVRLADNLSTFMCLG
                     LRQLLENRRFTGEHEIHDTIPDCPRGRQHDD"
     misc_feature    193844..194743
                     /locus_tag="AA805_gp82"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     misc_feature    193874..194239
                     /locus_tag="AA805_gp82"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    194309..194680
                     /locus_tag="AA805_gp82"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(200651..201574)
                     /locus_tag="AA805_gp83"
                     /db_xref="GeneID:24284888"
     CDS             complement(200651..201574)
                     /locus_tag="AA805_gp83"
                     /codon_start=1
                     /product="UL14"
                     /protein_id="YP_009137499.1"
                     /db_xref="GeneID:24284888"
                     /translation="MPLQSTNAFLLTVLTTVHCIPPSYWDRLMRVSPSDTDMVSAPTM
                     PPYGDRFNLTCEFPTGGWTEAAVQIRFCNTPNCRSLLLVNSKQITGEFQNKSHEQLQG
                     LRWKLETEGPVQRLTVSFLVTSNVSGIYQCAIVNNMDVDVLKTTVVISEVELRRRPHV
                     YCDLQFGEQSQTQYLWTPDPEKVRLVNCGEVGGLVKNTWHKHLHYAVGNSGMQPPCDL
                     ERDMSLCHRYVFASMRDNNCTRAAEQERALILRGEPLEKDEWSWICVSGLPTLCLLGI
                     LTSCVRLRQRRNRRWRRKREDEESRKSKKTN"
     misc_feature    complement(200735..201547)
                     /locus_tag="AA805_gp83"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            complement(211668..212615)
                     /locus_tag="AA805_gp84"
                     /db_xref="GeneID:24284889"
     CDS             complement(211668..212615)
                     /locus_tag="AA805_gp84"
                     /codon_start=1
                     /product="RL11G"
                     /protein_id="YP_009137500.1"
                     /db_xref="GeneID:24284889"
                     /translation="MLRSLWYFGYMQTVLAVLANSEPTCNLDCNCNSTCGFLYNVTNA
                     VGYYQNNVTLHTSISHSNHSNMHVGMWIRYNFPAQSYALCSVSGYKVAKEHHDGWCFE
                     CNETSLTLCDLDTNQTGSYIFKNLVGLTQHYTVTVVPVPRPPAPKITTITNCSVIFFN
                     EYLWKNASLSYVTTVPPTTTTTTTTTTKPTSTTHRTTAGRTITQTTHTTTPGSSATTW
                     STNMPKYISKYSKLATFASVSAGLFSFALVVFLLVFLFALFNLKKQGETEASGPPKKS
                     SVKDSCKKKKGRPGEPIYHLITENIQTSTSCVVEKSMFS"
ORIGIN      
        1 cccggcagag cgctcagtca tgcactgggg gaggatatct gctgccgttt taggcctttt
       61 ctggcacgat gccaaacagc agcgtctccg ggagctgcct tcctggcgcg cagccaagat
      121 ttcccggctc cgggtgcgca gttgctggct ttctgccaaa acttccagcc ctcacggatt
      181 tcctggcaca aagccaaggc tcgccaacct tcctccgccg cttgttgcgc tgcaccttga
      241 ggtgactaat gcttttcctc ttgttgcaca acgctttccc tctagcgctt gttctccgtg
      301 cacctttggc ctccaggctg cacccgacgc gtacataagc gcctgtgcca gcaaccgcaa
      361 gccgcacaac acaccgcgcg ctgcccgcac catctaggcg cattatcaat attgactgct
      421 cgctgcgact tttaacctcg cacgcgtcgc caagcagctg cagccatgcg ttgcagcttg
      481 cggtccgcgc tcaaggcagc gctgtgctgc tgcacggcgt gcgtgatgac catgattgcc
      541 atcttcgccg cagccgtgta ctcggcccta agcggcgacg acattctcgc caatatcagc
      601 aaacccaaag ctctccgtaa acgcattatc accacacaac ctcgggccac gacgcctacc
      661 tgcaaaccta ctgtcatcac tgtggatgtt gacgagcaca cgtgtgccgc ttcggactac
      721 gagaccgggg agagccagga cctgacagag gtggtgattg acagcgacgg cgagtctgct
      781 cccaaatgcc acagcaacac tcaagagccg acaaatcagg aagacgctct gacgctgacc
      841 gaaagcgaga ctgaaatcgc acaagcactc gccgacgcac tcgcgaatat gctgcctaag
      901 aacttgctga acactcgcag ccagtaaatg gtctgcgcgg acgccgtgtg cacgagcttc
      961 ggacacgcat gcagcagtgt tacgcattta cgtcagcttc cacagccacc gctccctaag
     1021 catgcgaatg gtataaaact cgtcactagc ttcgttcacc ttgccacatt ttgcgccgct
     1081 gcctgtggcc aacgaaccat tgccgtccaa acagcggcca cccgggacac tttgcacgac
     1141 tccgccaacg ccgccgtagc caagatgcgc caccaggacc aagttgtccc cgaggtaaga
     1201 tttgctatgc accctctgtg tatttacctt gcctgtgctg cactgtattt gattgacgtg
     1261 tattctctgg cgtgtgctcc atggtgtgtg cctttcaggg caagcctcca tctcctgact
     1321 cgtcgacggc cgtggatgga ccgtgccacg ctgctgcacc agcaccccag aacgtgtgcc
     1381 aggaacccat cgagacgtct cctgacgcgc cccccaaacc gcctcgactc cacaagggcc
     1441 gaggccgccc gctgagcacc agacaacccc cagacggcca gtccaacacg aaggagccct
     1501 gtattctgcc accgagacgc aaacgcaaga agacggcgtt cacacgtccc agccaccctc
     1561 ccccgcctcc cccagcccct gccaaccccg tcactgtgac catgaccatc agcccgccac
     1621 cctctcccat gcctacctgt cccccgcccg ttccccccaa gaaacgtccc gagctgagat
     1681 tgtctctcag aaaaccaaaa acggtgtgga tgacaatgcc atgttttaat cctgacgatg
     1741 cgtccccaga gtatgactac ccctcctcca gttcccgccc tgtgttgtaa gccgacttca
     1801 cccggagcag tcacgatgcc gccgacgacc tgttccgcgc gtcctgctgt ctgcgtcgct
     1861 gcacccatcg cccccaccag cctcgcaggt gaaatcgccc tttcatccgc ttccaccacg
     1921 acaccctgga gttctccgac agcggaggac acgacaccgc cgacgcgtag gacgacatcg
     1981 acgagcgaga cgagtcggaa tccagcgtga gggagcgact gcgcagcgcg tggccgcgcc
     2041 agtcctggca ttgacaccac gcgtcgtgcg ccaccttgac ctggtgtcgc cattgggctt
     2101 ccacctgcgc cggccagccg ccactcgcgg ggaacaactc atcggtggga ggctgcacgt
     2161 attccacatg cgctttccaa tccatgcagg cgcaccacaa atcgtgcgag tcgtcagcga
     2221 cccggcgcca tgcgagctcg cgcatgggcg tgtgtcccac ggcgccaacg atgctgccct
     2281 gttccatgct tgcggttacg aactctaagc cggactctga attcctcccg atgcagccca
     2341 ccgcactggt aaacgacccc cctcagcatg gcccttacta gtttgtatga cttcgcgtaa
     2401 gtgcgggtat gttttgcgtg tcggtcgtgc agtgtcccgt gttctgtctc tgtgtttgct
     2461 tgtaccgcca aggacgctat aaataaatcg tgcacacaga tgtcagttgc cagggtttta
     2521 ttttacgcac agaatacgtg gcacacgatt ttcaaactcg gtacattgat ttcatccaca
     2581 aagaatgcca taatgcagac atgaatggca tagacaaagg caacccacgc taagtaccag
     2641 tactctgcat agattacgag tctcataacc agccacgatg cgttaacact tgcaaagtcc
     2701 actctcagtt cgggttcgca cgtaacccaa agttctgcaa acgtgttgat gtacacacgg
     2761 acgaccactc tctttaattc tggtggtact tcgtacccta gaaagttcca gtagacaccc
     2821 tgtccttgtt taaattgaac gtcccttcga gcgaagacaa atctctccca tcccccattg
     2881 gcgctgtgta gctccacggc cagatggtaa tcttgtatgc gcccttcaac ggccccacgc
     2941 agaaacaatc tcgtgccttg tatgtagcag acattctcct gcactctgta cccgtcgtct
     3001 ttcacggctg gtgtcgttgg tgttgtcgga ggtggctgct tcggtctctg ctggcttttg
     3061 tgaacatgct ctgcagttcc ttcatacgga cgcggatgct gtaaatcacg actggaatcg
     3121 tgaaaccatg cagtatcccc aaacccacag ccttgtatcc gtataaaagt gctcagcaaa
     3181 caggcccaag tcaaccagga catatcgtta aagcagtgag tccgagcggt tgctgaaatt
     3241 ctgaacggtg tttggggata tatacaagaa acccttgacg cacgggatgc gcgtctgcat
     3301 cttgccgcag ccaagcccag cccataacgg cccctgtcca atgtgccatc ccaactgaaa
     3361 cgaaatacgc aacagactgt catgtgttac aaccacatta gttttattaa taaaatacga
     3421 agtgcatgtc aatctcggtt acaaccgagg taatcagttc atggttggcc accgaacaag
     3481 cagaaactat gttggtgcca ctgaggtagt tcgtaaactg ctccgttcct ctctgaggtt
     3541 ttcgttaaca gtgctgcact gtgtgcttct ttgagatgcg aacggtctgc acgccatcgc
     3601 accacgtctc cttgacggac agctcctcgt ccatcatggc gacctgccaa tcattctgtt
     3661 gttgactgtc agtgacctgc aaacacaaaa ggtcaagtgt gttatcgtta cggtaattga
     3721 ttcaagtgga ttacatacag gcgtacaata acgaacacga aaacaaacat accgagacaa
     3781 acatttacct gcaattacac cttggatggg ttgttcacac acacttctcc catgaggcga
     3841 atacgaaagt ccaccatcag cgtcagatag gtcaccagcg cagtgctcac cacgatgcac
     3901 aacacgattt tcgccaacag ccaccaatta tcttccaaca ctatcttctc cgcgtaccac
     3961 agtgcgcttt cgggagataa ctcaatctcc gttctcagat tgcactcaaa cgtatgatag
     4021 atatcgtaga ggcctatgat caccagatcg attccatgtg tagtgctgtg tacgtcgtcc
     4081 tgcacaacgt aggttctggt agtttcggtt gaatgtgtat gctttacggc aaccgttcca
     4141 tccaaacctt ggcgatggac tagaccgtaa atgtatttca ggtcacgaaa atcgccttcc
     4201 acgataaagg ttccgtaaac tttgccgcct ttcagatgac atgcggaatg tagcattcga
     4261 tataccgaag atgttggcaa cggtgccgac tctgttggct gtaacaggcc ggttaagata
     4321 atgcccagga ggcagcacag agcgcaggca agtttcattt cgattgctcg tgcaggcgct
     4381 cgtagttcga gctgtcaatc aagtctctgt agcggtagct cgtctccaga cgcgctgagt
     4441 ggactgcacg gtgtttcttg atatatacac catttttgca ggaccgccca ggaaaaacca
     4501 gcgtcaggat gattgacgtg tgtggaaaga tgttcgttac ggtttctaaa ccgacacgcg
     4561 tcagcgaatg tgtacccggg caccggttac ggtttttcct ccgaatgtaa gccacaccca
     4621 tccgagattt ccgagaatcc gtcttgtgta tatctgagcc cgcgtccaac cgctcatttg
     4681 tcgttcggat ctccgctggt tcggatgtgt cgttcgactt tcccaaaggc tcggcgctat
     4741 agactttact acgactatct atggcgcctg gcctctgggg aagttggacg tgttccgcgg
     4801 catctgggcc gggttggggc ggttgcgagt cggatagcaa tccggattcc ccgaatgtgt
     4861 cttttgactt tctcggccgc cctctggcac agatatgtat acgaatctaa gtgcaggggg
     4921 tctgctgagg aggtcagata gataccagcc tcgtacgaac ggatgatgat ggatcatccg
     4981 accgtaccgc acggcttgcg cacatagaca tgtaaagaac ggatttatgt gcaggggctg
     5041 tccggtcggt ctggtgattg acaatcacgc acacgtcggg agagagggag tgggaggatg
     5101 gatgcatggg gagctggtgc atgcggggtg gcgtgaaggg aacgcaagat gatgtacggc
     5161 cgcgcatctc agccgcatcg ggcatgtgaa aacctggacg tgcaaggggt tgtatgttcg
     5221 tgtctttcca tcaacagccc catgcacctc ccggtaacga catgttgtcg ataggccgtc
     5281 ggatacccgt acgcgcgcac tgccgaccga ccgctcatgt gctgttgcaa tggtcagact
     5341 atgtcatgat agtgagcgct tatcccaccc ttatcgtgac acagtttgcc cactgaaaca
     5401 gatctactcg aagcgcaaga aacgacgacg taaacagtgt aacaataaat atgtacatct
     5461 tttaattaaa gagattgatt gacaagtcca atgtgggttt tagcgtcaat ggcttccgca
     5521 gcgtctcgcg tgccgagcaa tgtcgcactc gtccatcaca tacagcatga gagatgtgaa
     5581 caccaccgcg aacaggatga gcgccatgta caccagcagc gtgagtcctc cgtaatgctc
     5641 cagcagtacg agcacacctc tgggcgcttt cgggcacccg aacagtccgc gaggccccag
     5701 cacgtgccgg tgcttcagct ggggatcgca ccccaggagc tggacggctc gttcgtagct
     5761 ttccagaaag gcgttgcagg cggggctgtc gtctcgcaac gggcactggc gatcgcaggt
     5821 cgggctgctg ctgctgccgg agagcggacg cgtttcggca tggtccctca ggtgtccgga
     5881 ccttctctgg ggcagttttg tgtcgttgct ccatgcggag ctgacaccag agaaggccag
     5941 cagaaacagc aacgagcaca ggatggtccc gtcgacccac ggcgtgcaca ggggcttcat
     6001 gttggtgcgt tgacagctaa tctgtcactc gtgctggagc cgcgacgaac gttgattata
     6061 taccttagct ggaagtgacg tttccaccat gaccgaacgg aatgggtgtt gacaatcgtt
     6121 cccgtgacgt tcatcgcggt tagttgtgcg ttcgtgataa gcctcacgag aacgtctgtc
     6181 tcgcatcacg tcggcgagtg aaccgcggcg gtcaccacag gtgttcagtt ctcagtgtct
     6241 gtagaggttt tcgccacatc gatgtcgtaa gttgattata aaactttatg atcgatgcga
     6301 cgatatcttt cccggtgcag tttcaccagc actcggcaac gcgctgcgtg ttccatggca
     6361 tctttgtaca acagacgcca agcataccgg aacatgagca tcatgacaat ccatgccatt
     6421 gccatcatgg cgatatgtcc caagaagccg tatgtgaatt gcagccacat ttctatcatg
     6481 tagtttttga agagtttagg attccaattg agtccatagg tgggatgaca tttgatgaac
     6541 agaggtttgg tttcaggttc tatgtgcatg gtgatatgca catcatgttc gtaggcgggc
     6601 agttgaaaag catagtaaaa gaggcgctga ttttctacgc gtacctcttt tgtaattcca
     6661 aactcatttt gccattgagc ttcagatacc aacgctttag gtggaattcc gtatctgtat
     6721 ttcttagagt ccatgatgat gggcggatgt tgcgcatcgg tggatagcac aaagaacaag
     6781 ttgtcataac gcttttgaat aatctgaaca tgcaaccaag cggtgtccgt gaagttgccc
     6841 gtgataatgc cactggcgta cagatgatcg ttcttcaatt cgcatgtatt gctgaattca
     6901 tgatacatgc gtggtatcac aggttctttt ttgcagtacc tattgagttg tatccatctg
     6961 taatggaatc ttcggttata tgatgtggta agtccctttt tggaaaaaaa gcagcataag
     7021 gagacttcaa agagcaggaa ggtcgctagc aactgcagcc acgggtaccg caacatcttg
     7081 acgggcaccg cgaagtgctt tagtaagccg aacggggttt ttaaatgcct taccaaagca
     7141 gaagtggggt aaacacagga aaggcgtggg cgactttgca ttgacgtcgc gtgcgtgtcg
     7201 tcacccacta ttgtttccat cacccccctt gcgcaaagcg agttgcataa gacaaaacgt
     7261 acgcgatcat gaaactacag agccatttta aggaagtgca cacttttgta atcactgttc
     7321 ctttttattt ggatgcacac ggtacgcgct ctgcgaattc gtactcccgc ggcatgtgcc
     7381 aaaccgccag agcacaaatg ccacaaagta cacggccacc acgttcatgc acactacttt
     7441 cacgatacac cgctgtctat cttcgtaaag cagtctctgt atgtcgccat tgaataacga
     7501 gctccaggag atggccgttg tcggggtaca cggcagtata caacgctcct tacagggttt
     7561 gatgtgtaag tctatgaccc cgagatccgt gggtacggga tggtagatgg taaaacacat
     7621 gaccatctca ctcagatacg atggctttcc cggcaggacg agtagttctc cgttttttcg
     7681 gctgtaggat aaaaacttat aactcatggt acacggtgac agctctccca tcacgcacca
     7741 tgtagcgtcc aggatgcctg cggtgaccgt gcatgtggca ttggtgctgt gtaccgtcac
     7801 gggtgcccaa atgtggtcgt ccccccgaac ctgcaccaac gcgcacagta gacacagtac
     7861 gatggagcca ctccccatgt taacaccagt ttttgtggta gtggcgcaaa gagtgtctga
     7921 gaacgcccga tgtgacccac tgcttatatt cgtagtctgt cgcgcatacg cccaccaccc
     7981 tcacacacca ggtttcatgt cccacccgtt tcttaaacaa accacgagac tcaaaaagtg
     8041 tagaaaaata aacgttttat taatacaatc agtccgatgt ctggggtgag ggggggtctg
     8101 gactcagatc cagaaggcag gcagttcgac cttcacgatc tcgttcgcgc tgctggcatt
     8161 ggcgctaaat gggcaaggca gtctgtagaa aggcctcacg acggggtagc tgtcagcccg
     8221 tctcgccaag tacatgttcc agcgccagtt cagccacacg aagcacctgg gactctcggc
     8281 gttgccaata gccttggtct cggcttcggc gtagatgtcc gccatctcgt tcagccactg
     8341 ggtctcattg aagttggggg agactgtcac gctccggtta gcggatgagc agggttccgc
     8401 ggagacagcc aacactccca gcagggccac cagggtaacg acgacgagcc gcttcatgtt
     8461 aacgaggctg tgaaggcttt ctgtgcaagc gcctgtccgt caaacgttga ctgacacaaa
     8521 tgcttgtcaa tcaacagtca gcaaggctct ggtccaagat aacttggcag agctatgctc
     8581 agagcaaacc tggcacggct tatatgcgcc tggctcgttc cgtggtgcaa ttcgttgacg
     8641 cggtacgggt ttgcacacgc gtcacgatac acgcacatcc acttgcttca tacctgcact
     8701 tgttaaatca cagttccgca tttctcacgg gttgactcag tgcatgttgt caaagaggcc
     8761 gtgcggccag taatctctgc cagccgtgct ccagtatatc tgaataatca tggacgcggc
     8821 aaacatccac tgcacaaact ttaacagcag tgcccaatag gcaacaaggt tccggccctc
     8881 gaacagcagt ctgtcaatgt ccgatacgga agcccacatt gggaaccagg agatttcaat
     8941 ctgtggatgg catctcacgc tctgagcggc acacgtcttg caaggatgca catcgaacca
     9001 gatgtcggta aagtatttgt ggaactggtc ggtgtgcagg tggtaccgct gttcaacgtc
     9061 cgtggagaca ttttgcggag cgggcatggt tccatatccc gttttggagt accacacggc
     9121 tctgacacgg aggtctggac tggtagcgtt acccgtgaat gcccaccaag cttttagtgt
     9181 gtgagagttc agtaaacggc attcggcgtc caaagtgtcc agacgataca cgggcgatgg
     9241 aggtttgggc ggtgctggca cacgatgtac gggcgatggg ctttcaataa tcttgtaggt
     9301 atcgtttatg ttgatgatgt ttatcttctt attgtccaaa tcttccgaat ccggaggcat
     9361 gggaggcata tcgagaagcc ccagctcctg tttgtccttg tcgctgggtt cccataagaa
     9421 agccgtgaat ggtggtaggt gagcatggct ttccctcacc gagtggtgta cgcaccagag
     9481 caacaggcac gcgaagagca gtttcatggt tgcggtcggc cgaaactgct tcaggagctg
     9541 tgttgaactg ccaaacgagc cggctttatg tagctacatc gtgacgcgca gatgacacaa
     9601 gtggcgccaa gctgtctgcc tggcctgaat cccaaaactt gttatgttcg aaaagcgcgc
     9661 ccacatcaac ggttttaacg gtcggttttc aaaacggtgt tttagctaaa tgatgcgtgt
     9721 cgggtgacct ttatttgacc ttcatccacc acggtggatt gcgcaatata ccaaacgcca
     9781 cgcgtgagtg acaggttttt ttattgacac acgtattcac acaacgggtt gctgggggct
     9841 cagaaagtaa tccggatacc agccgtcggc cgtcagaggc accacggtca tcatcagaac
     9901 tagcacttgg tccacgtaca gcaatagcgc ggctcggacg gcgtgccgat cgaacaatga
     9961 tcgcggagcg tggcacagaa ccaggagcgt gtcgtggagc agagccagag tgatcaggtc
    10021 caccacggtg gcggtcaaca ctgccagcca cttttgagcc ggagtccagg gctggtagta
    10081 cacgatggcg cagaatagag gcagggcgag aatcaggaac gcggcgatga tggatccgcg
    10141 cgggcgagtg gaggccagaa cgcaggccat gatggtgcag cccaactcca gaaccaggga
    10201 caggaggtat gcctgccaca gtacattgcg ttccagacac atgctccaga tcgccagggc
    10261 gcagctgttg atcacagtgt agagtacggc cgtcttgacg ctggtggcgt ggtaggtttt
    10321 cttgcgaagc ttgaaacgca gtatgctggg gacgatcata atccagatcg gcagggtttc
    10381 tctcacgtag ggtgcgtgta ttcgccaagc acacatgatg cacactaagc agaaggccag
    10441 ggtcacggcc atctgtacgg ccaggaccgt atacacccgc gtgagccaca caaaacgacg
    10501 cacccatctc ataatgtctt cgtagtcctc gttcccctcg cgggacgtgt cctggcggcc
    10561 catctttcac gacggtctgg ggaaacacac tcgcgcgtgg ggttttatag cgtcgtggaa
    10621 ccccatgtgc ccctttggcg ttacgacacg gtagcgtttc tggtggtgaa cgaactgaaa
    10681 atcttactga agctcacatc ccagattttc gaattgagca tgagaagcgt gacttggaat
    10741 aacacaaaat acattacgta aagcgtcaac gcccccctga ttagctgttc tgggtgcagg
    10801 tgtttttggt gttgctgcgt gacccagaag tttaggatga taaaacaggt taaaaagacc
    10861 acatacacgc ttaacatgat gtgggtggtt aggttagacg attgggaagc acaggcgata
    10921 atcagcagcg ccgcgacgct ggcgatcgtc cagatgccag ccagggcata gcgacgggtg
    10981 tagccgctcc cgccgcgctc aaagaacgcg ccgcaggtga ccatggcgaa cagcaccacg
    11041 gacgctatgt gagcagtgat ggtggtggag aatgtcacgc agaaaccgaa cagggttata
    11101 accgatgtga tccagaagac gtaccccgtc atggtcagga ggtcgctggc gtgtttctcc
    11161 cagcgcacca ctaaacaggc cagattgagt acgggtatga tgatgattaa aatcggggca
    11221 gggtctgtct ggcagaggtt ctgccattga ggataggcta gccacatgag ggtagagagg
    11281 gtggaggtga cagtgacctg aaggagccag tagctgtata gctgtatgag gatcttaaac
    11341 cgttgtatcc agataatgct ttcggtgaac cggacttgga atcgaaggac ctccatggct
    11401 cacaggttgt aaggcgttta ttgtgtacag gtacatggca tttgagagaa taaggtgtac
    11461 aggtgagcat atataacgtt taacatccaa tcgctacaca attacgtcta acatccaatg
    11521 gtaacacaat tacatttaaa ggggtccgga cacaaggtgc tgttggtcgt aacgtttagc
    11581 agttccgata ttccggtgaa cattttgctg gggtccacag tccagaggct gggcgttagc
    11641 aggtacacat acatgtagta cgacgcaagc atgatctcac aatgttccaa ggccattaat
    11701 attaagtgta cacgagtcct gtagatactc ttccatgtcg tgtcccagat catgattccc
    11761 atggcggtat gagtgacagc tgatagtata ttccgtgcca ctcgcggcag ttgtccgaaa
    11821 tagaatacaa gcaaggtgat gggaacgacg atgcaggcga cgatgcggta actaaacggc
    11881 agtggagttg cgatccagat ggctacaccg ctgacggtga tgaaaaagca cagcgtcagc
    11941 agcaacccga atgcggccgt agggctctct gtacaaaagt taatcaggga cgcgctcaga
    12001 ggcgcaaaca tgacagacaa ggcggccgcc gcacctttga ggctggagtc ttccgtgcca
    12061 cacatgttgc tgaagaacat gaaagccaca acggccacca ctagcagaat gctaggttcc
    12121 ctcacacaga tggttggttt caacggcaca ttcgaagaca agacgattaa acccacatgc
    12181 gtacacacag acagagcgac gataaacaca caaaagatgt acattcgaat taatggaagg
    12241 tagcgattca gccaagccgc gtgttcatgg ttcaaccgaa tttcaagaag gggtgctgcg
    12301 tcttcaggct cgggtttcag aggcttgtgc tgaaacttga tggtcggcat agtcgctgga
    12361 accgctgatg ctgtctggct gttcgcgaac gttgaagtgg ttcgctgagg ttgtcttcag
    12421 gaagctttta aggcgtgagt tcgcaggatg ctccgtgcag atatttatcg actggagttc
    12481 gtggcggttt cgttgtggat ggaaccgctg gatatgtgtc tgagtatgga atatctgagt
    12541 tccgatgtcc aagtgataat ggacatctca tacaaaatga tgaagagaaa gtaaagtaac
    12601 agcgatccgc tgctagttct ggttaacggc gccaatttga gattataata catttccgcg
    12661 cctacggtga cctgtagaac gatgtgaagt atggcgtaga tgacggccgt cacgatgaag
    12721 gtcttcgcat acactgacac caatgtgaga gcaaccacaa tacacagaaa gtaacacaca
    12781 tataaacatc tggcccatcg tgcacataca acacccgtag tggtatagct gataaacatc
    12841 aacagagaca tgcagaacat ggatacaggt atttcatcat gtgtacaggt attaaaaacg
    12901 gcgttagaca cagagaccag caacacacag tacacccacg cacccgggct gttaaatttc
    12961 tccgctctaa aatcaaccac gaaaaacaac aaggcaggca caatcaccaa aagcactggg
    13021 agcgggcaag cctcacagtt ggcaaacaca tagaagctgg gaaacgtgaa gcgcgcgatt
    13081 ccgtagatga ccacgctcca ggccagggcc accaagagcc agccgtggat tcggatgacg
    13141 agacatgtgc gcggcatcca tcgcagcgta gaacgagtct tcgcgtccat gtcttctcgc
    13201 cagagcgctc ggcgtccgaa tacggcgaaa cgctacgccg gcgccttact tatggcagct
    13261 tccgagccgc tgtggacgac gcggtggagt cgctgtgaaa ataagcaatc agcgagctaa
    13321 acgtgctgtc ccatcgcgcc gaccagaggt tgggagtgag gagaaaggtg ttgcactgga
    13381 gtagtagcat gaaattgata tacagcatca tggccggcca tgtgacttca catgatcggt
    13441 gtatgtgtcg gatggccacg gtttcgaggt ggacagtgat ggatgtcaga accagaaaca
    13501 tcatgtaggc ggtcatgaac agcatgtgag taggcgagag ctgaccgaac gagtacacga
    13561 cggtcatggt gaagagaatg attaagctaa acaccacggc cagcagcttt cggcggtaca
    13621 gattcatgct ttcaaagaca gccgtcccgg attgtaaaag aaacatgagc gaggtcagta
    13681 cgaagctgcg caggatcgtc cagtcgtccg cgcagatgct gatgaggatg caggacgctg
    13741 tgatgtagta tgtttcccaa accactccgt tgagcgtgtt ggaggcgcgt ttgtgggtgt
    13801 tttcgagaat gaggataatg gccggaatgg ccaccatcaa catgggtgcg gggtccgcct
    13861 tgcagtccac ggtcaatgcc gggcacgccg tgcgatagac gccatagagc gcgatggtga
    13921 cggacacttg tagtacgaac cagccgtaga ttttaaagat ggtgctgaag cgccgcagcc
    13981 aaccgagact gaacgcgcac atggcgcagt tttgcatgcc tctccgcagt cgggtcggga
    14041 gtaatagcct aatggttagt gagcgagttt ttatacaccg aaactcctgg gaaccatcgt
    14101 caaggagttt ttaccagggt gagtaccaca tgtacaggat ggagtaatgc attaggttga
    14161 gatggcaata caggatgatg gccgtgcgtt tgacacgcgc cgccgtcatg tagcgctcca
    14221 cgtccgaaag cgtgatcgtg agggcgccca cgaaactgac catggatagc acgtagaaaa
    14281 ttgacatggg tgtcaaggct tggctgtgtt ccagaacgtt gcggagaacg agattgatgg
    14341 tgaggcagac gatggaacag atgtcgaaca cggcttggta gcattgcagt cgacgcgcgt
    14401 gccatcggat gaaggcggag ggtagaaaca gcacagctat gacggcgcag ctgtacacga
    14461 tgttcaccgg gttgatgcac acgccgaaaa gggcgtagga cagggcgaga tggatgatgt
    14521 agagcaaaaa gcccagattc cgcgtcgccg cgagggaagc gtgttggtca tcgtctggtt
    14581 cgtacccttc tcgcaccaaa atgaggatgg gactcaagat gaccatctgt cgcgcgggat
    14641 acagcacgca cggaccggcg gcacagatgg gttctatcat ccgcacggct ccatagacga
    14701 acacggtcac cgcgatcccg aaaaacgtcc aagcgtacac cgaccacacg agaatccgac
    14761 ggcgtagcca gagcggaacg tgcggagtcg ctgctatcat gctggcgagt ttatgtgtag
    14821 taggatggag aggtttcgtt cgtcccgctg tcggagacgg aaaactcttg catccagtcg
    14881 gtgagcttcg ccaacgagct ctcggtggtc agaatgagaa ggatcagcaa gtaacagtag
    14941 actaaatcct cgtagaggca gaggcccagg acgtgtgttt ctcggtcgca cgaaagctcg
    15001 aagagttgtg aggtatcgaa agcaatgacc cctaacataa acgccaggac gatcacgtag
    15061 tagcccagta agattttatt gggtagggac agcggctgaa aagacaaaac caccaaaacg
    15121 atgcccacga atattaggaa gacgagaacg aggagtcgcc agcgattata gtagaggcct
    15181 cccacacagg acagacccgt gcaggtgaca aacagcattc ccgacatgag ggccgcccat
    15241 gtgatgagtt ggacctcgtc tacacagaca ttcgctaaaa ccacggcacc tgaagtcact
    15301 atggtgtaag aggtcaggac ggcccagctg tcggagtgct gctttgtagc atgaagtaga
    15361 gtgaggcagg cgttggggac caggagactg agagctggca gaaagcccgt gcggcagatg
    15421 ctctcgaaag cgtccccgta aggtgtcagt aagagcatca tggcggcaat gacaaacgtg
    15481 catgacgcct gtagcgatac cgtgcgatac agacggagag tgaagagacc gtagcgatca
    15541 aacacgttgc acgagtggtt ttttatttgg gtttgtttaa ccagctttat tacagaaggg
    15601 ttcgtcatag tgttctcaat gtctcaagca cgagttatgg gcaacatgca cactcatcac
    15661 gtttatatat acaacatgaa tttcatagtc atgcgggtac acagattctt gctccatcat
    15721 cgcctatggc ttgttcatta acagccaaga ccaagatgat cctgccgttt ggttcatggc
    15781 tgcaatgatt ttgcccatcc attgattgac ggaaaagacc atggtgagag cgttgaacat
    15841 ggcgatgacg gctgtgtaca cggccaggct acgagcgagt tcggcggcct cggtgagggt
    15901 ttcagaaggc gatgggtaca tgatctgcaa caactgatac accaggagat aggcgacgcc
    15961 gctaaccaag caaaagtaca tgacggtgaa gattttgtag atgatcgccg ctttggcgaa
    16021 cgtgatgaaa aagaagaagc agaggaggca ccagccgtag ccgcagaaga atattcgcca
    16081 acgcgtagcg ttgcgaccgg cgtagaacgt cacggtgttg cacacgatga gagccagcat
    16141 ggtcagagca aagcccagac cgagactggt acgatgacag cagaagcctg tcatgacagt
    16201 gacgccggtt tcgatcgcaa cgcaggcgat cgtggaagat cccgagtagc gcaggagttc
    16261 tttctggcaa cagcaggcta tggcgaggca gagagtgggc acgaggatgg atgccgtggg
    16321 gactacgcag gccaggcatt tttctgttac gccgggataa gcaaaccaga agagcacgca
    16381 cacactcaag gtgccagcga cttcaaacaa ggcgttgctg tagatggcga cgacgctgcg
    16441 gaatctatcg atccattgca ctaggttttc atgcatccag ctttcggcca gttccgcgtc
    16501 tgcatagctg cggtggtcca tgatgtgtgt gggttgcgcg cgtcgttcgc ttcagacgcg
    16561 ctgcgatcgt tctaaatgct acgcggcaaa cagtctatct tatgctgcgg ccagcggggt
    16621 ggattttacg tcattagctt tgaccgacaa ggggctccag ccaccacttg gtcagggtaa
    16681 acttcagact gatgtcggac atgcccgtca tctgccagaa gacggggtcg aagatcatga
    16741 gtccgataat atacatgacc aggttttcta tgtagatgcg gattgtgagc ggaaaagccg
    16801 cttcgaagca atcgtgatgc acgatgcagg ccagatcgtg aatccagagt ccggcgacga
    16861 gaatcagcag cagggctagg tagcaaccgt tccaggtcgc gtccgaaacc ggcacgacgg
    16921 ccagggccac taaaaccagt gcgcttccgg tcagtatgac gggaaacagc cagcggtgca
    16981 gaccgtaggc tcccttcgag ggttgaatgc ggacgaggaa cacgagtcct acgccgccgg
    17041 tgaaaaaagc gagagggacg atggtggcca gcaagagttt gtccagcgga cgacaagcgg
    17101 tcatcatgta aagggccacg gtgttgggga tgatgtagat gacggagaaa gtgagttggc
    17161 gagtccatct gtgtttcccc cagaggtgca aggtaaacaa ggagacgatg ggcacgaaca
    17221 gccagagagc ggcaaagcga ggtatgtgtg agcagtacgc ctggaggaac gccgggcaga
    17281 gaatccaggt gataatgcac gagatgacgc tggcggtgac ttgaaacacg agggtggcga
    17341 agactttgag gtaaaacata actcgactgc caaaggcgaa gatatcgccg tcgaaaaacc
    17401 ggtcagacga cgagatcata gtgtccaagg gaagagcgtg gcgttctgcg gcggtccgtt
    17461 tttgtgtctt gtcacttaag acttggtctg agtgctgtta gtagcgcgct ccacccattt
    17521 gggcatggac agcataaaga gaatagctag aaagatggaa accgtgttga cgtagagacg
    17581 aagagccgat cgaatacaat acaggtagga agcttgatag atgaccacgg aggtgtcgta
    17641 gcacaggatg aaggagaaga aggtgataga gaaagctgag atgatcacca cgagcttagt
    17701 gtaccacggc acggattgca gtcccgtgga gatgagaaag aggaggaaga ggatggtgta
    17761 gattccggcg atgcacttcc aacgtttggc atccagtcct ccgatgtaag tcaatccggt
    17821 gaaggagacg aagatcgcca cgctcatgat gtacgcagtg ctgatcgcgt agccgtcgga
    17881 gcagatgtcg aacatggtcg ccggcacgag attgacagcc atgtaaaaaa acagggtggt
    17941 caggttgctg ggatgctgtg cgcccagcgt gtacagcgtg agcatgcaga ggatcgggat
    18001 gaacatggtg agcaccacgc cgtggttcac cacgcaaaag ttctgggtct gcgggtatcc
    18061 cagccagatc aggccggaga ccccaaaggt catgctcaga gcgaagacga agatgccgta
    18121 gattcgcatc cagagcacaa attgcttgaa ccacgctatg gcctcgtcca ccgacacgag
    18181 taacggagaa tcggaggcct ccatttcggc gttctcctgc tgaaccatgt tggttgtgca
    18241 cggagacggc ttctagccgt cgctcgctgg ctgatctaac tcttatacac gacgttagag
    18301 acttcctggg agttgggcgt ggacaaaaag tacaccaggg tcaggaatag atacatcatg
    18361 tcgagataca ggcagatggc gcccgggatg tagctttcgt agtcgattct gtgtagcatg
    18421 ttctgactgt cacacatgac ggaggccact agggccagca agcctccgaa catgacactg
    18481 agttccccga cttcgccggg aaagtagtaa aagatgacgg acaggcagat gaggaggttg
    18541 gacgacccta tgacaaacgg tctgtggaac tccacattgt tgtcaaaacg atgcgtggag
    18601 acgcttagca cgataaacag taggacgata gacagcgtgg cgtacgcgat cgagcggttt
    18661 tgaaattgaa accccgacgc gatgaccgcc acggctatga ggaacgtgta ggtcagtagc
    18721 atgtacattt ctttggggaa ttccggctcg gcccagtgca gcacacccag gcagatgatt
    18781 gacagcatga gacagaaaag cgtcatgcgg atgctcggta agagctgtgc gacacgttcc
    18841 gggaacatga gccagcacac cgcacacgcg ctcaggagca ggaggttgtg aaaccagatg
    18901 aggatgtaga ctcgcaggag aaacatggag cgtaccgttt cgatctcatc ggactggact
    18961 tgcatgtttg tgtctgtgtg tgtgatttgc acatacgact ttgctgagtg gaggagggta
    19021 gtagacacgt ctaaatacgc tgtgcattgt ttacctcgcc caaaacatgc aggagacaca
    19081 cacacatgaa acgagacacg cacatgagtc tacgaactga caagactgtt tattcaaaat
    19141 agtcaatacc aatgttgagg ggatcataaa tgctaacacg ttggagacga caagaacagg
    19201 tgaccatagc gtcggccctg cgcgcgcgtc gtaaccagag ttccctctca caagtaaccg
    19261 gctcgtcctc gttttgccat tcctttttaa ttaagtctag aagttctgga ggcggttgtt
    19321 gggatgatgc ctcgtcaccc gacagcgacg acgtctcgtc atcgctgtct cctaaactgc
    19381 cattcaccag cggaggcgac ggagactgcg tttgattctc atcgttttct tgcggctcgt
    19441 tctcgtcgtc ttcgtcatcc tcctcttcct cctcgtccgt gtcctggtcg cccctgatgg
    19501 ttctgggcgg gtaccctttg tgcacgcgga acacgcgatg gtgaggcacc ttagtggtga
    19561 tctcgtcgtg gtcttcccag ccaccgtgtt gcggagctgc caagctcagg acgctggtcc
    19621 acggaaagca ccagttttgg ttttcttgca gcacgccggt tggcagcaaa tcagtgcgtc
    19681 cccaccaggg gctcgtgggt accttgtcgt aacagcggct gttgcgcgtc aaccagtcgt
    19741 gcgcgctgtc cagctgctgg cgactcaccg tacccaacat ggaacaccac gagagatctt
    19801 cctgtcggtt aaagtgatcg caggtgggcg cccgctccag gcggctctcg ccgcgcattc
    19861 cgcggtcgaa gcgcagcatg ccgcgcagtt tgagaaagcc gcatttgaat aacatgtgga
    19921 ggttgtcggc tatgcggtac acgtcggact catcgatcct cagggcgtag cacacgccgc
    19981 actcgtccag cagaatcacc ccgcaggtca tgagtacacc gaacgcggca tagcggccgg
    20041 tgatgccgag cacgtaccac cggcaacaca gacgttggtt tatgtacttg aggagctctt
    20101 cgaagttact gggtctcatc ttggcgaacg ggtaggtggc acgcaggttt tccacgctgc
    20161 ccagcagcag caggggatcg gcttccgcgc ggcctggagt tttgatcacc aagttcatcc
    20221 cgtgaaattc ttccgcgacg ttcgccacgg cccgtgcgtc tgtgggatcg aggcagagga
    20281 acttctccac ctggtagcgc ggctcggtgg tggagaaagg ggtgtgcggg tgtcggtaca
    20341 cggtttcgca catcagcagc ccgtattgcg ccaattcttt caccgtgtta gtgacctgaa
    20401 aaagcccgtc cgtgtcccag tcgtacacgt acacaaaccc atagtgtccg atcagcaaga
    20461 cgcaggtagt ctcctgcacc cttttgcgat ccccgtccgg cagtttcacg gccaggatcc
    20521 ccaccgcctc cagcttttcg tcacaacaca tgtaatcagt gccaaactgc cggccttcca
    20581 cctggggaat gtcggcgccg cagcggaaaa tgagaaacca agtgctgggg ttgcgtaagg
    20641 ggatcatggt gccggagtgc tttttcacat agtcacgcag gcagacgtga tcgtactgcc
    20701 gcagaaaaat gccctgcaac atggtcatag cacgctgaaa aacaatgttc cgcagattga
    20761 acactccata gtcgcagcgg atcacgtcct cgggacgatc atctcgctgc ttcagatacg
    20821 ttccccaggc ctcggcggcg gctctggaga gcagtgccat agtcacgggt ctaaaaaaaa
    20881 gaagacaaaa caacacgcac aaaaaagggg gatgagaaaa aaggggagag agtgtgtggc
    20941 tgcgagctcc gcggctggat tttttcatct gaacacgacg ccgcacacca aagcttaata
    21001 tacaagcacc ccgaagcttc ctggaagatt gacatgtgac gtgtgtgtct cggtcatcct
    21061 ttactggaag aaggcccgaa agtcaaaact gtgaatccag tcgggtgaca gatcacggtt
    21121 caagtgtatc cgccgggcct ccacctcggc ctccagcacg tgggtttcgg tgttgtacgc
    21181 gttcatcaac gtctggccca gacgccagcg gtgagcctga gccgcctctc tttcggcgtg
    21241 ccactcatcg aggtctttca ggtcgaacat gccgtcctcg tccaggtcga acccgaggtc
    21301 ctcgccgtcg tcctcgtcgt cttcgtcttc gccgttcatc tcgaaagcct cgttgtcgcg
    21361 cccgaggact tcgatgtcgt cctcgtggac ttcatcaaag ttgttgttgt tttctggcac
    21421 acgcgggata ggtggcggtg ggggagcttg cagcaccacg tccggcagcg cgggcacggc
    21481 gggcgcggga ggtggcggcg gcggtggtgg caacgctggt ggaggcgatg gaggcggtgt
    21541 gggcgcctgc tggttggcgg gagcttcggg cgccggctgg ggcgcgggag cctcgggcgg
    21601 gggtgtgggt gctctctccg ccggaggagg cggcgaggga ggtggaggcg ggggcggagg
    21661 tggcggcagg ttggcgggat cgaacattct tcgacggcgg gggggagcgt cttcgtctac
    21721 gttctcgtgg cggcgccgtc tgtccacgaa atccccgcgc atcacgcgtg agtgccagat
    21781 ggtgaacgcg tcccagccgt cccaagtagt gaacatgtcc gcccgaaagc ggtccggccg
    21841 acagagccag cgatactgac ggccaaagtc ccgagacacc ccgtgatcga aggcggtaaa
    21901 gtgcaggcgg taagtttcgt ccaggtgaat gcaacgcacc ccgcgttcca ggcgcgctag
    21961 ctgccgcagg tggtgttcgt ggcgtcgccg aacatacagt ttcatcaacc cacccttgaa
    22021 aaactccgaa aggttgtcgg ccaggcggta cacgttgccc ggggccaggc acacatgcga
    22081 cgtgcgatcc gtgtagggcc gcacgatcac cgcgtagatg cgtccgaagc ggtcgaaaaa
    22141 aatcacgctg ctgacctcaa aaaaaccccc gggtcggtag gaacccacgg cgcccataat
    22201 ataccagcgg caccgcaggc gcaggctgag atacatctgg cattctgtca agtggtaggg
    22261 atcgatggcc tcgaacggcc acagctcgct cagacagcca aagttggtga gcagtttcag
    22321 cgtctcggcg tggcgcccgg gcgtgtgcag gttaatgtcc tgatcgtggt gagcgcccac
    22381 gcactcggcc aggctttccg cgtcgcccgc gctctgcagc agggcttcca ccacgtcccg
    22441 cggcacttgc gtggcgtagg gcgtgtgggg ctgccggtac acgcactcgg cgtgcagcag
    22501 cccgtagcgc gccagttcgt ccaggtgctc ggccgccagg atcaggatgt cctggctggg
    22561 ttcgtagatg tacatcttgg tgtcgcccgc catgcacatg acgagttcgg tctccacgaa
    22621 gcggtcgtgc acccacacga tgcacttgcc gatgaccgcc atgcgctcgc ggcagcacgt
    22681 gatgtcgtcc aggagctggt ctcggagctc cgggaggtgg ccgcccggcc tcacgtgcac
    22741 gaaccagttg cagggaatgc ccaggcacat cacttgatcg atgtgctcgc gcacccacgt
    22801 gcgaacccag tcgatgctgg cctggcgcag aaacagatcg cgaaagtccg ccatgacgcg
    22861 tagataagtt tcatatttgg tgtggcagta tggaaagtcg tcggtgcggg tgaagaccgg
    22921 ggccccgtct tcccagcgag tgcgccacat gatgatgatg ctaatgatgg ttcccctttc
    22981 tctcctcagt gcttgcttgc tccttcttcg tcgccgccgc tgctcacacg ctgataaact
    23041 cccgtaaccc cgttaggctt ttaaaaggaa agggatcgct gtacgtcacc agccgcgatt
    23101 gatggacaag cgcgaccagc acgcgttcgg tgcaccgctc tcgcgtcgtg gacttcgtcg
    23161 agacgaggca gtggagccga gggccagtgt cttcctgatg gctcgctgcc tcgcgctccg
    23221 ctgcctcgac gccgacgatc tcagactcga gcacgtaggt ttggctcacc gtgtcgtagc
    23281 gatgcagcac gagggtattg gggtccagcc tttcccaggc gccttggtgc gggtcgaagc
    23341 ggtccgttaa acagagccag tcgtaatgct tgatcagaca gtgcattcga cgctcttcac
    23401 gctcgtaagg ggccaggagc tcgtgatgat ggtccatctc gcgctcgtcc gcgtgcgggc
    23461 aaatgcattg gtgttccatg cggatttttt tctggcgctc gggctcgaag cgtcggtacc
    23521 cgaacaccag tttcaggagc cccatgcgga aaaactccgt gatggtgttg gccacgcgcc
    23581 gaatgtggtg gttaggctcg tcgagctgga tggcgtacac cgccccgaac cagtccagca
    23641 tcactagcac ctcggccacg aacgtgcggc cctggcgcgg ccgtcccgtg gcccccaaca
    23701 gataccaggg tgtggccagg ttggccctga tgccccacca ccagcgtttg gcctcggttt
    23761 ccgtcaggct gctgaagggc cacacggccc gcagctcggc cacggttttc atgaggcgca
    23821 agatgaccgc cccgtaaccc ggggtgtaca gcttcacgtc gtgttccacg atccgctccg
    23881 cggtcacgta aaagctgtcc ggggtggttt cgttcagaaa cagtatgtgc atggtgcgcg
    23941 aggggcgcgg gccggagcgt atgaggctgg gcgacatgcg gcgcagctgg ttgtggatgg
    24001 tgtcgcggta gatgaactcg gagcgcacca gcccgtactt ggccaggtcc tccagccggt
    24061 gagccacgat caccatgtag ttttcgcgag gctcaaaggc gtacaggcga cagaaacgac
    24121 ccaggaggat gacgtaatct gttcgtaagt ggtcgcgatc ctggtcgcgg tgaggctcgg
    24181 ggacgagttt gatggcatag cccagggcgc acagcggctc gtcgcaacac accagcttcc
    24241 tagccgcctg ctgcgcttgc agcagctgct ggtcgcgctg cagttgcacg taccagccct
    24301 cgggaggccc caggcacagc cggcgcccgt ggttgtggcg cacgtactgt tcgatctggg
    24361 aggtttccat gcaaaagaac aggtcccgaa agtccgtgag cacctgcctg tagaagttca
    24421 ggccatcatt atctcccgcc gcgtcccgct cgcagtgccg ggccgccatc gccgcactgc
    24481 ccgccgcgcg ggacgaacga ggagaaaata cgacgacgag agacgatact cacctcgttc
    24541 tgttaaccga tctagcgttt ggaccgattt gttgagatct cggtccgaac tgctgagcgg
    24601 ttcacagatc aggtttgggg ttctcggcgt gtttgccaag ctcgggacca tcatcacagt
    24661 gcgttgctat ataccgacga cgtggattgt gagcccgtgg cgtctgagcc aatagcgccg
    24721 aaggacactc cccgggattg attgtttatg ctagaaagct ctcgggggac acgcggtgcg
    24781 ttttcgtgtc catcgttagt gaccaccgcg aaaccataac tgagtgagca agcacgcaga
    24841 caagccatcc atccatcaat caatgtccac acagtgaatc agaccgctcc tatgttctct
    24901 ttattcgctt tggggttttt acagccaagg gggtaaatac gaaccggggc ggggaacggc
    24961 tgggcgagga aatggccgtc cttccagaag ggcggctttg gcagttctct gaatgaggac
    25021 ttcagtgtag taatcgcagg tgggctcttt gtcttcttcg tccgtatcgc ccccctcatc
    25081 atccgcctcc tgctctcttc ctgcaccgct gtcgttgctt tctgtgtcat cggaggtttc
    25141 gtgttcctcc ttctggtggc ggtggtggcg gcggctgctg ctgggcccgt caatctctaa
    25201 caggtcatcg tcatcatcgt gatagcgctc tgatttatga ggttttggag tcttctgagc
    25261 aggttgtttt ttatgaggtc tggttaaagt gccagaagga ctggccgttg gcgtgactgt
    25321 ttgttcggtc aaaagatctc tggacgatga ggaagaccta ccgttctcgt ccgtcagcgt
    25381 agctctcagt cgtgcgattt ctcgttccag ttggggggtc agctgggtcc agatggaata
    25441 gcaccgcaca ccctgtctga cctcgctaga ctgcacgtgt tccgacacgc gacgccagaa
    25501 attgtgcgcg gcctccacct cggtggcctt tgggaaatcg cagcgcagat ggggctccca
    25561 actggcatcg gccgctccgg ccacttcgtg gtagctgttg cgaacgtgac agccgccgac
    25621 ggcctttttc ttgaaacgat ccctgcgcgt gagccacttg taacgggtga aaaaactgtg
    25681 ctgcgccgtt ccccggtcca tgtacaggta gcgatcccag aactgatagg tgccgtgggg
    25741 gcagtgcgcg ggcacttcca gcctttcggc gtcggacacc gcgccgctga aacgccgacc
    25801 ggcctgatag attttcaaca tgccgatcgt cagcagcgag tccagatcat ctgccaatct
    25861 ccacatttcg cggcgaaaca cgtcgaaagc ataaaattct ccaaacacgt ccatgaggac
    25921 tacccattcc gagtgaaaca ctcccgacgg cagaacttcg cccagtacgc caaaggttag
    25981 aaactcacag cacaggcggt ccctgaaaaa ctgtatcaga ttgttgaaca tgcactcgtc
    26041 catgcacaga aagggccaac acgatctcag gtcgtcggtc tccccgcaga tcatcaaggg
    26101 acgggtcatc tccccggggg tcctgagcgg tatgcattgc cagcggtagt tggccatggc
    26161 tgccttgaga tggctggtgg agtgatcgtt catgcgaagc atggaaatta tgtcatcggg
    26221 atctgtggtt aacatgggca ttcgaaactt gccggtgtag atgctctcgc agtgcaccag
    26281 accgtgccgc gcaaagtcat ccaggccgct ggcgagatag tagagaactt cttggtcgcg
    26341 atccagcaac cacatgctct cgtagcgtcc catcatcacg acccgcctgg ctttgcacgg
    26401 cggccgcagg tcttccgcgt acaggcagct gtcgtcgcag tactcgtcgt cggagtcatc
    26461 gtcgtcttcg tccgacagcc cgtcgttctg ctgcggatgg tgggcagagt tccaaaactg
    26521 caggaagccc aggacctcca gcggctcttc gcagcagatg agcttgcccc atggggaatg
    26581 gggcccgtgg cacggggtgc tgctcccaaa gatgctgggg aagctcgcga agaccagccg
    26641 ccagccgggc ggggcggaca ccggcacgct gacgcggcat tccgccttca cggacaccag
    26701 ggttcgcagc gcggtctgcg aatcctggtg tgtgaacacg tctttgagcg cacacagcgt
    26761 ccgcctgatg tcggaacccg aggcgtaacg ataggattgg cgcagcatgg tggtgtgctc
    26821 gcgccctttg gaatgtaacg ggctttatgc ccttggagaa atgacgtcgc agccgtgtgc
    26881 caagatcacg gcttattaat catgatgtgt atcttccgaa agccgttcat tccacaggga
    26941 actgccgggc ctcacgttag aaacctcgag gccgacatga actcgagcgt tcgcaacgtg
    27001 accgccctga cccctcttgg cccggggccc attctcgccg gctacacgtg cgttttcctg
    27061 ttcgggctca cgggacattt ctatctgggg ttcaagaaca gccagagacg acaccatgcg
    27121 ggtgctttta gcgacatttt atttcgacat ctcatgatca ccgagggggt tttcaccctc
    27181 gctattccca tgtggaccta tcacctgagc accggcggac acttaccgga tccgtggtgc
    27241 cggggtctca ccttcgtgtt ttatctgacg gcgttcgccc gcgccacctt ctacctcttg
    27301 ctagcctggg atcgctacag cgtgatcgtg tgccgccagc cgctgcccgt ccacgcgagc
    27361 tacaatcagg tggtgggact gtcggtctgg ctgatcgccg tgttggccgc ctcgcccttt
    27421 gccatcttca gcggcgacgt gcagcaatgc ctcggcaaca tgggcgtgat gcccactcgc
    27481 tcgtccgcca tcctcaacat ggaggtgcat ctgtgcactt tctggttgcc gctcatcatg
    27541 atcgccgcct gttattacca cgccaagcgc cgggcggcgg ccgaccagat cgccgatctg
    27601 caccgctgcg ccctgctggt caccatcatc atggtgttcg ccatcgtctg gtttcccttt
    27661 catctggtgc tgctgattga cgcgatggcg agcctcagtc acgtagagcc ctcgagcgcc
    27721 atccactggt tacccatcgt cgtcatgtgc gagtctctcg ccttcgcgta cgccggcgtc
    27781 agtcctctgg tgtactttgt ggcctgtccc gtggttcgcc acgagttcat agtcagtcta
    27841 cgccctttct tctggcgcat ttcgggtaaa cagtggggag gctatgttcc ggtcgccacc
    27901 cagcctccga cgaagctgga cgaggaagag gcagccagtc ccgaataaca ggatctagca
    27961 cgccatcaag gtcttctgtt ttgttcacgg gaatgataaa caacgacatc ctcggataaa
    28021 cgcgtgcgat ttaattatat aaagcgaggt gagtgacact ggaattcgcc gtcgctcggt
    28081 gttaggagtc gacggtcaaa acgtttcgtt agatcgagtg tgtgtcgcac cagccgggaa
    28141 ccatggcgaa taacagcaca aactccacgt gcaaactcaa cgagactcta agtgaatttg
    28201 gaatcgatca ttccgccacc atcgtcgtct atagtgtgtt cctcatcgtc ggcttgtttt
    28261 ggaattttgt gctagtgatc gtgctaacta ccaagcgtaa gattaaattc gccagcgacg
    28321 tttactttct gaatgccgcc atagcggaca tgttttgcat ctgtatgttg ccggcctggg
    28381 tacactatgc gctgcaatcc gtgacactga accaattcgc ctgtatcacc ttttcgtacg
    28441 gtttctacgt ctctctgttt ttgcaatcct ggatgctcat cttgatcgcc ttggagcgtt
    28501 actcgtacct gattcactta accccggtga agaaaaacac cgcgatcaaa agatgcgtgt
    28561 gggcctggtt catggccgtg ttcctcgcgt taccgtattc cattttcaga aagataaacc
    28621 catccgacga atgtcttctg gggaattacg cgtcgcacgt ggcagagcct taccatggca
    28681 tactgagtgg cgttatcacc attctgactt ttatgatccc agtacctatc gtgtttgctt
    28741 atagttttaa gatgagtaga tcgttctggg gtagcagaaa actgaataac aagaacagct
    28801 tgattttgct tcagctggcc atcgtcgctc tgtgtttctg gggacctttc cacctgttta
    28861 cagtggtaga tcacattata cagatagtgt ataatttatc acgttgtcac ataagacatc
    28921 ttattggttt gctgacggaa agcctggtgt ttctgcgctc ggtgtggaac cctatcgtct
    28981 acctcatcat cagccagaaa tttcgcacgc aggtctgcaa tctgttccga cgcgtacctt
    29041 acagcgagat tgacacggaa ggtactcatc gacagcccgc accagagaca gagagcgaaa
    29101 ccgagaccgt gcaactgacg ggcaagggcg ggaagaacaa gcgcgccaag gacggcgagg
    29161 acataacgct catcatccag ggtgccgacg taacgccccg tgactacact tgtttcttgt
    29221 aaagatggac atcataacac cctttgtgat gtatatgatc cttggaacca cagaaagact
    29281 gccggtcgca aaccacgtag cgggatttcg gggagcgagc aatcgaacaa cggccgcaaa
    29341 atgactgggg aagtctgcca cgtaaacgac acgatgaagg cctacggcat gacccctgac
    29401 ctcaccatca gcttgtacag cctgggtatg attctcggta tcggggggaa tatgctgata
    29461 ctctgcgtta tatgtctaac ccgtcgtccg tggttcgcgc acgatatctt gtttatgaat
    29521 atgatattcg cggacttgct gatgctgctc acaatacctg cgtgggtgta ttacctacta
    29581 aattataccc aagtgtcgcg tttggagtgt gtcggcctgt ctttcgcatt ttacgtccca
    29641 ttattcctgc attccgatat gatagttgcc atagccgtgg aacgctatca gaacctcgtt
    29701 aggaacacac ccgtgagttg caaaaccgcc gtcatcagct gcacgttact ttggaccact
    29761 gtgaccctgg tgacatcgcc ttactacatg ttaagagaga cccaagaacc cgactcatgc
    29821 attctgggga actatacttg gcatgtgtcc agtccttatc gcaccgtcat ggacgtcgcc
    29881 attaatcttt ggacgtttgt ggtcccggca ggtgtcatat tgtttctgtc catcaggatt
    29941 cattcctgtt cctggggtaa cagaaagctc aataccagaa ccagtcggca cctggacgcc
    30001 atggccatta acatgttatt ctttaacgga ctgttcaatc tcgtcatgtt tcgggacata
    30061 gtcaccgact tctcgagcgg acttagttgc cactacctca gacaagaaca cttttttcgc
    30121 atgatgggta tcgcgtttgt gttcgccagg cccattttca atcccatcct ttacgtgtcc
    30181 attagtaaaa aactcttacg cagcattttc cttctgttca tgcgagtgcc ttacgatacg
    30241 ctggacagtg aacatgctga gctcatggtt caggggaaga ttaacaatga acaggtccct
    30301 gacccctttc ctagagaatg cgaatccatg ttgtaaaaac atacatgcac tgaccgaaat
    30361 tgaatcattc gtcacacaca tgtttgagtg cagtgagaaa ctgcgggtgt gtggactgca
    30421 catcttgcgc gatttgcaaa ctggttgaca gaaacatgaa taactcatct tgcggctttg
    30481 acaaccccag gactgtcggg cccttgcgct atgtggaaat catcctttac agcgtagcca
    30541 ttttcgtggg gttgacaggc aatatcctgc tgttgctcgt tttcgtgaaa agacgcggcc
    30601 tccgtttcgc cagcgatgtg tactttatgc acactactct ggtggatgtg attattactg
    30661 ggacgttgcc attatggatt tactacgaac tgagctacac ggcgttcgat cgagccacct
    30721 gtatcggctt atctgtgact ttctacgttc ccctctttat gcaagcttgg ttcctcatct
    30781 ccatcgccat ggagcgctac tccaacctgg tatggatggt gcctatcggc acaaaggcag
    30841 ctatgaagaa ctgtctagga acgtgggtgg tgtgcacctt tgtggcctca ccctattacg
    30901 cctttaggaa tgcccacgac gggcacacat gtatcttggg caactacacc tggcatttca
    30961 acgagcccgc gcacactctt ctagatttct tgatgatagc ctgtgtgttt atcagcccgg
    31021 taggcatcgt tctgacggtg agctacaaaa tgaggaaagc gacgtggggt aatagaaaac
    31081 tcaacagtga aaccggcgac atgatgctgt tgatcgccat catagcgatt ttgttctggg
    31141 gaccttttca cgtcgttctc atcatcgaca acatcttaca aagaatctat ggcagttcag
    31201 actgtacgat cgaggagatt aaacacttaa tctctatggg ttccgccact gcggtgtacc
    31261 ttcgcgcagt cgtcaatccc atcatttact ttgggattag cgataaggtt cgggagcaag
    31321 tgtactccct gtttcggtat catccgtacg acgagctgga cctggaggct gccaagaata
    31381 ctgtggagct ccgtgtacgg gaaagaaaca caaagggtaa aaaacgtaaa aagagggtga
    31441 cttggtttga tcagaccttt ccgaaatcct acgaatgctt tttgtaaata cgtgccaaaa
    31501 aagaataaac tattttcaga caaccctgtt cgttggctct gcgttgtgtt cttttgggcg
    31561 ggttctatac aacaaataaa aggtttctga gaactccaca gcacacacgt acaccgcgac
    31621 tcatcaggct gctgtggaga atgaccgcta ccacttccac caccatgagc gtcaccacga
    31681 atgctaccgc aacaacttcg tccacatctg ccaccaccac tctcacaagc aaaagcagta
    31741 cccccgcgaa taacacaaca acgtcaacga ttcgcacgag ttccacctct gccaatgtaa
    31801 cttcactatc tacgtcgacg tccaaatcga ccgttacgag cagtttagca tctaccctta
    31861 ccactagtcg caacgctacc agtaatttaa caacgacttt gagtagtaca tcgtcgctaa
    31921 cgtcttcaaa cattacaagc actttatcgt caaccatctc aactattgtg tcgaaatcaa
    31981 cacctaacat cacaaccagc ttgactgcga cagttagcaa tgcaactacg agcttaacca
    32041 ctgttagtac tgcgttaaca accacattct ttgaatccag tactcctttt gaatacgatt
    32101 atgatgcaga agtttgcaac atgaccgaca tcgtgcacat gtccaagtcc gtcacggtta
    32161 ctttctacac catcatcttc atactcggac tcctaggaaa ctttatggtt ctcatgacca
    32221 tcgtatggaa tcggcgcatc acgttcgcgt ctgacatcta tttcctgaac ttagccattt
    32281 ctgacttgct gtttgtgtgc actctgccgt tctggatcat gtatctcctc gatcacgaca
    32341 tcatgtcaca cgtctcgtgt gtgatcatga cggctatttt ctactgcgcc ttgtttgcca
    32401 gcactgtctt tctgcttctc attattctgg atcgatgcta cgctatcctc tggggtgtag
    32461 acagggctga ttaccgttcg ctacgaaacg ccacgggggg atgcgttctc atgtggggtt
    32521 tgtgtattgt cctggccttg cctcacttcg tctttctaag aaaaggaaaa aacgtctgtg
    32581 tggccgagta tcaggaactt actaattttt acgtcatctt tattaacacc gaagtcaatc
    32641 tctgcacatt aattctaccg accgcagcca ttatctactg gtacttgaaa ctgactaagc
    32701 ttacaaaatc gtaccaacgg ctgcgtcatc gtctaacttc tctaaatatt attctggctg
    32761 tagcgattgt ctttgctata ttctggctgc catacaacct tctgcttttc gttcacagtt
    32821 tagagcatat gcagattccg tggggctgtg ctagtgcaaa agtggtgagg agaggcctca
    32881 tcgttactga atctatcgcc ctctgtcact gcttcgttaa tcccttcatt tatgtcatct
    32941 ttggccaccg gtgtcgcagc gaattctgtt acttgctgcg cgctctgctc aacaagcttt
    33001 gtccgtccag gtcttggggc tctctgcgtc cggatgccgt ttccctggat ctcagtcaca
    33061 tgcaggtcgc tgtggcatgt acctacgaga gtgaggactg cgagcagacc gacgaactgc
    33121 agtttctcat ctgaaagcta aacctgtgtt ctcattaaac cagtgccggt cagtgcgcca
    33181 tacaaaaacg tgtgtgtgtc gtgtgtgatc ttgagacgcg gttccgcggg ggcaaggtat
    33241 taaaacgacg tacgtgagtg acacgtctcc cgaaaccctt atcccggggg agagggcaca
    33301 catgtcggta gcgggcacat ggcaacatgc cagccccgcc ctggcacacc gccgcgtggt
    33361 ggatcacgct gggatgcgcc tcagccgcga atgtggccgt gtttctaaca tcacccacgg
    33421 ttggggcaca atccatcgtg gtccataaga cgtcgtcgtc gtcctcgttg ccgtcgtcgc
    33481 cgctgccacc ctcgcgctta tcctccgccg ttccgtttca ctcccctact cgccgctccc
    33541 cgcgcaccac gggtcccacc cgctcgcgca tcagcgcctt cggcaggcgc agcaggcgcc
    33601 agcgacagaa accctacagc tattgcgtga ccgagaccca ttggaccacg gacctagcgt
    33661 tcagcgactg tacaaacagc ccgagcttcg taaagctcga aggcgtgcgg cgctggactt
    33721 taaaaggaca ggtgctagga gaaacctcct actacggcag ttgctgccgc ctgagtcacg
    33781 gcgagaatgc gtacatcatt ttcgctcacg gttacggccc tgccgtccac ggccatgctc
    33841 tgcgcgtgga ttatgcagct actaactgct cgcggcctcg cgttccgttt ccatcccggc
    33901 tggaaattac gtttacggcg gagattccga gccggtgcgg agcgcgtcgc ctctattttt
    33961 acggccttca gtgttcctcg cagctggcat tctccgcctc cggaatggtg gatgcacatc
    34021 ggtgcccccc cgttctctcc attcgatccc ttcctctacg attcttcctt ctggatgaac
    34081 gattacgaac aacactgtat ttggatgtct tcctctgtct agtattaatt atcatcctgt
    34141 ccgtggaact cattccccgc caagtcgttc gtcatcccgt cctgtattgg cgacactgga
    34201 ttgaaagcgg ctttcaatat ctgtggccgt cgtcgcctcg gtacgcgagc ctagaaaaga
    34261 agaagtctcc cagtcacgtt tgtcacatca cttacacggc gccttttcca tgtgtttaca
    34321 cggatttgtc acggccttcc ccgcggactc ttagacgtcc tgcctttgga tacattttgt
    34381 ggttaaccac gtcacgctcg cagtgccaac cgcctgagcg aagctgacag acgtggtaca
    34441 tatgagcgcc acgcgcggcc gcctgccagc tttcccctga tcgactccgc cgaacaacac
    34501 cgtccggtgc gtccagttca ccaaacgagc cacacgccca tggcatcgtc gccgatgatc
    34561 cacacctctg tggtttggtc aacatgcaca tggatggtgg tcactgccat gctcatcgtg
    34621 ctcaacatca ccggtacggt tcacgggtgt cgcatggaac ccggcgaaga cgtgattgtg
    34681 gagcaggagt gccggcagcg aaacaacctc atggtagcca cgggtcgtct ggtaccgaaa
    34741 agccatcaac ctcacgtcat cgaattcaat tacaaaatca aagaccgcct ggggttcagt
    34801 cagcggatcc agctgcatat cagcggccta tcgctcaaca accagagcat cgtcaatcaa
    34861 cctgtcacct ggcgagtgtt tgccagacgc aacgacctgg accccgcaac cacccacaag
    34921 gctaagttga ggctcatctc tgaccgggac gttccccctc gacagtgtga aatcatcgtg
    34981 ggacgtgaca gcggactcga ggaaccggaa tcgtggagcg tgcttcacgg tctgggccaa
    35041 tgtctctggt ggttcgccgt ctcgtttttc gcggtggagt tcgtgctgac cgcttggcgg
    35101 tggctaggga agattgacag gggccgccgg tccccgactc tgctgcgtgc tgagatgttg
    35161 cacaataaca gggaaatgtt ctggaagagg cggcgagcgc gcttcggagg tgtctccgaa
    35221 acgccgccgc ctgcggttcc cccgcgctac gcgtttacta cgccctggag tccgaaggcc
    35281 gctcaggaca tggtgatgat tgccaaacca tcctcggtgg acgagacgat accgtcctct
    35341 gcgtcgacac cctcgtccct atcgcccgaa tctgccatct catccacacc ccccagttat
    35401 tcctcagtgt ttcctccctt ccccgaataa agagagttgt ccattagcga gatcgtgtcc
    35461 agttgccatt ctttgtcatt ttgtgtccgc gccgatgatg accgcgacgg ggccccgggc
    35521 gaaaagcgcg cagcaacaca tggagaatga ggaagcttgg cgatcctcgc tcctctcatc
    35581 ccacggtctg tggtgcgtct gcggacactg gaaatcgcac atcctcgtga gcgacgaggc
    35641 caacagcgag gaggtcagtg gcagcgactg gatggaacgg gcggccatgc gctggctgct
    35701 ccaggcgcgg gagaaccacg acctgtggtg tttatgtgcc aattggagag aacacgccct
    35761 gtccctggat gaaaatcgca tcactctggc gcgcctgccc agctacctga cagaaaggtc
    35821 tcgcgcgcgc tccagcggca ccgccagggc gtcgtgtttc agtcggttca ttaaaaagct
    35881 gaaaagacgg cgcagtaccg cgcgttcgtc catggtgtcg accggcggcc acagcggcgt
    35941 cagcaccgtg agcagccgca gctggcaatg gttcggcatg ctgcccgtgt accgaccctc
    36001 gagcaacctg taagacgaca acgataacca cacacgacga aggggagagc cccgcaggaa
    36061 atttcctgac ggcacgcgcg tcccccgcat cctcaggacc ggtcatcaga tttagcgaag
    36121 cgaacaaaag gaaaaactaa aacgtttaca gggcagacgc ggcgtttcgg aaaacgccgc
    36181 tagaccatga gccggcaggc acgtgacttg attcccagac tcggcgactc ctgcgctcag
    36241 accgagctcc gctggcggac ggtgctgagc gagtcccacg cgctctggtg cccctgcggg
    36301 gactggaccc cgcacgtgga gtgcgtcgaa gagcctcatt ttcagttgcg ctggcgcaac
    36361 cgttgcgaac gtgcggccct gcgctggcgc aggcagatgc atcgcttgca caacctctgg
    36421 tgcatgtgcg gtaactggcg ggagcacgcc ctgtaccgcc ggggacggct gacggactcg
    36481 tcgtcggggt cgtctgcgtc atcgtcgggg gagtccgcgg aaaattcgtt cgcgtggtgg
    36541 aaatgcttgc gcaggtggaa cgtgctctgg cgccagagct acgagttttt ccagatgccc
    36601 gttccccccg cctccgaacg catgtcaccc accttttcgg actcggattc cgaagacgga
    36661 acgccgtgcc cggccgacga ggtggagatc tggcgacccg aggactgccc catcgtcatg
    36721 gacgtgcgtc ctgcctaccg ggagaccgcg gtctagcatc ggcgtcaccg ggttgttggg
    36781 caagaagcac tgacgacaaa cgattatcac tgacatcacc cgcaagttgt ataaatgtct
    36841 gcgtccccca gggattctgc aacgccactc ggagttcggt gacagctggc actgtgcctc
    36901 cgtgcatgtg gcacgcggcc atcctcctct acgaacccac cttgacggcg tccgcggccc
    36961 tcgctctcgg caacgcgatc tctgcgatcc accaccggtt ctccatgctg tgtgcccgct
    37021 gccgacgccg gcccgcgact gagagcgatt ccaacaacgc gcggtcgtcc caatcggagg
    37081 ccagccagcg gcgtcagacc agagagaacc agaaggagcc gtctcccaag aacaacaaca
    37141 cctcgctcgt gggtcgcgcc ctggtgatca tcggacagca gttgatagcc gcgaacctcg
    37201 gcgcctgccc tccaccggtg accctgtttc gctaagggag agcacaaaac aaacaaagga
    37261 gagagactgt ttgcgtgtac gtgtgctgca cgagaccgag gagagcccgc gccatgctgt
    37321 tccccacgaa gcgcctgagc ttcgggatct ggatcacgtc cctagtccta ttaatcgtca
    37381 tgtttgttta acgactcgtt tgtgtgtaaa taaatcagac gacgacatga aaataactcg
    37441 aatcgcacgt gtgcgcgttt tattcacatg agaaccaaac agtttttgag aaaagataca
    37501 gagggctata ggctgtagcg tcgggtgagg gtgggtgtaa acatgttggt cataaagcag
    37561 gggttcacga agccttcgat cgtcgcgagg gacgagtttt gttggtggtg catggcgtcc
    37621 ttcagaaccg ccaagtagat ggacaggtgt tcgctcgcca cgttggtttg tgtctggttt
    37681 tcctcctcat catcctccgg ctgctggcat tggcggcgtg tacattgtcc gagagagttg
    37741 cgccaccagt gtcgcagagc ggcgcggagc ctctgcagcg cgccgcgccg acacatgatg
    37801 atgatggatg agtaggcgaa tggatttaca gttgtcaaca cagtttttat tattttagaa
    37861 ctgcactacg aggtctccat ctgaggtgta catgggataa tgggacggat ctcggtcgct
    37921 gggttggacg ggcaggggac ggcggtgagg gcgaccggcc cgagcgtggt aatggcacat
    37981 gcggcgggaa acaatggtat tggcaccgaa ggcggtgggc gggtggttcc actgaggatt
    38041 atagtccgtg ggagcccaag tggtgtaagg tagctcgttg aagtgaccgt cttcgccagg
    38101 attttcgtcc tcttccgggg ccgagcagag tttccagtat cgattgtcgt tgcgcagggc
    38161 tagactgagc tgcgcctggt cgctgagagg ggtgtcgcag ccggcgttgg gcggtaggcc
    38221 cagtgcttgt gcgtcgcgtg cgcgccagcc gtcttcgtcg ggcgacgacg tttgtggttt
    38281 gtagccttca ccgccgcatt ctcctatggg ttgggagcgc cagcggcccg agcgcatgag
    38341 gaaggatagt tgactgggca gatcatgtgg gccacctccg ctgcgaggcc acaggtacag
    38401 cgcgtccgca cgcgggcgct cccagactag gggatcccgg tctggtatca tgcgcatagc
    38461 cgcttggtcg tcggtggtgg ctatgcggcc aatggttagg acatttagaa gtcccacgcg
    38521 gaggaagtgg gataagtctt cggccagagg atagatcaag ccgtcctgag tacagtaccc
    38581 aaagatactg cccagttcgt ccatgataac gacgaccata atcatggggt gcgaggcggt
    38641 taggagacca tcttcatcca cttccgattg cttcgcctgt gttgccttgg cgggactttt
    38701 ttgtgcgccg gcatggggtt gctgctggtg ttgcgcgccg ggtgcaccgt gacggccctt
    38761 gttggatttc gggcgacgct ttacggtggc cgtctctact ccctgcacgt ctgggggcct
    38821 acgtcctact ccaccaccgg gaccgcgcga gcgcgtggcg taatagttgt tcttggcagc
    38881 cgaccactct ttgatagtgt gtagccaggg gctggtggtt accacgccta agagatggca
    38941 ggtgcaacag aggcgctgga tgatataatt tcggacggcc gctacgatgc ttcccgggta
    39001 cgaccatttt ctgaagggat cccagcgttc gagttcttcc caacatgttg tcagtagcca
    39061 gggctgtgga agtcggccgg gggtttccag atgcacggtc tggcctccag ccgtgtgatt
    39121 gatggccgct gctgcggcgg cgggtgtggg ccaggaacgc gttaagagct caaccacgtc
    39181 gggaggctgt gtggtgagtg gcggaagcac tgaacacacg tacagtcggc agcagtcgcc
    39241 gaaaccgtac ctgaagaact cgtctgcgtc ggcagctacg agatgcaggg tcatgcgagg
    39301 caaatcaaac agaaaaacac ggaaacggga cgccacggcc atgaacaaac cttcgtgatg
    39361 acagagggtt ggcgactggc caggctcggg acacacttcg tgcacgatgg tagccatcag
    39421 gacgatccag tcatcggtgg gcgacagttg tcgaagatcc gtggctccca cgtcccgcat
    39481 ctgtgcgcga ggtgtgacca gggcatagta accgcacggt tttccgagtg ggagcagctg
    39541 gccgctttcg cgttggcacc acctgcgagt ggcacgcgag gtgctgttgg ccaagaagca
    39601 gcctgaccat gcagaagcca tcactaagaa ctcgtctctg gtcagcgcgt gacgttgcgc
    39661 cggcacctgg gtcaacagct gctgttgcgc cgccgtgcaa ggagcgtgtg ccgtgggggc
    39721 cccgggagca tggggcgggt tgtgcattgg agcgctggtc ggcgcgggat tcgtggcggg
    39781 cagcgcggcg gcgagggaag acatatccat gttgtgtgca aagttacccg ggtgccagtg
    39841 gcgcggcggc ggtgggagca gtcccgactg ggcgctgggg ctgcaactca gaccggcgta
    39901 gcgcttttga gaccacgcgc ggggcgggcg gtgtccgctc atgatgacag cggagcggac
    39961 gagtggtgtg agtgtggtac acggaggcgg cttttataga aggcgtgttg agcgagcggg
    40021 ctgcaaatat acgaattggg gcacgttagg cgtgtgtgga aagcaggtgc atttctctga
    40081 aacacataga tgggcggtaa ggggacaggg gagagagatc gacggggccg tcacggctgc
    40141 tgtcaatcat ccagagcgcg cgcacccgcg tgattgacag ctcagccacg caaggacatt
    40201 gcgcgtgccc gtgggtgtcg ccagctgtca atcatcttga gtgacaggtg ccggctgtca
    40261 atcattttga ttgacaggta accgtcgcga ctcagtgccc ctttacgggc ccctggctgc
    40321 agttggcacc gagccaaatt cctagaaaac aacgtgctgt ttcttcgcta cataatccta
    40381 gaaaacagcg tgctttggca cggcgccaag acgttgtttt tagcccccgg atcgctttcg
    40441 ccgaagcgct gcgcgcagcg cccggcggcc tcgtctgcag gcctccacgc gccaaatgca
    40501 cgcttttcgg cccgcgcgca cgcagagtga ggagggaagg gttcgggaaa gtcccgtcac
    40561 ggtaaacgcc gtgacgtcgc agggactttc caggccgaag cacggcccct cgcgtcagct
    40621 tcgtgctttc caaccgctgg ccgccacagt cccttgtcac cacgcccaag gcgacacaaa
    40681 acccgctgtc gccgttcccc agggcacacc gatagcccat gcgcgcgcgt gccgctgcgg
    40741 cgccgctgcc atcgctgcca taactgccac tgctatgcat gtagccctct cgcgaccgcc
    40801 atcatgctga ccttcctgct gatcctgagc atgttcttgc gcgtagtctt cgccaccgtt
    40861 ctctgcacct tgctcaccgc cttccttctg gctctgctcg accagctctt cagggcctgc
    40921 gggttttctc ttcgccgcag gtaccagttc ttctccttgc aacgcacgtg gccgctgggc
    40981 cccgcgtatc gcttctacaa acagacgctg catgactgct accactacta ccagcacgtc
    41041 aaggccatcg tgcgatccta caaggcggtg cacgaaccct gtctgcacgg cagccccact
    41101 aaacgcaagc gctcgcgcct cacgcatatc cccgtctgcg aagacgaacc cagcagtagt
    41161 ccccatgcca ccactgcgac tccaagcccc gctgcgcctg tcccgcccga atctcatctg
    41221 gaatcgttgg tttcgtttca ccacgcggcc gcggcggccg agggcagccg tctctctcgc
    41281 cctccccgac cgccacgtga gctgctgccg ccgccgcgca agagaacgca ctacgcgcgc
    41341 ggcgccacaa cccagcccgc gcagccgaac ccccctgccg catcaccggc cgcgttataa
    41401 agtggccgtg tgatgcagat ttctcggagc actttcccca gcaggccacg atggacaacg
    41461 tgatttggat gatggacttc atcaacacgt ttattcacac tacgttatgt atagttttcc
    41521 tggcagccgt gttcacgggt ctcggcctgt acatgttcaa caagttttac accactctat
    41581 ctccacgacg ctaccgcccg ccgttgtggt ccggccgcct gaagtacagg gtgtgcaggg
    41641 agagttcacg tcgccgcttt tgttttcccg agcttcgacg ccaagacagc agcagcggca
    41701 gcagcaagaa ggcggccaag gacgcgaaag gctccgcgga gcagacactc ggcgaggacg
    41761 acgttgccgc cgctccgaag gctaacaaga aaaaggcgtc tctctgcaca cggctgtttt
    41821 gtcgcaacag gaccaagcgc tcctccaaga cgacggcgga gaaagcggcc ggcaccagca
    41881 ccgccaccgc caaggaatgt cgtaatcaga agggaagaag cgaaggtagc aaggtcctag
    41941 ccgttggcac tgctaggtcc tccctgcctc cgcgtcctcc tcgtccaccg ccaccgagac
    42001 gacccgcgcc ccagctcgct actctgtgcg gtttgtaatc gccgcggtgc ggttgctcgc
    42061 cgctctctga tcgagcgctt gcaggcaggt ccacgcgact cccaggatcc cgacgaggac
    42121 gacgctgatc cccaacattt ctaaacagag aatgcatgcc gtaggcacag gtttgcattt
    42181 catgcctact tggccagtac ccaccacatg agggctatta acaggctaat gagcccgacg
    42241 ataattaacg cgcccgtggt ggttcgtacg gccacaatca ttcgatcgtc tgtcttcatg
    42301 gtggccacgg tggagtttcg tttgtttgtc taggaaatgc tcgcggaaac tgggactcgg
    42361 tgttgcgtaa cgacgtggta tcaaacaggc catcccaaca gtgagtatat cggagaaggg
    42421 agtgtgctgt gtacgacaac gcgtttgacg aggtcgcgga gcgcattcgc tatggatccc
    42481 tgggacatcg cagcggttac gggttgtgtg gttgcttttg ttatggttct ttgtacttgc
    42541 gtttggtgga tgtgcaagcc gaggtttacg aatgtggtgt atgcagacgt ggcccggaaa
    42601 aggacggcgt ttgtgtaatg atttcgaata aagatgatcg tgcaactgac ttgaggttgt
    42661 catgtcgttt attatggttt acaggtgttg ggtcaaaaag ggtcacttga tgggattgat
    42721 tgaatgtcaa tcaatcgcca agtatgaata ggaagactgc ggtaactctt ctggtgttac
    42781 cttgtcacct actagctacc atcaatgaag acgattttag ggttcctcta gacgcaacaa
    42841 gagttgtttc taccaccaca acgcgaacag ttttgcaact aggtagtaaa ttcattttca
    42901 gatgtgaatt tagttgcaat tgtacgcgag gaatacggtt cacatcttgc aacgcttcca
    42961 tagtggaaac ttggctatat cgttttattg atggtatgga cacacctgac gatgacttac
    43021 gagtaaaaga tgcttccaga gtacaatcag gtggtgcaca tcgcaaacag aatagttact
    43081 catcgcacat gcaactaagc attacaaaat atcaagtgaa ccacacagga acctacgaat
    43141 gtttcatcta tattaacaaa accatgaaca ttacgaaagc agtacagcta agcccaatgg
    43201 gtgacatata cgtgtttcag tttccgccag gtcaaaattt ttgcgcagta cagtgtgttt
    43261 ttgatgtagg ctttcccggt acggtatctt taatcacgaa tagtggaacc tcctttaacc
    43321 ctgatgttcg actctgtaac ggtaccagcg ttgtttcaga atatgtggtt tcaaccaaca
    43381 caaacagccc tatttttcaa tgcagcatca acgctacata ctgtccactt acaagtcatt
    43441 cacaaatatg gaccactaaa ggtagtagac gtcacctaca gagactaaat ttagaaaatt
    43501 gtgaaaacta ttcgtatcct gtgcggacaa caatgctccc tacaaccacc gttggcacat
    43561 tatcaacaac catagcaata acaacgttaa gtacattaag ttcactcaac gagtctaaac
    43621 ctaatgccct gcgagcttca cgtgaaatgc acagtctatg gatgctcgta ttgatagctg
    43681 ctattgcgtt agggctgtgg tttctacgta tacctcaagc actaatgcag aaaatgagag
    43741 ggtacagaaa gccattacgt gtagcgaata atgaataaac tcgtaaaata aatttgtgtg
    43801 gtatgagttt tattatgttg caatagttat agtcagttct gaagctcaac ctattcagta
    43861 taaataagtg acaatgcata atagccgtag tttcgttcaa gcatcttcaa agatgaacat
    43921 gctgcagaca ctcgtgcaca tcgccgcata cactgtgtgt gtgtgtgtgt gtgtgtgtgt
    43981 aatgcagaag cggatggata tcagtaagtt ctcaatgttt cggaaaccgg ctacttcctt
    44041 atgtaataat tgcaatagtc atgaaagcct gtcaatcaaa gttgccgcat actccaagat
    44101 gagtctttac aacataaccg cacgcctgct catgtgcagt gtgtgtgtta tgcaaaacaa
    44161 tgcaaaggca ggtagacaac agtacggtga acggaaactt atttccttgt tacagcatcc
    44221 tgtttgattc tcagctttct taactttggc atacaatgcg cactaacaaa cgacgttagc
    44281 ttttaagagt gttgtatcac aacgttaggc tttaacgaag aatggatctt cgaagctcca
    44341 taacacaact cattacatac actgtgtgtg tgtgtgtgtg tgtgtgtgtc tacctacaaa
    44401 atgttcaaaa gtatggaaat tggtatgaat atgttgagta tgtgtccagt ttctaataat
    44461 tgttgattgt aaggtttccc agaagtatga caacgggaaa ggtttaaatt tccttatgta
    44521 tatgtgaaga tataagctaa tgcgcttaga tacgctgaac gttcattagg ctcattgcat
    44581 tcagaaccga agtgttgact gtgccagcat gaatctgcgc agcaccacac ggtttatcgc
    44641 acgcacaaca tacacactgt gtgtgtgtgt gtgtctgcct ccgtgatgaa acaacgtcag
    44701 tgtctgagta tgaagaatgt aataatgcat gtagtaagca gcactttcat ccgcacttcg
    44761 ttaactatca cccatctact aaacaactct aacgcattgc atgtgcaaca ctaacagcac
    44821 gaagccgggt aatgggggta ttgcgggatt gtgtatacga acgctttaat acgtgatagt
    44881 tgctaaatga attatagcat cagttatgtc cgtttaattt agcagatgca ttctaagtat
    44941 ctgacttcca tctgtcaacg ttccttagta atgcctgaat tttaaactgc aaacgtatga
    45001 cacgagtatc atcgtggctc acagcagtac gttttgaatt tctgttttaa cagcttattc
    45061 tagagtctaa tggtaagttt atattatcag tgcagctgct acctggtaat gtgattaatt
    45121 ccaaatacgc cggaattatg gagccgtaac atacattgtt atgtattagc agcttttcca
    45181 ctttgatgcg caaccaccac atatggaaaa cagcgtactc tccgcactct catgtacgta
    45241 atgtttttgt attgttacag attgatacca atttaacggt ttaatacaac ctgcttgttt
    45301 gtgttcagca gtattgcaag tttgatacta gatccaccac cttgtttgga atgcgtccca
    45361 atagaaacct gaagcctccg atgatgctac gcaggaagtc ttacaagcaa tgtataaagg
    45421 tgttgcgaac gagatggccc gcgcaatcca ccaaatgctg cactcaaggt cgcgtacgtt
    45481 gaaacaccaa gacgacgtgg ttgtgctcca ggtggttgca gcaagatgca gttcaggata
    45541 agctacatta tagcagatac caccatttac attttcatcg ccatcctgtc tcgctcagct
    45601 gcaaatacaa ctccattatc gaatacatct tcaacaactg cggcacctaa tactaccagc
    45661 gtaaccacct ctacttcgct gactacagct acaaccacat ctacaaccac gaatgtaaca
    45721 tctgctccat ccacggtttc gtccactacc aacacgacta caactgcaac gttaacagct
    45781 agccaaaatg tttcctcaca acccacaact gttacgtcta cagaaccaac aagtaatcaa
    45841 tctagtgttg tcagttccag ctcaactaca atttcagcaa ctgtatcacg tacgtcttcg
    45901 aatggtaatg catctaccac aactacatca accgtaagca ttagcggcag ttcgccaaac
    45961 gtttctttaa gcaccgtggt atctaccact ttaaacagtt ctcaacatac atcatttaat
    46021 accacaatta caacaacgat gccgcctaac accaccaaca ttactagtac taaacaaaca
    46081 tcaactactc ctaatgttac tacaggattt acaataaaat acgtaaacgc aacggtatgc
    46141 ggtactgtaa atctaacggc gagcttgtac aacaaatcca cacatgggca tcacactgta
    46201 tggcttttaa ttaataacaa tagcacacca agggaccacc aattatgtag aagttcgagt
    46261 tcccatacca caaaacatca ttggaaagat ttgtgttata actgcagcca taatactcta
    46321 acgttgtata atgttacatt gaacgatagc cgtcgatacg tgttaaaagt ggaaggtagt
    46381 gacaacacta atccacaacc agaagcgttt gagttaacag tgactaatgg gaacgatact
    46441 aattgccaga acaatacacc atctttctgc acttttacta cttccactcc tccaacacaa
    46501 agtagtaaaa cagatcaatt tatgacggtt gcggcgagta ctggtacaca tgccgtatgg
    46561 gccctagcac tagttctcac cgttgttgcg gccctgatat ttggacaagg aaaggtgaaa
    46621 cgttcgttat acacccgcca tcggagcgac gacagagaac agctaatcgt tcgttattat
    46681 ccagaaggaa gaaggttaac atctgctaac gatgattcca gtgacgcgta tgattctacc
    46741 taatttgcaa acctgcacaa ctggaaaagt tagttttcag caaatatatc gccgcgacca
    46801 tgagcggcaa ctgtaccaat ggcacagcgg cacctgccct caaccaggct ggcaacgtgt
    46861 tagatatgtg gccactaggt gtgatgattt gcggggcggg tggcatgacc tcggtggtgg
    46921 gactctttta cttgatctat gactggaatt ttacctgtaa agtttgtcgc gatgtgtgtt
    46981 gtaactgtca cgaatgtcgt atctgctgtt atgattgtta ctcttgcctc aacggttggc
    47041 ggcggggtcg cacgcagttc agccggcggt catcgcactg gcgtcgtcga cgcgaggagg
    47101 aaggcaacca gagagtggag tgggaagtgg taaacacctg gaccccgaac gaagcaaagg
    47161 acgatgcggg cgacgagacc gtcgtacaga acgttagtcg acggcccacc gtgttatgca
    47221 ctcccatctg cgcgaccact gagacggtct tcgttgagac tatagtgggt ggcgatgaag
    47281 atcgaccccg ggctcaccgg tgtcacgccg agctggtttc agaactgtga tggttgattg
    47341 acgtgctgtc taccgtgatg taacgtgtgg ttgtttgaaa atgtagttta ctgctttctc
    47401 ggtttgcctc gggtttttgc cagaacctca cgcgctttac cctgtgttgt gtgatgattc
    47461 gagtgtttca catgacctaa tacgctgtca gtaaataaaa aggccgctgg gcgcttgctt
    47521 tgcactcata caggtgtgcg agtcgttctt ttgtggtttt gtggctttct ggatgaagga
    47581 ttaaaggcat aacatggctg agacggtgag cattgttatg cttgcggggg tattaccctt
    47641 aacgatcatc ggggcactat gctttctcgt ctgggcttac tataaccgca aatacgcacc
    47701 ttgttgcctc aagtcttgcc tagaaaagat agcctcgttg attgcctccc tgcaaaaacc
    47761 tgaagatccg gaagagggcg ccgtggacca gaaagatgac ggacgttgct gtgtgtgtcc
    47821 cctgtggtgc gcggccacat gggcgcaggt ttgctattgc ttttctagat gtttctccag
    47881 atgcttcgct cagatcggga agtttatcga tgaggtgaag agaggggaac gctgttctaa
    47941 ccaagttgcc aaacagaacc tcaagtacta cttcccctgt tgcttccagt tctggaactg
    48001 gctgtgtgcc aagctgtgtc ccaaagaacc gcgccagagt agccggggac agcctaaaac
    48061 taagaaggac acgcaggtcg attgcgtgac agtcgatctg gatgagctcc cgtgcgaaca
    48121 tcagataacg aggatcgaat gttcgcctcc gaagaatgag gaagaagcaa acgccaggga
    48181 gaccgaggcc ctggttcaca agtgtccatc agattgcgat ttgaaagaag cgggtgagga
    48241 cgagaaaccg aaagcagata atttacctaa ccacacacct gagtgttccg ggttacctgc
    48301 accaactacc gcacctgaag actcacatgc agccacacct aatccctcac ctgaaccaac
    48361 gcccgcaccg gcactcgctc ccgcgccagc acccgagccg acgcccgccg tcgtggactt
    48421 gtcaactcta tcgcctgaca tcgccgccgt tgtccaggca gccgtgcagg ccgcactgca
    48481 agccgcactg gccaacgccc cgcgccagtg aacaccaagc gataccattg gacctggtta
    48541 ctatatatac agcacattcc gctcgatagt taaccacatc gcagcgcgct tcgccgagat
    48601 ggatctgttt tccatcttcc tcgagcgctt caaactgttt ctgagaagac taaccagcaa
    48661 catccgaaag tacttcgctc ggcctccgct gaacaccacg atcaagatca aaaccgcagc
    48721 tacctatacc acctctgatg ctggttgcac ttacatggaa ctaatccttg acctgtctga
    48781 tctgctacac agaaggctct atttggttga cccgcacaaa ttttcacatc aaatcaacgg
    48841 catcttagcc aaggaggtgt gtcacatcct gcaactcgtg cggtcgagtg ggaaacgaca
    48901 aacggcggcc gaggtgttga tctatgtcac caactgtccg gtgggtctgg ccagcgtgct
    48961 ggacagtgaa cacttttccc gcaccatgga cgtcaaactg caggctgcca tggattccgt
    49021 gatgttgcgc aaccccagag cctgacgcta gccacaccac aattaaccag gaactggact
    49081 gctctcgtca tatatagcca accctgctca gtttttgcac attgcttcaa gggagatagc
    49141 tctcgcaact cttgaacaag tttagaaaga ctcttttgca acatgaagtt ctggaccgcg
    49201 atgaagtcgg cctgcgggag atggaaaagg tgcttcaaaa acgcattctg ctgctgcttg
    49261 ccgcggcgct ccgggactca tgccgccacg gccaacatcg cggtgcagac cgacctgagc
    49321 tactgcttgc ccgccgtgga tcacaccctc atcactgtga gcgtggacgt gtccaacttt
    49381 agagctcaca aggtcggtgt gtgcaacgcc agcgcgttcg cgaatcacct ctctacactt
    49441 ctgagacgcg gggtgaaggc gtgtttgcgg ggagtcatgc taacgggaag agtagacact
    49501 gctgtgaagg tgagcgtgat cgcctgcggt taccccctga cgctggccgg catggtggag
    49561 accgaaaact tctcccatca catggctgac agatttcaga gaattctgca ggccattctg
    49621 gaaaatgtct acgcccagtt gcccgagcac gccaagcatg aagctctgag aaaaaaaagc
    49681 agcagctacc cgagaaaacc gagaccacca cgtgttcccc atccatcgtg actcgcaact
    49741 aacgccatgt gatgacataa aaggcccgct accctgggct tgcgccagaa ggctctgcgc
    49801 caacacccct ctctgctgcc accaacgcgc cattctacca gactgcattt tgcgcataga
    49861 tggaccagat ggacagatac attttcatcg ggatattcgg tttcatttca ttctgtacag
    49921 ttcttgccct attactcttt ctgatgtgcc ataggaaacg aaccctgagg gttcacgatg
    49981 acatctttga ctggtgctgc tctccatccc tgacggctcg actctgcggg aacagaccta
    50041 agaagttgcg gaacaaatta tgttcagact gcaacagggt gctgctgatc tgccataaac
    50101 ctaaaaagaa cacaaagact gaattgaaca ctgtctcgga gcgggaaaac atggtgatac
    50161 cagagatgat gcgggacatt ggcccggcgg acaagatcca gaccatctac atggaacttc
    50221 ctattctggt ttgctctgag ctcggaggcg ccgacagacc accgctgccg agcctccccg
    50281 agagaccccc tgtcattccg ccccccgaaa gcgtgacggt ggccatggaa gaacagcaaa
    50341 gtgtcaccgc cgcggtggat acggagcttg cggttagctt tccgagcgtg acgcccgaga
    50401 tggtcgccgt catagaagcc gccgtgcaca gcaccctgcg gatgatgacc accatgtcaa
    50461 aaccggggga tgccaagagt gactgactcg ggtgtactgt tgtaacaccg caggagacgg
    50521 gcgaccacgg tgtaccaccc cggacgtcac ctggaaatgc ccgcaacgtg atgccgcatc
    50581 atcagctatg actttgcaac tgctgtgggg ccatacaaaa aacaacttgc agatgtgatt
    50641 gattgattgc tcgcttgaca gacacaacgc gcacgacttg acagttgttt gtgaacacgg
    50701 ggcagccctg actggacttt gcgcttcggg agccgcgatg gatatggttt ttatagtttt
    50761 ggtggttgtg ggtgctatct ttgtagccat catgacattg gcgatgtttt gctacccgat
    50821 gtatgtcatc ttggtgtgct acaacttctt tagctgtccc tggctgggtg ccatctttgc
    50881 caggtgctgc cgcaagaaga acggccgcgt gtggcccgat gacttcaagc ggtcgggtgc
    50941 gcggtcgaag gaacgaatgt acagagacca agctaacgat gtgttgattg acattgacaa
    51001 cgtgaacgag ctaaaagcta aaacgaagac aaggaccaag agcaaaacca agaaaccgaa
    51061 aagcaaacct gtaaaggcat tatctgggaa ggagacagaa aagctgctgg actgcaatat
    51121 ggatgatacc gggactgaga gagaaagcca gtccagcgac gactccgtgt tttcagatga
    51181 cagcggcgtt ccctccagca gcctgcaatc cgtagcggtc acccaaccca gaatgaaaca
    51241 ctgagcggtg acgcaagctg aggcggagaa tgggccataa aaagccacgt cgtgtttcgg
    51301 gactcactcg cactcgtgtg agcagtaaca ccgttcaccg tcaccatgac cggcggcgac
    51361 tggagcgacc ccaccagcat cggcctgcta gtcttcggcg ccatctgctt gctaattact
    51421 atagcaggta tcatctttct ctgccactac ccgcgagagg cttgggcggc gatgattgat
    51481 gtcttcacct gtcagtgcat agttagctgc tacaggtatg gctgcgacat taggaaattt
    51541 aagactttga atatgctgga agatggcacg tacgaaacag tgggacaatg gctagccaga
    51601 cactataaca agtggatgga ccgctggcgc tacgggcccg gcggcaaacc cgatcccgtg
    51661 cagtactact cgccgccttg cgaaggaggc gaagagatgg ttaacatgcg gtcatcgcaa
    51721 cctaaacaga cagtggtaac cattgaaggt ggatccgctg ttaccagact tttgaccgag
    51781 cagccaactc aaccaacaac cgagcagcca acaagtcagc agccactgat tcagcagacc
    51841 gctgtgcaaa ccgcagtgga agtccatgtg cgcatccaga acgatgtgga aaccaccttg
    51901 gaaaaccaag aagaaactga gaacaccccc tgaagcacac gagcggacgt gggacgggcc
    51961 atcatcaaac ggcaccagat cccaataaaa gttttcaccg ttccccgtct gcgctgcctt
    52021 tggcccaagg actcgccagc cgagccagcg ctcttttgct atggaacttc ctacgctggt
    52081 agccactgta ctggccggca ttatcctgtt gatgatcctc atcgccatct gctgcgccca
    52141 gccctggaaa aatcgctact cgcgctatct gaaccctccg ttcctggtgt tcaaaaagag
    52201 atcgggagcg agaaggctgg aagaagacca ggatcccacc tttgaggaga ctgtgttgat
    52261 cttggagccc atgagcccgc agcccgtgcc gcagtgaagc caagcggagc ggaacacggt
    52321 gcggccagcc ggcggtggtc ggcgatcgcc gcgaccatgc gtcccgtgcg gtttccgaga
    52381 gggtcggcga ggaacggaac ggaggatgaa accgcgcagc tgataacgga gcggggccgc
    52441 tgttccaaac gccccgcgta cgttggattg ggccgggaac ggactattca ggacaggttt
    52501 cccagcgtgg agttctccgt accacgaccg atggtgccac gggtcgcagc catgccggtg
    52561 cggcgtgccg tagcggctct ggccgtcgtc ctgatcagca gcctggcccc gggagcgaga
    52621 tcgacggaca tcgaccacct gtcatgggac caatgctacg aggacaactc cccggcgccc
    52681 ctcatcatgc cgctgggatc gcagatcact attccctgca cctttctgcc tcactcgtgg
    52741 cccatggttt ccatccgcgc ccgtttctgt caatcagagt atgcaggtca tgaactcatg
    52801 gtgaatgtga caaacgggac gctggtgaga gatgatctga ccggccgtct atcgaatgcc
    52861 agctggagct ttgtggacct ggggctcgct cattacatcg ccctgactct gaacgtgacg
    52921 aataacacca ctgccatgtt tgactgcgtg ttgcgcaatg ccagccacgg acgcatcgag
    52981 aaacggttta cggttatcac ttttgtagag actttgcagc ggcccgggga acccgattgc
    53041 cagcccaagc tggggttcaa tgccgacggt gacaagatct ggaccgccgg gtacaatgag
    53101 tggcagcgcc acacgtgcgg gactttctac ggctttgatc gagtgttcta ctacttggcc
    53161 actactaacc gctccaacca caaaccgcct tgccctccga gtgcacccga tcgctgctgg
    53221 cccgtcgtgc agcagtacat cttggacggg gactgctttc gcatccaggt tccccggcgc
    53281 cgcaagatac acccccatct gttccctgat gatggacagg aggatgactt tattgaacta
    53341 ccctgggtga cactggggct gactgtgttt ctgatcggag ccctgtgcgc ggcactgatg
    53401 ttgatcatcc gcatgacgtg cggaaagtgc taccgccgct acgagcgctt ccaaaagaag
    53461 aagcacggct accgacccgt gtctggactg tttgtgcgcg cggctgagta cgacgagctg
    53521 tactgcagcg tggacgatga tgactacgac gacgagtgca gcaagtcgta cgaggcgctg
    53581 tttgagtgcg agtctcccga gccgccttac cccgacgaca atgatgatcc ccctttgtac
    53641 agtgaaataa agagacgctt gtaagctttt atgataaatg agtgtgtgcg cgtgttgttt
    53701 cagccggggt cgctgggtgt ttgcgggtaa tgtggatatg ttcctgggtg ggggaggaaa
    53761 tctaacatgg cggacaaacg ccgtgtattt acctgacgct gtttcgtacc acacccgctg
    53821 gcccgtcaac agcgccgcga aatagggtca gccacgagac ggcggcgcgt ctatcgcaac
    53881 catgagccaa cctggaaaac tgtgctgcta ctgtcggtcg tctggacctt tgtcctggca
    53941 gatgggtccc ccgcatcccc gtgcaacgcg ggcgagtatc ccgcgggcac acagtgctgc
    54001 ccgaagtgca gcagtacggg ctaccgggta aagactaact gtagcgagac tacagggacc
    54061 gtctgcgagc cctgtccctc gggatcgtac aacaacgcca ccgagaacat taactgtacg
    54121 acatgcgaca cgtgcaacgc gtcctcgtca gtgatggttg ccaactgtac cagtactcag
    54181 aatgttaggt gccggtcggt gaacgccacc gcgcatctga aaccgggcca gggccagcac
    54241 aaccaccagc actctggcaa ccactcgctg gcctcggact atgaggacga cgactccgcc
    54301 agccgggact ggtggttcct gctggtgttt gtggcgttcc tgttctccct catcctgctg
    54361 atcctgggct gcaggctgct cctgctgaac accacgtacg gcaagacgct gacggcgtat
    54421 atgtacgaga agatttcgta accacggcat aaccatggca taaccacggc ataacccaaa
    54481 agcacatatg tgatgtttgt tctgcgttcc ccatttgggc cacctcccgc catagcaaca
    54541 tgcctatcct ggctgtctgt ctcattgatt gatgtttctg tatagtaacc atgatccgtt
    54601 cacacaacta cattgcacgc atgataataa agcaatctca gcatgatgtt gcgagtcggt
    54661 gattgatatc tgtcttcctt attcgtgtcc tccgcgtgta accctctacc tgcgcgatcc
    54721 gtcccgtgag cactttatat attagagaga gacgcgtgat gccatgtggc caatccgcgg
    54781 aaaccgtgac gcggaatatt tccgtctggg tggctttata agcccgtttg caaatcgcat
    54841 cggtcccctc gaaacacaac cagacgacga catcatggtc tttattcagt accacaacgc
    54901 cgtgcagtta ctgtccgcgc gacctcgcga cggacccgga cgatgggagc acctgacgca
    54961 ccacgcgtcc tacaccgccg accatggggc ctgcaccgta ctgatggcta cctcacgcaa
    55021 acgctccctc gtcctccgga ggcatagcgc catatctgct gtcactctgc gccttatccc
    55081 tgataaaatc ctgaagaaac ttgaagtctc ggactgggtc ccgggtgcgt ggatcgcatc
    55141 ggagaccttc cctacctcag acgtcagccc gtgacgcaca tactactgtc cacaggggca
    55201 cgcatataat gtgcacctgt gttcttgctg ctaacctttt ggcccagacc cagagcactt
    55261 atctgatttc cgttgacctg accggggcga tgcaatactg tctgctgcta acctgtctaa
    55321 tcttttgttg ctgctactta tctctggtac gagccgtggc gaaggtgagg cgttgtccat
    55381 gcaagcatag caagcacgcc aagttcatac cacccagagc ggactgcctc tggctgcatc
    55441 gatccggacc accatgcggc aacgaagcct tagctcactt tccgccctcg gtgaagagga
    55501 atggaaagcc gcaacactca atatgtctga gctacggatt cgtgaacgag acccttcacc
    55561 gccatggatc tggaaacgat ggcaacggac cttactgcgt acaacgcatc aacggtaccc
    55621 gcgtgccagt tagatgttcg aattgcactg cacatgatct gtacgataaa ctgagatcgg
    55681 actcatatgg agacccttgg tggtggctcc cggactgggg aatgcagggt gaaatattgt
    55741 gaaaagcaaa caggtacgat aatgattgtc cagggaaaaa ttataacgta aagagttacc
    55801 ggtaactgaa tcgttatgcg cacctatata ctatgtattt tgatgtgtat cgttatgtta
    55861 agttacggtc atcatatagg attccggtgc aactgtgtgc atcgttacaa aggacgtata
    55921 ccatctggtc gcgttcaatg tgtttggatt caaaaccccc acgttggatg cgaacacaca
    55981 gaagttgtag catatttcaa ccatacactc agagacacac cgctatgttt agattatgaa
    56041 acatacaaag acaaactccc cacatcttct ggagcctggt gttatatcag aaaagataaa
    56101 aaacctgcgt tacataggct acacgactgg gactgcagac tgtgccacag atttaaaccg
    56161 tatcatctgg acgttcataa ttaatatcag aatacaacgt cgagatgctt atctctagcg
    56221 aggcgccgaa cacccaacaa cccacggtta cgtttgtgaa gacaaaacaa cagattaaga
    56281 aaaacaaacc gccatgaagg tcctttacaa tcctcggttt ctgggtatcg ctctgctgct
    56341 gatgacccta attgcatgca gcgaatctgc acacgaatta cgttgtcagt gcacacaagg
    56401 agtacaacga cttaatccaa gaaatattga caaagtggat attaaaagtc cgggggctga
    56461 ttgccctcac gtcgaaatta tagctacctt gaaaaatgga aaacaagtct gcttggatac
    56521 cgaagcccgc atgggaaaaa ggattttaaa aataacacat cattaatcac atccaacttg
    56581 gctgaaagtc tacatgccta aaaccacacc ggataagttg gcaacgtttc ctaacccaat
    56641 aagagaatac ggacactcca caatgctaat tagaaactca ttctggacag tagcaaacaa
    56701 tacgattaat tgttttgaca acataacata gcgctacaaa attaaatcgc aatgcaaggt
    56761 tttaaagtgt tatcagcaac cctgctaatc gcgctgttat ctggcaccgt tatttctgac
    56821 atggcgcaac agtgtctttg tctcaacaca gcaccgtggg ttaattggaa gttaattcac
    56881 cgcgtaaacc tgcatccccc aacacgcgtt tgcttcaagg aagaattaat gtaagttatg
    56941 caacactaac atcaaacttt gacaatatac attgaactca tttatatttt atctctacag
    57001 agctaagctc aaagacggac gcgaagtttg cttggatcca gaatctccaa tgggaaaaaa
    57061 gtttataaat aaaattaaag aacaacgaaa ctcacaataa aggttcactc tgtaatagaa
    57121 aattagttgt cttgtcttta ttaataaaac tatgcgtgta ctcttaatcg ttccgttgta
    57181 agattggggc gcttttctgt ctgcgtttca gtatctaatc taggtgattg cgtggggcac
    57241 aactgcgtta cagctgcatt aaccattacc acacaatatc atgaataaca agatgcgttt
    57301 atcttcaaaa agtcctgtct acgataaata cgaactaacc gtttactatc agaatgtacc
    57361 aacaaaaaca tgcgtgcatg tcagtcaatc cgccgtctgt taccaacaaa gcgggcacga
    57421 gacaagtgta cagaaacaaa atatgtactg tcatgtccta atccgcccat tacatttttt
    57481 aactatggta cgaatacttt cacgaaacgg tacgagacta cggaatgtaa aaggcactac
    57541 gtgttccacg gtacgatgaa ccctaaacgt tagttgcata aacatgaaac gcatcccagg
    57601 tttacactcg cacatcacca gtgttatttt gctcacgttt acattttggt ccaatgccaa
    57661 aaccaagcta ccagtattgt ctgggtgtgt caaaggccct tggttagaaa ccattccacg
    57721 agaagcactt tatgtgaagc ctattgcccc aactgaaaac tgtacccgac agcaagttat
    57781 tgctgttatg ccgaacaaat ctgaagtctg cctaaaccct tatgttaaag acgtccgggt
    57841 atttttcaac caactgttct accggatcgt cgaagatgat gacggcctgt atcaggtgct
    57901 ggacacccaa ttaaaattgc ccggctggac cgtcacaaga aaacactact tggcacatct
    57961 gaagaagaag gcttcacaac acaacgaagc catactctat cggcgcagca gatggtggct
    58021 gctgggatga agattctttt gtactgcttc ggcttgcttt ctctgcactg catatgctac
    58081 gcttcgcagg aggtctgtgg agctggttct ccggacctcg tcaccacgtc gtgcgctata
    58141 tctacccatc acgacccgtc ctatctcgct attttagtat ctgcagtttt cattctctgg
    58201 atgttcgtgg tctcctgtgt ggttctctag cttccattat gggcgctccg ctcgtcggcc
    58261 tcctgattgc cgcactttct ctctgcgccc tccctacgct agtcggctct gcggacgtta
    58321 ccggcagggt ccataccgag atgctccgct cgcctgaaaa agctgatgac ctttaccgtc
    58381 ctgaatttca tttcgagttt gccgcctact cttcgttttc ggagttcggt tgggccatgt
    58441 gtatagactg ggagagcatg acgtgctatc ccatctgggt catgcaatcg tgggatctta
    58501 gaaacgctac ggagatgtcc aaacacccgc acgactactt cgttaagacc actgtgtttc
    58561 agaccaagga ctttgtcaat gttgacctgt ccctgcgaat acagcccatg caacggaacg
    58621 ttggactata tgtggcgtac atctcatttg caaaaaacct cccgcaacgc ttctccgatc
    58681 ccgctgtaga ctacgcccga ttcgctctgt acctgcacac cgccatcgag tctcaactaa
    58741 atttgcagga cgtttttaaa gtcgaattcc acacctttgg aatccagacg gacgacgagc
    58801 tcttcagtaa tttggttatt agcaacccaa aaacgcctaa ccttattatt aacttcacca
    58861 ctacccatgg ggaaacgcac cgttgccgcg acgttaaagt tacggctcgg gacatgctcg
    58921 acggagtcat tcatgaggct attataaaaa agactaagga ctattaccct tgggtgcgtc
    58981 tgcacttttc tctgtattgg aaaaacaccc agatcacttt cggggccgtg caatatcatt
    59041 tcacggaaga ccagctggcg aagccgccaa gacagaagcg tacagactca ctgaagaaag
    59101 aaatctatcg tcacctcggg tttttaactc ggctcatgcg aagccctgca ctgatcaccg
    59161 tggtgctcat ttccctgatc ggcgcacttc taaaacgagc gccccgaccc cagtgatacc
    59221 gacgcgggtg cgctgtttct tcatcacgtg cctgggtgtt tataaaccac cctgaaggtg
    59281 tcgcgctgcc gcaatgacta ccagcaccag taccacagtg acgacgaaca gttccgcgtc
    59341 tacaaatggt actgccagca gcattgccac cagcaccgct agcactacca acagcactgc
    59401 caccactacc agcagcactg tcaacgcaac aaccgtcgcg accgcagcag cggcggctac
    59461 ctctgtaccc tttccgctag gagacttttt agggattgtt atttactgtg cttccacggt
    59521 agcactgtta tgtttacttg tggtgttagt ggctgcgctg tacggcgcgt tccactctcg
    59581 ccatgccgcg aattcttatt tgggaacgaa ggaggaagct gcaaaattgc tcaagagcga
    59641 acgcatgtcc accaagaaga ggaacaggta tgagaatgag taccagcctc tacgtcagtc
    59701 tcactctgat acggagtcta tgaccgacga ggatccggcg gagaaccacg tcatgtactt
    59761 tgacaagaaa ggagacttga tttcactggt aaatccgaac tacgggcggc cctcgtctat
    59821 tatgattgac tgtcagccag acgatgacga gaacatccat tactacatgt ctatctataa
    59881 ggaactcgct acgcaagcca tgaccgagcc ttcggattcg tgggtactgc cagcatctaa
    59941 tgtgatgcaa gtcagcaccc aagaagtgac gttgaaggaa ccagaatgtg atgacaactg
    60001 agtataaata acgtgctgtc aataaaggtt tttctagaac acaacatggg tgtacggtgt
    60061 gtgtgtatct gcgtctgtgt tgtcttgtgc ggcgcggtcg gagttcaggg tttctgttcc
    60121 gagttgtatg cgaatttcac tccgtacgac agaccagaca gctactggga tgtgtgttca
    60181 aaaccaattt cagacgcgcg tcggaatgag ttcttggaac gaattgtcaa cgcgtccata
    60241 acatatcact atgatatgag tcacgggtac gataatctag gtgcgttaca aaggtaagtt
    60301 gcctcacgct accgttacgc tttcacatcg tgtactgtca ataggcgtgt ccatcatgag
    60361 tgtatatatt tcagaatcaa cgtgacggaa gtgtcactcc tggtgaacac gttccaggat
    60421 ctcatgccag aaatcgcaaa gagtctcaac gtagaattca agacgcgcta tccgcaatat
    60481 acaactggaa aaaacggcaa agtcgcaact tggaaagtgc catcttttcg aaacatcgcc
    60541 agtcgaaacc tcatcgcctt tggtgccagc gcaagcagca tcttctggag acggaacctt
    60601 ttcctatcca ttcgtttgcc aataaaaaag caatgactcc ttactgccaa ttatgtgtat
    60661 gcatgttatg cctgcttctc ggtatggcga ctgctctaca gctgcatttg gacaagctat
    60721 gccctacgta tgcatctcct ccgcaagact tcggactctt tgaatcttac gatgttgaat
    60781 caaacgcctc tcactgtgga aatgaatcac tgtacgtttt acgtacaaag ttcggtcaac
    60841 acctcgtgga aaaaccatcc ccctgggtga ataaactcgt cacatatctc aggtaagatt
    60901 tcaaattgta tgcgccagaa aaaatccaca ggtgtgaata aaaaaagatg tattgctaat
    60961 cactgtcatc taactttttc cagtggtcga aaccactcca tatttcggac ctttacgaat
    61021 gtggcagcgt caccacaagc aacggttccc gagattacga aagaggacag tgatgcattc
    61081 cgtcgttaca tgaaacccaa gcataacaga acccttctct acaaagttaa agacggccct
    61141 gagatgcaca tctgtcagat gcgagtaact accacggcag cggcgtttac caattatatc
    61201 acgtttcaag tgaggattga attgaccgac ccgaatagaa aatttaacag catctgcatc
    61261 cgtcccaatc tttttgttaa agaagaacca gccgccacaa ccaggcctcc aagaaagtag
    61321 catcaagctg aagttatgat tgtactgtac atggtgtgcg ctctgttggg atttcttcca
    61381 tccactcacc cgaagtatgt aactgacata ccacctgcgt gctgcgagat ggttagcgtg
    61441 aactacctgc ccgtcaactg taccgacttc aaaatctgca ggaaccacac ggtctcgtac
    61501 gtatcactcc cgaaactttt ttcttaatat gtaaacttta aacttggagc gcaacagaat
    61561 tctaacttgt caaatccttc aacagactaa gctgcgatat tgggcagatt tgcttcccac
    61621 caaatttaac aaatgcagaa aaagttataa tgcctttgga aagaaactta accagggaca
    61681 tgatcaacag gaagctgccg gactgccgtt acaccccgta agttaacccc cctccctcgt
    61741 acaaaaccga acaccttatg aagatttcac aaagggtcaa ccatctccac ttttcctttg
    61801 ctttttttcc tagactgttt gtccgtccca atggaactgt acgttgtgcc agtcactacg
    61861 acgacaccaa atatatcttg ggcgcagctc atacaattga atatgaatgg gtcagccagc
    61921 caaaggaacg aggtcccttc gtagacttta actggtttct gaataagact ctggaatacg
    61981 gacggaacac aactatgacc cgcggactgt tgcgcggtgt ttctgtaagg aacgccacgt
    62041 cgagaactgc tgccaaccga acattggtga acacaacagc aatacctcat acaactgatg
    62101 ctgctttttc aactgcaacc agaagcactc ctttgtctag catgccatat acctcaaccg
    62161 ccggaaacgc cagtctcaac atgtctaact caagtacgga atacaggact catgtgcata
    62221 tcatctcaga accaccggat tctgtttacc cattgtataa tggcaactat acacgcgaac
    62281 tggttattct ctgctcaggt caataaactt gcttgtcatt gtgttaagtg tgagtggttt
    62341 ttctgcgagt tggaaggtgt tcgagtgggt acaaaactgg tctgaaagag gcctggaatt
    62401 gagtgcggaa cggtctataa atgagcttca ggtgaggtaa aaatgaggtt ccaggcggtc
    62461 taaaaacagg tctcagagag gtaaaatttg aggtctaaat gggtctgaga actggcctcg
    62521 tagccgttaa aaatgaggtt gagatgggtc cgaaatgggc tccgagacgg gtcagaaaca
    62581 ggtgtaaaat ggcttgcgaa cgaagttgag aatggccaaa aaatgggcct gagatgggtg
    62641 taaaatgggt gcaaatttgg gtccgagagg agttgaaaat cagtctgaaa taggtgtaaa
    62701 atgggtccag aatcgggtgt gaaatgagtg gaaaatggtc ccgaaattgg ccttttcgaa
    62761 ggccgaacat ggggtctgaa gagggtccaa aatgaatgaa aaagtggtct taaatggggt
    62821 ctgaaacggt ggaaaaatgg gtccaacatg ggccaaaaat taggcatgaa attggttaca
    62881 atgggacccc agatgggtcc caaatgaggc gtaaaatcgg ttaaaaaatg ggtgtctgag
    62941 agctcaaaaa tggactgaaa aagggaccaa aaatgcccgt tgaggaggtc aaaaataccc
    63001 cccctgaggg gtaaaaaata gggttgaaaa tgggtaaaca ataggtgaaa aacaggcccc
    63061 aaaatgacca aaaaaagggg tctgaaatgc gtgaaaaatg accccccggt ggggtaaaaa
    63121 taggacccaa aaagggtcca gaaatgagtg aaaattgtgt ctgagaaggg gtccgaaacg
    63181 agctgatttt tccaccgttt cgggcctcca aacagcgtga aaaatagcgc cgtcagggtg
    63241 cccagacgcc gtacttttca tatcccagac ttggcacggt gccaaggttt cgccagaaaa
    63301 taccccccgg gatatctgga aaaccaaggc ccgtagagcc tccaaactat gcgggatcaa
    63361 ttcccccgtg tcgggaaagt ccaaaaaacg caaaatcccg attttggcac ggtgccaaga
    63421 aaaatccgga tttggcacgg agccaaaaat tcttggcacg gtgccaattc caaaatggcg
    63481 acttggcacc gtgccaacaa atatggccga cctggcaccg tgccaaaaat acttggcaac
    63541 gtgccaagtt caaaatggcg acttggcatg gtgccaacaa agatggcgga cttggcactt
    63601 ggccaaatca atatggcgga cttggcatat ggccaattca aaatggcccc catggccctg
    63661 tgccaattca atatggcgga cctggcacaa ggccaatcca atatggccga cctggcaatg
    63721 tgccaattca atatggcgga cttggcaccg tgccaattga ggggtgggct acttggcacg
    63781 gtgccaagaa tggggagggg tcttggtacc atgccaacta atatggcggc catggcactg
    63841 ggccaatagt gattgatcat tatagccaat acccaatatg gctaatagcc aggatcaata
    63901 ctggtctatg gctatatgcc aatggactat ccatatatgg taatggatat gacgtatata
    63961 gcccctcccc aatatgctaa tgatattcca tatatgggct ttcctatatg agtcattata
    64021 cccctcccat tattataatg aatgtccata tatagggttc cgtatacgtc aatagaccct
    64081 cccattgacg tcaataggga ccacctacca ttgacgtcaa tggggtggct cattgcccat
    64141 tcatatcctt tcccacgccc cctattgacg tcaatgccag taaatggccc acttggcagt
    64201 acatcaatac tattaatagt aacttggcat tgaaatagta cattggcagt actcccattg
    64261 acgtcattta cggtaaatgg cccgcgacgc ttgccaggta ctgccccatt gacgtcaatg
    64321 ggcggtccac ttacgtcaat gggcgggact gggcggtcta tataagcaat gcgcgtttag
    64381 ggaaccgcca ttctgcctgc ggacgtcgtt ggagctccat tggaagaagc ggggaccgga
    64441 ccagcctcca tagccgggaa cggtgcattg gaatgcggct acagcgtgcc aactaatgta
    64501 agtacatgcg gatgctatag attctatagg aatccaatat ggcggcatac cgccatattg
    64561 ccacgccccc tatgggccct atagaatata tagggaggtg ggcgggccta tgtatatgca
    64621 tgctatatat agggggctgg acgtacatga gccagcccca ttatgggagg cgctattgct
    64681 tatgggcggg tgctattgat tatggaggcg gtgctattgc ttatgggtgc agccccctat
    64741 cggtgacggt atttccaatg gccccgccct atcggtgacg ccatgcttat ctataccttg
    64801 gccctatgcc atatggtgac ggtgctgtct ctgtatacgc ccctattggc cctatgccaa
    64861 ctcggtgacg ctgcatgctg gccctatgcc aatggtgatg gtgcatttca gtgtggcttc
    64921 atgccaacgg tgacggtgca ttcgagatgt ggctatatgc caactggctg tccgccagaa
    64981 ataaaatctt ggcacggtgc caactaagta aaaagcacat atatacacgt tatttcgtcc
    65041 acaggcttta tttacacact gtttaagcac ataagtccac agtatagacg cctatagagg
    65101 tagtggccgt gtccaggcga ctgggtgtct cctccagttc gtcctccact tcccggctcc
    65161 agtaagttga gccaatgttg agtccaatca ccactagcac caccagcagc atgccactta
    65221 aggccagcac cgttgttaat accgtcgaga gaggagataa tgcctcagca gacccaggtg
    65281 gctgatgatc atgatgagta ctagcagagg aggtaaggga tccagccccg ttttcacctg
    65341 ttgttatagt ccctcctggg gcagccttgt tgaggtgggt tatcaggttg agtccaaggt
    65401 agcacagact tactctgcgt tccatgttcc agttagattt gagttcagtc acaccaaaac
    65461 aacaccacca agcacctgca aagatggacc ccagacagct caagagaaag gctgatgatg
    65521 agcagagtga tcaggaagac cccggtgagg gaccctcttc tagtcctcct cctgcacctg
    65581 gcccatctcc acctaagatg ccaaggtact gtataggtat ttttctaata aagtgtatta
    65641 aacctgtgtc tggtgtgtat gaaaccctgt ctcatatatg cccctactat gttgcccata
    65701 gacgtgaaga caaagacata gaacaggagg cagtggagtt cctggaaaag ctgttagaac
    65761 aagagacaaa tgttgtcctt aacctgggtg accccctact ccacctttca cctgtgccta
    65821 atgaggtgaa catgcagtcc tttgaagaga tactgctgga aaaccctgga gatgttataa
    65881 gacaaacgca aagcgtcggt aagtatgcct tgtgtgttgt cttatttctt tcactgcaca
    65941 catgcatata cacatactta catgatttta tcttcccaca gtgtggcaga tcaagctcag
    66001 acttatgaga aaccacacaa gccacaaaaa tgaaggcctt ttccagataa atcaagttag
    66061 attagaaatg cacaaagaat ttagagaagt acagaatgag atggaaggtg ccatgagagt
    66121 gctaagcaag ttatctgatc cttttaagga tgggaaaggc atcttagaaa acacatatca
    66181 catgctgtgt gattatcaga tgccacatgg ctcagaaatc agccagaaac atactgaggc
    66241 tgttaagcta actgcccaaa tggctgtgaa actcactaaa aagttggaag agattataga
    66301 ggacaggcag agacagaaac agagagccat ttatgaatca ctgcactaca tgatctatgc
    66361 atactcagtg caggcagtaa actccatatg catgcccaaa acaatcaaca gtcagcaggc
    66421 agctatcatg ttcttaagag gtctgcctca acatgatggc atggaggatg ttgtgcgaca
    66481 gggcaaacaa gtgatggata tgttagatag ggagccaaat gaaattacca atttcagtgg
    66541 catgttcaag aatatgctgg agagcattaa gctggccctc cgtaaggaag ccacctttac
    66601 aactgagaaa ttcatgatgc agatgtttcc acctgtaact caggcaacat catgggtcaa
    66661 cactctcagt gctttcatct gccatgagac tgctgacatg ctgctcagaa atcctcagat
    66721 aacagtagag gagattgtta agaaaatgga gtttaagatc agggcattag ctagagacat
    66781 gttcttaaaa atggtggtag atagaactga caaggtgaaa actcaaagcc ttgaggattt
    66841 tagaaaagtt atcaaagaag ctgaggatga ggaactactt gctaacatca ttggtggtga
    66901 cccattctct gctgtccgta tgaggtctga atcagaagat gagagcgagg aagaggagga
    66961 acaggctgag acagatgagg aggttgaggc agagagtgag gaagaggaac aggctgacac
    67021 tcaggctgag gaggagactc aggtagagga aggacaggct gcacaggcag aggaagggca
    67081 ggctgagaca ggacaggctg aagggcaggc tgaggaagag cctgaggagg agagtgagga
    67141 agaatccttg acagagagtg aggtagagat gatcatgctc aaagctggga agcctcaagt
    67201 gaagcaggaa ccagaaccac ccaccagcat tcatcccatg gtgaccagaa gcaagaagag
    67261 ccaccagtaa agacagatag ttatatgggc tggtccctat aactcaaaca ttgtgcccct
    67321 tagccagtca gttaggaatt aatgtactaa ttgtatgtaa ccccctgttg tttaactgta
    67381 ttaacatgat atgattgcca tatactttat attatactct atatactcta tgttatatac
    67441 tccatgtata caatatatac tcacatagga cactgttgtt acttggtgtc tgagacttat
    67501 gtctggtggg aacttgggaa gatattgtgt ccttgtcctg tgtactgtgg atcaataaat
    67561 gtttccctgt tccaaaagta ctaagtgtgt cccgtgtctt tctttgactc aggtggtggt
    67621 ggtaatgatg atgatgacat tcttgctgag gctgtcaatc aagctggcat tgaccagact
    67681 tcagcaggta tcactatcac cacttcaact ttcaccacca ccgccccagg catccctcag
    67741 ggtgtcagca ctcagcccca gacgctgccc aacgtcacaa ctgtttctcc acctgatacc
    67801 agcggcagtg agcggaaaaa atcccgtaag gccaaccacc ctaccaagat cattattaaa
    67861 ccgcccgtgc ctcccacgtg catgctggcc gcttcggaga tcaagacaga gcccggtgaa
    67921 gattgcttgc aactcaagta caaacacaag tccagcagaa aaccaacctc tccttctggc
    67981 tttattgtga tctcagacag tgaagacgag gaggagcact cggtctctca agaatcttcc
    68041 tcacaaccag gtgtcaagct cacaatgacc acccagacta ctggatcctt gggtcaaatg
    68101 tctgtggaga gttcctcttc ctcctccagc agtgactccg agtgctgtga tgagtgtgga
    68161 ggggggtctt cacccagcac actggcctct cccatctccc ctcttcctcc cacaccgcct
    68221 cctcccgtgg tgatgcccag cacatcatct ggcatcacca ccagtgccaa gaagcccaag
    68281 actcccaaaa ccaagaccac caagagaatg gcctccctgg actgtgagaa ggtgagaagt
    68341 gccatgaggg agaaagctgg aattgtcttc accactccta cagtggagac caagagaggc
    68401 agggtgaaag ccggtgaagt gtctcgcatg ttccgtgcca ccagcaggtc actggagtac
    68461 aaaaacctgc ccttcaccct gaccaacgtg caccaggtgc tgtctgaaac cgtgaacatc
    68521 tgcaaaagca tgcaagtgaa caacagaggt atcatgctga tctatacccg cacccatgaa
    68581 gtgaaagagg ccgtggatca ggccagagtg aggttgggaa ggatctgtaa cttagccatc
    68641 tccactcctt tcctgatgga acacaccatg ccccacgtgc acagtgctga tgccacccgc
    68701 aagaccgccg aggcctgtca gcaaggaatc agatccgcat gggatataaa gaccgtgcac
    68761 accaacgaac tgtgcccccg ctcatctgac taccgcacgg tgattgtcca tgcagccacc
    68821 cccgtggact tcctgggagc catacaagtg ctgattcccc tgaaccagca gttccccaaa
    68881 caggtggcca tccgcatctt ctctgcagag aacaccaact ccttcatgct ccccatctat
    68941 gataacgcct ccaagatgta tgcggtgggc cagtttgatg aacccaaaga cgaagaactg
    69001 gagaacctga gcatggccat cgagaaagcc atcgaggaca tgaaccagga gtcccagtga
    69061 agaagagtgt tagctaagaa tgtgcaagca ggcaagcaca gtagctgccc taggtactga
    69121 tgaactgtag gtggctctgt ggtgctgtgt attgcaagca gttagtttct acttgattac
    69181 ccaacagtgt tccatgtata ccatatcagt attaccaact ttgtatgtgt atgtatatat
    69241 attattataa taagctagat aataaatcct atcaatcatt tgtagataac ctgactccag
    69301 tgtcctggcc tcttttgttc tgtgaaagag acatctgttg gtggagattg gtggtctgtt
    69361 gccatgctgc gtagcctgaa tgtggcgtgg tggttgacaa tgacacttat caccgtggtg
    69421 gtgaacatag ctgacggaat gaacactcca gagatgtgtg cagacgttga aggcgtgaaa
    69481 gtgaaatgcg tgatacccaa attggacaat cacctttatt ggttcataaa tctaactgac
    69541 agaatctggg cctttaacca tactacctcg gatccgtacg cgttggatgt ccgtcagccg
    69601 ttgtggtccc catactttga gataataatc acccctgtct tgccccacac caccgtaggg
    69661 atgctgctgg aggagacccc agggcgcccg gacctgctgt gtgcaggtgt ggtgccccac
    69721 agagaacagt tgaggcagtg cgacccggag tttgacgcgc gcctcctgtg ctccatctct
    69781 gtgctgctgt cagtgctggt aatcgtggcc gggatcctga agatggacca tgacaccaca
    69841 ggtcagttgt acaactataa attatggctg tcacgtcgaa cgcgatattt tgagcccgcg
    69901 gtgaagaggt ggtaagatgc tacgtttttc tgacgctgtt tggctgtgcc tagggtgcgg
    69961 gctggtggta gtgacgctcg tatgtggaac tcctttctat cgaggtgact tgtatgcgcc
    70021 tactgtgaag atggcttata tttattataa tgcaactaac ttaactatct attgtaacac
    70081 ctcagctaga cagtctcgct tcctagcaag tggaattatg ataactacta gatataacac
    70141 cacctttatt aaaagtggat acaaatatca cagaagacct acactattct atctaaagtt
    70201 aaataaaaca ttagaagcgc catatggttt ttataaaaac agtatagtga cttgttgggg
    70261 atcaaatggt acttatggag ttaagtccta tatcattaga agaattacca acgtatcttc
    70321 ttctgccggc gtctctagaa tgagtcccat tatagttaat gatacagacc tagttgaaac
    70381 ccccgaggtg gctcttcagt ggtggcctaa gaggagacaa aaccaaatag tgatgggtgt
    70441 tatagtgtca caatttgtat ttgtactatt tattattaac gtatgcctta tatggagcta
    70501 taagttcaag cgtcataagt gacgtacaag gtatacatat agcgtgttgg cacagttttc
    70561 tgttagacaa gcatgcttgg caccggatcc tccgggtctc ctgtggccct tgcggccttg
    70621 cttgttagcc atctgattat cggcggagtg tccactacca gctctccgag cacctccacc
    70681 tctgcaaata catcatcaac tgttgcgagt ccaacgtcaa ctaacgcttc aacgggtacc
    70741 accgctcctg ttacaacaac tgtaaccagt tcacctaaca gctcaacagt cagttcagtg
    70801 agtacaagtt ctgctaatac aactgtgaca tcaacctcga gtcctggcaa ctcctcggag
    70861 aacacaacca cagcgaactc taacagcacc actgataatg cgacaactag caatacgaca
    70921 gcgtctccaa caactctcag caatgaaact accaacacca cgagcgttcc taccagtgtt
    70981 accacaacca acatcactgc aaccaacaga actttgttac ctgacatcaa cgttacatgc
    71041 gaaagtgctt acagctataa ctatcaagtg acggtaacga gatgcaaaat ctccaacatc
    71101 aatcatctga acaccacgac ccgtgatctt atatctatag agtgttatca acggactgga
    71161 tgcgaaggga actacaccag ctttggatcc gtcaccacca gcaacagcag taagtacagt
    71221 cactttacat acgtaatgta taacttgtaa aatgtgttgg cttccattaa ctcaacatgc
    71281 ttatcattta tttattacag cacaaggaat gcattacaac cgcagtaccg catacttcac
    71341 tctcacacaa tcagctccaa atgtcactac gcaatatact tgcaaattca tcgcgtcggg
    71401 gggacaaatt gtcaacaaaa cctgggaatt tatgaacgtt cctgtaaagg ctttctttgc
    71461 ttctcagctt aacaatactg tcactcagct tcgtctcatt gtcaatgatg acaaatcctg
    71521 cttaaacgaa agcatttaca ggaataccac agcatatgtg tacattgatg gaacttgcca
    71581 tccatcacat acagtccgca acattaccaa agataaccag cacttttggg aatacatctt
    71641 ccatctaaaa gattacattc ctgacacagt tcgcctgaaa ctacaccttg gcaacaagca
    71701 ctctcttctt acgtacattt tcctgaggcg cgatccggac gcatggccca tcatcggact
    71761 gctgggctat gccatcctcg gcttcattgt gtttatgcta tttgctctcc tgtacatcgc
    71821 ttacatcctg atgcgccaac agaatccttg ggcgtaccaa aggctggacc aggaaaaaga
    71881 ctacccaccg cctccgtact ataagcagtg gtagtcagca gcacacagga cacacaggcc
    71941 tcaccatgta ttccaacatc agcatcgtcc acagctcgca ccgcgtctcc aagtctctcg
    72001 cccctgctaa caagagaaag acccaccgca ccattgtggt agtgccgcag aagcggttcc
    72061 tgcgaatccc cccggacaac caggacgtga accatgtgag gatcatgcat ccccgtccat
    72121 caacatcacg tgacgtgagt cagcccacag cagctcccaa gctgatcaag agcgtgtacc
    72181 cgtacggcac ttcgctgatt cgcaagtgct ccagggacgt taagcagcag aaacgcctca
    72241 tcgtcttcaa tacagctccg cccgcgtccc agagcgacac accatccgga cccagcaaca
    72301 ggatggaaga catggacgac atcctagaca ctttccagcg ggaaatgtac ctggccccca
    72361 actgcaatgg aggagaacaa gccatccagg agattaacat ccacataaac accccatact
    72421 cgctggacga cgacgaggag accgccagct gtcccggacc cgtttcgccg ctgtcgcctt
    72481 caccctccgc gtcagaagtg tccgaagagc agcccgccgt cccgaccata gacctgacgg
    72541 accaccgcgt gctgctggaa tccacggact tgccggagga attccacaac tcaccttact
    72601 ttctccccac cgactgtcgc tttgctccca gctgtgtaat aaagtacaga tacatatttg
    72661 aagaactgtc tcgcgtgagc cgtgtgtacg actccaccgc cattcagatc caggtcagcg
    72721 ccgcctgcgg caacgcgttt cagaacctaa aaatcactct gctgaagctg cacaatatca
    72781 ccgtgttggc agggccccag atcattaccc agacagtgcc tcacactcct caagccatcg
    72841 cagccttcaa gtactgccac gccaactcgc acaacgtgct agacaccgtg cggtccgtgt
    72901 tccccagatc cgtgtcgtac tatgaaacgg gagtgcacca gctgtatgtg tcgggcgcga
    72961 ccaagaaaga cctgtttgac gcggcgacgc tgtgtgccgc ggtagcagaa aggcagccag
    73021 acatatttaa tatcaacatt tgcgccctgt catatccgtc tatcgccgcg cctcatctgc
    73081 ccctgtacaa cagcttcacg gaatcccatc cctaggcatg caagaggcga tgaaaacctg
    73141 ggtgttgcta gttgcgctgt ttgccatcac gagggactcc gcttgcaaca atacatccac
    73201 cgctagcagt agtagcacga gcagcaacac tgttactagc agcaaagcaa acaatactac
    73261 ctctatcagc agtagcacgg tgagcagcac aagtccctca ggcagcagta gcgccacaag
    73321 taacacaacc aaggcaacca cgtctcctgc cactaccaat ttatcatcag cgtcgccggc
    73381 ttctagtcca gctacagcca ctacaaacag tacaactact acacctacac caacctccag
    73441 caaaaatact agcgcaggca gcagtacacc gacaaacaca tctaacaaga catctccacc
    73501 agcaagtaac acaagtacac catcagcaac taaaacagct aactcaacta ctacaaacaa
    73561 ctcggcagct gaaaacacta ccaacatcac gccaacattt agtacagaaa acgttactgt
    73621 ggactctaac tttaccaccg ggtaccctaa cgataccttc aacgccacta cagatcccta
    73681 cgaagttatg caaattgtag acttgtgcaa tgcaactatc tctatcatct ttacagactc
    73741 agatgaagaa actgaggaaa gtgatgaaca aagcagtgaa gaacaacaaa gtttcgattc
    73801 aatagatgac aacacatatt accctgtaaa cccaagttac agcctattat ctgactctga
    73861 tgacgtcatg tacttctatg ccaattgcga gcgcaatgac actttgagca acacctcatg
    73921 caactatact aaccagcgcc tcacctcctg gtcactagtt agcagcgtgt ctttctaccc
    73981 tgcggagcta accaactgca acaaacccgt ggcagtcatt gaagttggca acagcagctt
    74041 ggtagttagt gcagaagcta cctcgaacct ggtggacgga atatataaag ttttaggagt
    74101 gccagacctg aactccagct ttctaaaaga actcgcaaag ttccagcagc tgatcataca
    74161 aggacagaat aaacctcaaa agtgaactgt caagtaagaa aacccatgca gaagatattg
    74221 gcggtgagtc tgttggtaac gctgacctct gcttacctgc ctaaaaactt tacctgtctt
    74281 gagctcacac gccgatgctt tatcggggaa acttttccac ctgaagatga gagctggact
    74341 aagcctctgg tgcacgtcaa tcatcccgat ggcaatctgt cacagctcct gcgttttacc
    74401 gctagcacaa agcatgcctc ccctctgatc tcgctggacg acaactttat ggattacctg
    74461 actctgctcc ataacaaccc gcagcagcta agagttttgc tggccttact gaaatctgac
    74521 gctgcaccgg tttggatgac tttgatgcaa ggctacagcg agtgcggaga cacgggcccc
    74581 atctacacct gcattgacaa tgtgtgccgc gcgtacgacc ttcgccaact cacatatcaa
    74641 cgcagtatct ttactgaaca tgtattgggg tttgagtttg gagacgaggg acagttctcc
    74701 attatcctgg ctttgcgcaa cctggattcc aaggtccatc gccctatccg catcccggtg
    74761 tccaccaaag cccaaaaaga cggactgccg ctgttttttg cgatttacaa ctatctgaaa
    74821 gaattcttca tacgtcacga cctggagacc gccctgatcg atcgcctgga taaatactac
    74881 cacgatctct cagacgagtg gaaacagccc ttgtcaaaca accccgcttt gctgcataat
    74941 ggccttaaaa cagtggatgt tagaaaacat tcccgataat aaaccttgtg tgttaagcta
    75001 tgatgaacag actcgaattc tgtctcttaa taaagaatgg ctagtgtttc taagcatacc
    75061 gtctagcgac ctggccttgc ttcaggagac ggtcactgcg gtccagcagg ctcgccggcg
    75121 cgagaccgtg taccctccgg ccgagcacgt gcatcgctgg agccagctgt gcgcgcccaa
    75181 cgatgtgtac gtggtgattg tcggtcaaga cccgtattgc gacgggagcg ccagcggcgt
    75241 ggcgttcggc accttcgccg agcaggtcgc gccgccctcc ctgcagaatg tgtaccgcga
    75301 actgtcccgc accatgagcg gcttccagcg gcccgtgggc ggctgcctgg acgactggtg
    75361 ccgccgaggc gtgctgttgc tcaataccgt gtttaccgtc gcccgcggcc agccgggttc
    75421 gcaccggcat ctgggctggc agctgctgag cgagcgtgta atcatgagac tgtcagactg
    75481 ccgcgagcac ttggtgttta tgctgtgggg caccgaggcc cagagtctgg agtacctgat
    75541 cgataaaaac cgccacctga tcctgaaatc ctgtcatccc tcgcctaaga atacgaccaa
    75601 gtcctttgtg ggcaacgacc actttgtgct gtgcaacgaa tatctggaaa aacaccacaa
    75661 gataaacata gattggagct tgtgaatgtt tttttattaa aaactgtaca agataaagaa
    75721 tggcaatatg aatctcaata ataataacgt atatagtaca aacatacaca cccgcttgtg
    75781 gacctgttcc tttcagtcga aaaacgacgc gatcgaggca gccgccaaag ctacctcttc
    75841 ctcggcgtcg ataatctcta gtccgtcctc ggcaaaggat ggggggacgg ctcgcctccg
    75901 gctggggcct ggcaaaacct cgtcctctga ctcgtcgtcg tcccggtttc tccgccgtct
    75961 tcgagacgag gaggaggctg aaggccgccg agcgccaccc ccaccgcgag agccgttacg
    76021 agggcgagca cctcccctag tccgtctggt ggtggcggct tgctcaggct gctgctgctg
    76081 cggcggggga gcggcgggag tcaccatata gggtcggatc tcgcacacgg gacggggtac
    76141 gtcgggagca gcgttggcat tgctggtgct ggcgccggcg ttgacggcag tgctggtgct
    76201 ggcagcaggg gtggcggccc gtgattcgca ctctgaaaca cgtctggtgg gaagcggggg
    76261 aatgttaggc acgtccttac tacactcatt gatcagtctg gtcaacgatt gtataatgtc
    76321 ctcaaaagga gggctgcgag gtggaggagg aagtggagga ggtgatattg gatcggtgat
    76381 ggtggaggag gcctgcggat tcggaggaac agggcaatta gaagacgatt ccgaagcagc
    76441 aggcgacaag tgcgcagtac tagtggacgc cctgacccca tcatcaatta taggtcccac
    76501 ctcggccccg ctattcccaa gtgcgggagc cgcggactga gcctcgtcgg gctctccggc
    76561 ggcgtctcca aacccagatg tgtcattgtg taacgcaccg tcgccacctg catccatcaa
    76621 cgacggcgcg tgtgaaaaat ttagaaaagc cacagggtca gattccggcg ccagacgcgg
    76681 cggaggatgg tccgaatcat tcttcgagtg atcgtggtgt gtctttggcc ttttgtctaa
    76741 gggagagcct agacggacac cgcacgaaaa tggaaattaa tgatgtgttc cgcctgcgag
    76801 ctgccacaca cccacagcgt caccatcatc cacaccacca gcacactccg cggtcacagg
    76861 ggccgcgaca cggatcgact taccgtccgc gtctggtcgc cgttctttgg ggcgattcag
    76921 catgcgtgga tcgcgcccgt ccgatccccc cgaaacccgc acctgtccat tgctgctgcc
    76981 gccgccgctg ccatctacca gagagttagc ctgctgttgc tgcagcagca gctgctgctg
    77041 ctttttgcgt tcgtgacgat gctcgctacg tgcccgcttc tcctccacac tcgcggagga
    77101 ggcagcggca gcaacagaag acgaagaaga agcgccagag gacgacgcct gtgaacccgc
    77161 gtccacagac ctaacgcagt gcttgacctg agtcacttgg atgttgtttc cctcgatcaa
    77221 aaccgttaac aaggagctgt catgaggtcc cgaattgccc accacggacg aaacgccctt
    77281 gtttttcaaa accatgccgc gaccggacag ggtttccacc gtgttttcga tagtaacgtc
    77341 cagagagaga cagcccggcc tctgctgcgg cttctcgcca ctcgttcccc cattctgaat
    77401 aacggtgacg cacaaccagc ccttcccgaa aggcgtagtg gtgccctcgc cgtcgacaca
    77461 cttgacgaga cgcgcgctct cgaaacagaa ctgttgcacg tcgaaatccg tattcacgct
    77521 ctgatgcagc gcgcgcgtca cgccatagaa agtccagtat ttgcgcgtca acgtgttgtt
    77581 atccatctcg cagcaccgct cccgaacgct gtggcagccc ttctccgcgc gtaagcagct
    77641 tcagagagct gccgcggctc gctcattcta tttatacatg atgaaccgct cccgccctgg
    77701 aacacccata aacaacgtca cgacgcaacg tggttaaaca gtacgtttat taaagccgaa
    77761 ccagccaggc aggctgagag ttgtaaaccg gagcacgttg aattaaccgg cacgttgtta
    77821 gtttgagtga cagctccctc aggactgcgc gaggaaggtc tccaaatagt tgacgagcag
    77881 atccacctcc gccgtggcct taatcgtgcc cttccacgga tccagctgca aaaagaacgt
    77941 tcagcgtttt gctaaaccga aatggcacgc ggccaatact ggggaacacg gcgacctgaa
    78001 ctgaccttgt gctccgtttc cagaaactgc gtccacgccg gcgtttgccc ggtacacgcc
    78061 agggcaggct gccaagacac aacaaacacc gtttaagcaa acggcgaaat gacaccacgc
    78121 ggtttctaaa acgcagaggc ccctaaaggg gtcgagtcga cacggggtca accagaggtc
    78181 atgtcgcgat agtggcgata tggcacgata gtggcgacat gaggcgatag tcgcgacatg
    78241 gccattatgt cggcgacatg gcgcgatata tggcgatatt cggcgaaatg ggccgacata
    78301 tggcgatagg taagcgtgta gtgccgatat cgtgcgtata tcgcgcgata cacggatcaa
    78361 acgtgcgata tctggcgata tacagcggtt ggaggtaaga cggagcctaa tttcggtttg
    78421 tctgcgtatt tggagcggtt cgtatcgata tatcgcgaca tactgcgact agagtcgttt
    78481 tacggtttga aaaggtttct agtgacattt gcggagctta tatcgcattt gacaggctcg
    78541 tatggcttgc caaattccca cggaagcatc gcctgccaag ttttaaagga tgtcaacaag
    78601 ttgttctgcc aatgtttcaa ggaaatgtcg cctgccaaat ctgaaaggat gtcaacaagt
    78661 tgtcctgcca acattccaag gaactatgac ctgccaaaaa atttggctgc caattttcca
    78721 aggaaatgtc gcctgccaag acgttagacc gcagccaact ttccgaggaa acgacttacg
    78781 catttcaaca tgtgtttata caaagcgtcc aaagaagaaa ccaaggaatg caggccatcc
    78841 aaggtcgtgt tatcgtaacc gcactgaaat gctcgtggca gcacgccatc cagataatgc
    78901 tgcatgagct cattcgttac gcgacagcca accggactca gcatttcatt taacaagtta
    78961 tcatggaaca atgaaacata gtacacggtg tccttgcttt gctgcaaagg gaaaaaacag
    79021 gacagcacgt tatgtttcca cgaagtaact tctgtcacac gagagaaacg tcccgcaacc
    79081 taccagcgct tgcttaatgg aaccgtagcc agtccgcact tctttgatga tgcgcgataa
    79141 agtgccatgg acgggatcgc agtccaccgg cgggggcttg gaagctccac agccccgatg
    79201 gacgaccgcc gccagcaccg ccaggaggca cagcgcctcg gagacgacac cgcacaaccg
    79261 caccagtcga gaccccatgc ccaactgccg agccgcgcca cggagctgca acagaaaatg
    79321 gtcgttcagt cacaggtaag gtggtcccct acaatctttc tttttgtttg cttttcctca
    79381 atcctaatcc ttgaagattt attagtctgt ataaccgata cattattgat aacagataac
    79441 aaatttgaca ggtcactgtc accactaaat agctacgaac gacacattat aacgatgata
    79501 aatggcaaac aaacgcaaaa atatctcctt gccttgtctc ccgggccggg tgggcaaaaa
    79561 atcacggtca aacatcttac tgaaaaaaaa actgtgtatg caaaaggaaa taacaatagc
    79621 aactcgatct acaccacgga caagcttacg acatactctt gagaaaaaag aacatcgtcg
    79681 tccatcgtaa aaaaaaactc gaaaagaatc tggtatctac tgcctacttt cacagatgta
    79741 ttgcaaaaaa tagtggaaat gtaatttgaa gacacttgtt tattttttta cggactggat
    79801 gtttcttcga agaagaagtg taaatgggta gcaccttcag agattcgttt agcttctaac
    79861 tctttcgtaa agttgcacta aataaagctc tacagaaggt tcgagccgct ctcgatctaa
    79921 cgtcacaaac ttcacgtacg tttgtacaca gactcagatt gaaccctcac tttgctaaaa
    79981 aagagatact cgagatccta catcgaggac cctacatgat atcgcgggaa gatcagattt
    80041 gacacgcgaa taaacacgga tgtacacgaa ccaaaaagcc acagactccc tgtttctgct
    80101 ggggaacttg aaaacacgaa cgcaatctat ctgtatgacg ataatagtta cggagaagca
    80161 attctgttag cagcataaga gaataatacc taattcacat ttagttctcc taaccaaccg
    80221 atatccatat tacagttacg ctattttaca ctacacgaac gacaccgctc agatgaaaag
    80281 agaagactaa agaaaaaaga ataaagagag tggtgtcact cacacacttt cgctaaagat
    80341 gcaacccccc ctgaacaatc aagccagact tgtaaaaacg ataactgtgt aaaaaaacaa
    80401 acacttaact caagaaacaa gtacgcatgt tataggggta gaagaaaaat aaggctaacc
    80461 tttcgaaaaa aactactcaa ccaacagcct gccccccacc cccaccaaca ggatatctaa
    80521 tcaagcatca aaacgaacaa ccacagggtc gtcccccacg accggactct ccggtgagcg
    80581 cgggttcgcg atcgaggagt cccgggcaca ctgtcgtcgg gcgtcttcac ccacaagagc
    80641 caatgcacag agttatttct agcaaccgcc acgctttcct gcgcctcgcg gctggcccgc
    80701 gacgaactct ttttgtgccg ttgacggaga acacatcgtc gacggcacgc cgtaaccgcc
    80761 aagctgtaga cacgtctgca taagcattct tcttcttttt ataaatgata tctttagata
    80821 aatcgataga aaagcctcat aacacaatat tccataagta cacatagtga taaggtacat
    80881 atagaacgta aatgtttttt tcgccgtaag tttcctttcg tgtgtatatc atgttttacg
    80941 tatcttcgtt tttgtttcgt gtttgatatt ctcatagtga ctataggaca ataaggtata
    81001 gtgacaacca atctatatag ggttatccgc taagctatca tataggtata gagtttaagt
    81061 tcttgtgtct ccgctcccta gaaatcatta gcgacaaccg tagtgataaa agagccatag
    81121 cgataaacaa caccctatac tccccaaccc tatagggcta ctccatagtg cacataccat
    81181 agcgataaaa taacgcgtct ataatctctc agctaatcac aataaagaat ggatggatag
    81241 ctgtaagtct cacacctaag ctgtgtacat tcatctgtat catctagttt aacacaacca
    81301 tgaatgactt aaatctatat ctgaagacta ttacgactac atcatcatca caaacgttta
    81361 ggccgcagtc ctgaaagaga ccgagaggtt gttctccggc catcgtcact cagttcttct
    81421 tctttggccg ccacgacatt ttttttccag atggtctggt cagtgtggtt aagctgtttt
    81481 tttttaattc tactattttg tctcttgttg ccataacaag taatcggtaa tctcgtaggt
    81541 ttaagtaagt gatataaggt tagggataaa gtcgtctcag ttaagcttcc ttttctacca
    81601 tcttttctcc ttctcgtttt cttttcgttg taatatttca taagcccatt ttaagtaagt
    81661 tgcgccatcc ccgtcgaggg agatgatgtc tttgtcatgc aagccaagct catgtgagtt
    81721 ctctgtcatc tggcccagag tcgtctgccg cgtctgctgc cgccgccgcc gcagacgggt
    81781 acacgaatcc tcacgtgtaa aaagaaaaac aaaacatagc agataagtta gttactcata
    81841 agaacaaaca atatcgtact ttaggactcg tacaaaacaa acaactgtag gtgttggtcg
    81901 ccagtgatga ccgaaagatc atcgaacgca cgttagaccg taatgttgat ttttttctct
    81961 taaagaaaga caccatagga ttctgaattt accatgatgt tatagctctt aagaaaattg
    82021 ctcttaggag aaagcttagt ttcctttgct agccccttta tcctcaatca tgaagttcga
    82081 aagcttccat aacaactgtt aaaatacccg tatcaaaagc tggatatcca tgtcgattgg
    82141 tctacatgat tagcagatcg cacgctatat acacaaatcg ctatagacgc caggcgcgcg
    82201 tcggcgcgcg cccactttca ggccacgaac gatctgaacg agcttttttt agaccgcttc
    82261 gtctctgcct atcgaacagt ttcagttgca tagagacaaa ggatgcacgc tgaaaacgct
    82321 acgcttccta actgtattgt tattaaggaa tgttagaaaa ataaacacct catacttctc
    82381 tcctctcatt tagaaaacga atacagaact acttgtatgt taaggaaata cttatgaatg
    82441 tatcaccaca tcccttataa cagctcagct cagcttttac gagcgttctg ttgtggatcg
    82501 tcaacactga ttcggaaaag gtctattctg ctacgtgaga gacacatcac atagccgttg
    82561 gcaatttttc tcaacacatg ttttattatc ctctctcttc cacacgggat cacggatgtg
    82621 tattcttaat taccagtgca tactgaaatc atgatgtgga gcagaatgag acccagcgga
    82681 gccgcccccg ccaggttctg gtccctaacg ccaggcaggg tggctcccac tcgttttccc
    82741 ctgttttgtt ctctttgtgt ctccctcccc gccctctaga agatcagcat cgtccgccgg
    82801 tccttgagcg cgcggcagat gtacggcgtg atggtcgtgt tcttctcgta cggcaggcgc
    82861 agagggttca cgttcgtcac caggtactcg ggatccgtca cccgcgacat ggccacgtag
    82921 atgtggctca tcttcaggtt cttgggatgg tcgccgaagt ccaccgccac cttctccagc
    82981 gacagcccct ggctcttggc gatcgtcatg gcggtccgcg acgtgatgcc gtagtccacc
    83041 gtggtgcaca cgtgcaagct cttgccctgc gtcgactcca cgaagcggga cacgttcacg
    83101 tccaacacga acagaaagcc caaggcgtcc ttgagcacta gccgcgacag gccgcgctgc
    83161 gccacctccg ggtggatgcg gtgtccgccg ggcaggctca ggatgttgtc cgtggtgtag
    83221 ccctcgagcg tgtacgtctg cgccggcgac acgtgcgaga gcatgcccac gaaggagccc
    83281 gtctgcgagg cgatctgaca gttggacttg acgaccacgt tgcgacggtt gtaggtgatc
    83341 atgggcaagg cggcgaagcg gccgtgggtc gcccgctgca tcacctggta ccgtttcaga
    83401 aagatttcgc gaaaggtcgt gtagatctgc acggtgtcct cgaaggacag caggctgatg
    83461 gacggaggtt tgacatattt ggcaaagaag gggtcctcgt acaggctggt ctgcgccagc
    83521 aggtccgagt cggaaacctc ttcggccata caggggatgt cgtaggtgtc ctcgtctatg
    83581 cccagaatca aggcattgtc gttgtccccc tcgtaccccg tgaccggcac gcgcgtgatt
    83641 cccgacccag accccgacac cactaccgtc gacgccgccg ccgccacctc ctcaccatcc
    83701 acgtccacac ccaccacacc tttattattg tcatccacac agagggaagc tatgtggggc
    83761 aagtcgattc gggccaactc acgcagggag tcctcgtcgg tatacggcga ggagtaaaac
    83821 aggtacatgg ccgagaagag cagaccggag accagcgagt acgcgtaccc ggcctgctcg
    83881 cagggagtcc tttcgatgaa ggtgtccttc tgcaaaatct ccacaaactg ctcgaacgtg
    83941 ccgtggtacc ccaccacgca cgccctgacc ttagagttta cccccaccga actgccctgg
    84001 atgtatgtga ttcgcagtgt taataaagtt tccgatgctt catcggtcat gtcttccccg
    84061 tacaacggct ctttgagtat ttcgttggac aggttgtggt cgacaaattg cgagtaatta
    84121 atgatccgcg tcaggttctg gcggaaccag atgtccaccg gctgcggcga gccgctgagc
    84181 gggtcgctga ggtcgcacag ctcctgatac gccctgttgt taaccacgca gtacacgggc
    84241 agatcgaaca ggcggtgcct ctcgctctgc cggatctgct cgtgcagcct tttgaaatac
    84301 gcctgcacct cgacgtgcga gagaaacagg cgggtcatat cggaggcgta ggacgggttt
    84361 cggatggaac tcggaggttt cacgaagcga tccacgtagg tgatgtgctc ctcggtcaga
    84421 ggaatgccaa actccatgta cttgagcaga tcgctaaagt ccaggtccgt gcagcgcttg
    84481 ttattgataa acatgaccca gttgtccgct atgtcacagt actccatgag cacctggttc
    84541 tggatgaggg ccgagagcac gtcgatcccc ttgcgaatgt tcttattctg cgtggtgtga
    84601 tcgtagcggc tctcgagcgc ctccgtctgc gtgggcgagc ccacacagat gatgcagggc
    84661 acgcgccgct cgcggtaaag ccgcgtgtcg cacacggcgt tatagaagta gtagaaaaac
    84721 actaccacct gcagcatgtg cttgagcagc aggccgcact cgtcaatcac gatgatgttg
    84781 ctctcgcaca tctcggaaac gtcctccagg gacgccttgc gctccaacat atttaagtgt
    84841 ttttccacaa tgtcggcgat cacgggccag taggccagga gatcgttgac ttgcacgcgc
    84901 tggatggtgg tctcgtcccg cggctcgcat atccggtact gcttcagggt gtcgttcccg
    84961 ccctcggcca gcggcacgtg cttgctgttg aagccgaaca cgcggtagat cgtcttgact
    85021 tgcgccgagc gcgtgcggtt gaggatcgcg ctgaggttct gcgcggcgat caccgtggtg
    85081 ccggtgatga cacaattgag attggcggcc agcacctgaa tgctggacgt cttgccggcg
    85141 ccggccgtgc cagtcaccag cagcacccga aaggggaaga agggccactg atccgtgcag
    85201 ggcacgcgca cgtcctggtc cgcgcagcgc tccacgcgac ttatggattt gaaccactgg
    85261 tacgagaagt cctccggctc gaagcgcacg ttggacaagg acttgacctt gtcgacgatc
    85321 cgctcgatct tggcggcgga cgacaggttg aggatcaagg cgtcctcgta cttgaccggc
    85381 cgcgacgacg acacggtcat cgacatcttc cccaccaccc agaccctagg ttacatccgc
    85441 ctgctgcacg gcttcaccgg cacgtgccgc ggcaagagca tccaccaagt cctgcgggac
    85501 ccctgcgtgc tgcgcaaaca actgctctac gggctgtgca agaccatttt cgacaccatt
    85561 accattaaac aggtctccga cgaatggaag atccactcgg ccctcttccc ctacagagcc
    85621 ctggacgacg aggacctgga aaactatctg gcggtgtgga gcgcctcggt gcgccagagc
    85681 gtgcagacgg gagtgctcgg ggcgctgcgt gacattttat accagttcgc cgataacgac
    85741 gagtatggcc tctacgtgga ctggtgcgtc accgtcggca tcatccctct gatggacgtc
    85801 aagtccaagc ccgcggacct cgcgcagcgc gcggccttcg tgcgcgccgc catccacaaa
    85861 tccacggagg ctcatccgct ggcccaagac ttgctcaacg ccaatcttcc gctgctgcat
    85921 caggtggtca cgcacctgtg cgcggtgcgc atcgtcaact cgcccgagct gcgcatcttc
    85981 aagagaatca agtcggagaa gatcgaggcg cagctgaagg agcgcgccac cggaagctac
    86041 gtggtgaccg agcccctggc ctacgagcgc gaccggctgt ttttcaccac ccccatcgcc
    86101 cacctgcacg aagagatcct gcgctacgac agcctgtgcc gccaccagaa gatctgccag
    86161 ctgctcaaca cgtaccccgt caaggccgtc accaccagcc gccacgagat gaactgcaag
    86221 aagatcgtgg agatgatgga caagcacgac cgcggcagcg acgccaaaaa ggccatcatg
    86281 aaattcctcc tgaacgtgtc cgacagcaaa tcgcgcatcg gcatcgagga cagcgtggag
    86341 tccttcctgc aggacctcac cccctcgctg gtggaccaga gtcgcctgat gccctcccgc
    86401 gcatccggcg gcacaccgtc cgcgcccgga ggaatttcgg cggccggcgc cgcgccagac
    86461 cgtgatattc gtgatctgtt taagaagcag atgataaaat gcctggaaga acagatccaa
    86521 gcccaggtgg acgagatcca agacctgaaa agcctcaacc agacgtggga aagccgggtc
    86581 cgcgagttgc gcgacctgct gacccggtac gcgcgccaac gctcggggcg ccccttcgaa
    86641 cgcgacccca agctgtacca cctgtcagtc accgaagcga ttcgcaaagc gcaggaggtg
    86701 tccttcacgc ccctggcggt ggaagataac cgcgtggtgg ccaacagctt cttctcgcag
    86761 ttcatcccca acacggagaa gctcgaaacc ctgctgaccg agctgtggga gaacgaatac
    86821 ttccgcactt tccgaatgaa acgcatcgtc accgcacagg gcgccgagga agccatcgtg
    86881 tactccaact acaccgtgga acgcgtcacc ctgccctact tgtttagcgt tctctccctg
    86941 tccaccctcg aacccattcc cgaagactat ctgaacctgt ctttcgggga aatcgttgcc
    87001 gccgcgtatg acgacagcaa gtttcgacag tacgtcgaac tcatctgcaa ccgcgaaaag
    87061 gcaagacgcc gacagatgac tagccagcca gtcgcgcacc ggcctccaaa cgctgaacgt
    87121 ccaaatccac atcccgacgc ggcgggaggt ccgctgcgat tccgtcatgg acatcctcat
    87181 gatccgcggg gtgctggaag tccatactga cgccaccggc agcaacgcga ttatcacgtt
    87241 cccggaggtc gtggacctgt ccgtcaaggg ggaccggcta tgggtgcaca ccgaccacgg
    87301 catgctgtgc tcgatcgcgg aataccgcag tgagttgcaa ctgaaaccct cgtttctggg
    87361 ctactccaca gtgtttcttt tggagaacga ggacctcatg tcccacgtca aactgtcgtc
    87421 catgcgactg aaacatcgtt gcggcatcgt gatgcccaac aacctcatgc actttacgct
    87481 ctgcaccata ctctcttgtg tggaaaacct caccctcacc cgcaagtgcc taggcgacct
    87541 gctggaatac ctgaaaagga ccaacgttcg cgactcgttt ggccggttac tgcgcagtag
    87601 ttgtaaaaaa ctcatctgca ccaccctcta tctgtttttc gacgacagaa caccagagat
    87661 cgtggagttg gttcccagtg cctttatttt attccaggag agccgacaca gcttccttca
    87721 gactatcatg cggttttggt tccgcatcac acaccaggag gacatgtaca aattttccat
    87781 gcgactcatt gaacgcaaaa ctctttatgg gaccttggtc gagacggcta tagtacaggt
    87841 actcaactcg aacttcccca gcctgccttt cagacccact tcgctttaaa tgcgctagca
    87901 gcgcttagca gccacctgtc aatcaaatca tcgtcaagca ttgaggcgga aaaaacgcaa
    87961 cccgtctgcg gcgacgcgtt ctgccgcctg gcgcgcctcc ccacccagcg ccttggtcca
    88021 atcctcgcga tcgtccgtcg tcgttgtcgc cgtcgtagtg gctgagcccg gccaggccga
    88081 ggacgaagag gacgagcaag aagagcccgt cgaacaaggc ggcaccgcgg gcgaggcctc
    88141 cgaacacata gcctcgacgc acgcggtcac catagcgaac gctctcttga ggtacacgcc
    88201 gtagccgact tctgcggaca gcgccgagtc tcgagactgc acgataatct ggccctgttc
    88261 ggaccacact ccgtaaaagg gagcgcagtc gatgactccg gcgtgagggc gcacctcgtg
    88321 ttccccgggc tggcactgca gtaaccagaa ctccacgtcg ttgcggcgag acacgaagcg
    88381 gaagagcact tcgcggtaca cggcctcgag atcggcagcg gtcggccgct cacgcagcag
    88441 agcgggcacg cgtccaagca ccttacccac cacacaccac cagtcgtcat cccccgaaga
    88501 cccgaaagga ctgaccacgc gctcgccacc ccacaccagc atgattccgg gagcgctggc
    88561 ctgcaagcgg caagtgggac ctggcgcgtc gccaaacagc ttgcgccagt agcactccat
    88621 gacagttcgt acgcacgcct ctgccgagac cggcccgtgg ggcagattgc cgtcatagac
    88681 gtagaactcg cagtggcccc gcgacagaat ccacgacaag cccgcggacg cgcaggcgga
    88741 ggtcacatgc tccgagatgt aacccagcag actctgaatc tgcctaaagg cacaacccga
    88801 gcgataccgc agattctcaa taaactgttt acacacagtc ttggcgtgga gtctgttact
    88861 gaatcgcagg tgggggttaa agtctcgggt tcgaatacac ttgctcaaca cacactccac
    88921 caggtccacg atcaccaggt ggtgcagggt agagtctctg gcgtgcacgt gggccgtgag
    88981 ctcatcttcg tcccccgcgc gcatccacaa ctgggtacac agcgagtcgc tggcttcgcg
    89041 aaacgcggtc ccgttgagtc gcatgggcag ggtgagttcc ccgccaaata tccgccactc
    89101 atcgtcgggc actccgagcg agagcgcgct cggctggact tccaacttgc ccgcagcccc
    89161 cacaatgttt ggcagtccac accacgacat gatctccccg gcggcatcga tggcggtctc
    89221 ccgcaacaac acggccaggc tattgacaga gtagacgggg acgggaggga agccgggaaa
    89281 aaagaaggat cgcgttcccc cggcctcgaa aagatcgggg cccaggtagt cgcgcagggg
    89341 cgcctgtccc gcaaagcccc gaaacaagag ctcgtacagt cgcgtccagg cggatttcag
    89401 taacagacag cactgctcgt cggtgacggc caccgccacg aatccgacgg gggtcaccag
    89461 ccgcaaacag gtgcggagga aggagacctc ccggatttca aacaggcgcg agaccacggc
    89521 ctcgtcgtcg cgctcgagca catacttgtg ggaccccacc ctgaacgaca tagcgacgtc
    89581 gaaagcgtag tatcccctgc gcatcttttt gttggcgtgc gtcccgtatt cctcgctcac
    89641 ccgctcctcg cccaccggga cggcacgggg ttcgggcagt tcagggtagg agcctatgac
    89701 caccagcttg gccacgtgaa agaggctgag tgcgttcgac agggcggcgg agtccacgtc
    89761 cagcgcgggc accgcctcca caatctcgag accgttgtga tcggtgcgga tctgcacggg
    89821 gctgaacgga tgcgccagca cccggatgac cgcgctgccc tccagcagca cgcgcgccaa
    89881 gaccgcgctg cggcggtcca gactctgctg gcgctcgtcg ccgtcggtgg tggcggccag
    89941 attcgcgtag ccccctcgat gaacagctcg cagatccgcg ggcggcaagg gatcggctct
    90001 gacgataaag gtttggagtc gtggctcgct ctggccacgg gccagatgta taaataagca
    90061 ctgcaccacg ggcacggcgg actcgaggat cccgtaccag ctgagatgac agctagcacc
    90121 cacatgggtc gtgccggctg acatctcggg cggtgagcct ggcccgcgag tcccgaatcc
    90181 ggagcccgag agcgcgaacg ccgtgcgccg ccgtccgcaa acggccacag gggttttgcg
    90241 ttcgcggacc tcgtggtgcg aaaagccccg cagaacacca cgcaccatag tatttaacga
    90301 ctcatcggtt ttttcgtcat cagcgcgcac cccgcctggc accgcctcga cgtccaccgc
    90361 ggcggtacca tggcgccctc caaggtggac tcggtgaaca gccgcatctg gggcatctcc
    90421 gtgttcctgg cgttcctgac cttcgccaac atctgcggac acacgacgat gatgaacgtt
    90481 cccggagtgg ggtacccgtg ttcgtactac aacgtcgtgg atcacacgga gaccaacctg
    90541 tctctgtaca atgtgatgca cctcttcacg cccatgctgt acatggacgc cgtccagacc
    90601 attctgtacg tgatttttag catgctcgtg tttctgtgtg tgatcatcta ctatgtgtgt
    90661 tgctggctga aaatcacgta ccgcaaagag gagggattga gcctcaacca gcggacgcga
    90721 gacatcgcgt acatgggaga cagcatgtca atcttcgtct tcatcttggt gatggacacc
    90781 tacgaattga tgaccttggc catgaccttc cgcctcccga gcgtgatcgc cttcatgacc
    90841 tgcgtgcatt ttttctgtct gacgatcttc aacatcaaca tggtcacaaa ctaccagagc
    90901 tacaggaaca gtctgtttca gctgcagcga attcacccga tgctacaagg caccgtgcag
    90961 tatcgcacca taatcgtgaa cctggttcaa atgctgctag gttttaacac ggcggtcatc
    91021 gccatgtccc tgtgcctggg cttcggtaac aatttctttg tccagaccgg acacatggtc
    91081 atagccgtgt tctttgtgta cgcgttcatc gttatcattt actttctcat gttggaggtg
    91141 gtgttttggc gctacgtcaa agtacagttt gggtatcacg ccgggacctt ctttggtctg
    91201 tgcggcatga tctaccctat tatcaagtac gacctcgcgt acacaccaga ctacacctcg
    91261 caggtggcta ccgcttttgc tttgtgcttc atcatatggg ccggctttac agcctgtcgt
    91321 tgcatccgct acttccgcgc ccgccacacc atcaaataca agagtctgac tacctcggag
    91381 gagatttcat ctctgaaaga cggtttagtg acctcggacg cagacgacac ggacgagatg
    91441 gcctaaggcc aacagcacat catgtatgct atggacaaac gaacgcgcgc acacacgtct
    91501 gtacaattgt aacatatttt tattattaaa cacacatgag atacaaatga aacgagttgt
    91561 aaagtcctaa tctttgtttt gtacatatta ttttcagagg atggtggtgg aacacggccg
    91621 cttaatacac actaaagttg gtggaaggta tacgacgggg cgctcgggga tgcttggggg
    91681 tcgggggacg tgccgccagt tttgatgatg aggaggagga tgcattggac ggtttcggac
    91741 gaagagtttt tgtggccctg gcaggggaat ggtaaccgtc ctcatcctgc atgagagcta
    91801 atgtcagctg cctttccttg tagtcttttt tctttttttc ttcttgggtt tgggctcggc
    91861 cacgacgaca ggatcctgag ccgtcagcga catttcagac gtcacactaa ggagatccag
    91921 gttgtcatcc tcttccgacg acgtgttgtc cagatcagca aaagatctaa gacacaccgg
    91981 tctgcccatg gtgtccctta agggctgacg ggtcggggaa ccgaagaaac aacatattcg
    92041 tttgcagcat tgggcaccca taccggcaga ttggtctttc gggacagatt acggctccag
    92101 cgatctacaa cagtacaaac cacatgcttc gtgaaattgg ggtcgaaaac cacaggggtg
    92161 acgatgagca gcagaggaat gtgatcgcag tgaaaaaccc gaccgcccag atgcagcggc
    92221 cgccccactt cgccctcgtc gcgctcgcga aagatggccg agaccaggtg cgcgctaggc
    92281 agatctcgaa aatcgatgcg ctctggatcc ggatgattct ttatatagta ttggctcagt
    92341 acatactgct gaatcaaaag ctgaaagtag tattggtggc gcggattaac gaaagcgggc
    92401 agcgcaaagc gcgccacctc atagatggtg agcttcccca gcagatctgg ggtgttttcg
    92461 tcgtgcaggc tcgactgcga gtcgctgccc gtttccacgg cgtcgtccgc caccgggccc
    92521 gtaggggaaa gcgaagcgtt aatagtgtca tccacatttt tggcgtcgaa aacgatgact
    92581 tccgagcgtt cggttttatt caggtagagc aaatcgtgga tgtagtcgcg caaagcgtcc
    92641 ggaggcttga tcggacggcc gcgtttcagt gtcgccttga acagggggtc gtgggacaag
    92701 aggaactctc gagccgacgg gacctcggcg tcgtggcgaa actccacacc gggcacgggg
    92761 tgggagagca gcagcttggc cacggacgcc gcgtccgcgc gctggagcac gctctgcacg
    92821 aaggggtccg ttttgctgcg gaggtacttg taccgacact tgatttcata cacactggcg
    92881 cagggggaga tgcgcaggct tgagcgcgcg tccccgctgc tggacttgcg gactccaaag
    92941 cacaggtcga tcgaggcgcc gatgaggcca gaggtaggat cgatgaggag tcccagtccg
    93001 tctcgtaccg gctctcgccc gtgcgtcaca tgaaactcga ccatggtttt caccacaccc
    93061 tcgtgccgca ggccaaactg gatgccgggc gaggctccgg ccctggaggg ctggtgcacg
    93121 gggctgggcg gaaagccaga caaaaaagcc tcgtaaatct tggtggccga caccgagtcc
    93181 aagcgcagca cgtgccaaac gacgttgcgg gactggccgc gcgactcctt ctccagcagt
    93241 tggtacagtt ccaactgacg gtagttagga gccaggtcga gcagcttgct gagccacacg
    93301 tagtcttcgg acacgtcaat catctcatca ccatcgtctc gatccctgtc ctggcaccgg
    93361 accagacggt ccagcgccgt ctggatctct tcgcgcgaat ccgcgtaccg attgccgaga
    93421 atgtcgcgaa gcagctcgtc tcgagccaga gcggccaccg cggacacaaa ctcctcggcc
    93481 accgccaccc cgtgggtgcg acccgctctg gtgaacaagc gataagcata ggccagacgc
    93541 agaatagagt agggcagatt gcgaaacccc tcctgcctga gcagaaacgt gttcatgata
    93601 aacaagctga ggggctcatc gtcccgcaaa gctagcaagc gcgctaggtc ctcgttcgca
    93661 tcccccgtct cgtcccacat gcctgctgct gcggcgagcg gaccgccgtc gcgtggcgtc
    93721 cctcgacggt ggtcctctct ccaggggctc agtccgcgaa aacctgccga caatcaccgt
    93781 ccaggtcctc ctcggcacta atgttcgcgg tgcgccgaaa cgaagtgtat aaatacacac
    93841 cgtccggcac ggccagcagc cgctccagat tctttctgac gtaatcgtgt ggcaggtggc
    93901 caagacattc gtggtagtag cgtcgaaagg cgcgcacccg gcaggaggac agcttgttct
    93961 ccacgaaatt caccgtcctg ttcacgatgg gcaggccctc gtcccccagg aggccggcgt
    94021 ggtaggccag ctgcgcggcc atgataagca tacacgcgtc cgagcaggcc gtcaggcggt
    94081 tgctctccag cgcgcggcac gcggtggagg cgtgcttgaa cagcatcgcc tcgggaccgc
    94141 cctggacctc tcggatgccc cggcggtcca gcagtcgtac caagcagaac cccagcacat
    94201 tgcccagggc ggccagctcg gccatgcaga aacgccgtag caggctgctg tcggggaaac
    94261 gggcgtgggg attggaaatc atgagtttct gcagcggcag gggccggaaa gcggggtggt
    94321 agcactcgcg aacgcggtgc gtacagttgg ggatgcgacg agccgtaccg gtttcctgaa
    94381 acaccaccac acagcggtcg ttgcacacgg ggtagggttc gctgagactg tagtcgcaga
    94441 gaacagcgtg cagaatctcg ctggggtagt gagggttgac gttgacgagc acattcatgg
    94501 gggagatgtc aaaatgacac actttgcagg tgtggttgag gaacttaatc ccttcggcca
    94561 ggtgatggaa agcgcgtcgg tagctagcta tggacgtcat gtcccagtcc tcgtagtgga
    94621 acaggtcagt gtgaaagcgc gtgtacagcg tgatgttgtg catgagacag caacccgtgg
    94681 ccgtcatgag tccgtgatac acaccgtcgg cctcctcggc ccgcggtccc gccctcgtgc
    94741 ggatcaggcc cgacatgtag gcgctgagga tagtctcgct gtgttttctg gcaatcttca
    94801 cgacgtgatg ccggctcaga ggccacactt ccccgaacga accgcacccg atgcgtttgt
    94861 gggaatcgct catatccacg gcgtagcaga cccgctggca gaactgttca tccttgggca
    94921 cgtacaccaa aaggtaggtg acggccatct cacagagctc gggttgcgta attcgcgcaa
    94981 agaacgaggc atcgcagacc agaccccgga tagaggtcgt aatgacctga tcgttggaac
    95041 acgtgcaatg cacggcctcg tgatcatcat cagcagccac cgacgcctca gaagtctgac
    95101 tggaggccgg gtagttatcg tactcctcgt gctgctgagg agtagtcacg ccatcgtgac
    95161 tggcgtggga ccgcaagggc gcccgagtct gcactccttc ccctcctctt cctcctgctc
    95221 ctcccaagag gtcagccgtc tcgtactcga aagaccagtg tgacgcatct tcgcgacact
    95281 gcagctgctg ttcgttacag ttgacgagcg tatccacgct cgatttccgc gaacccgctc
    95341 taccccgaga cgtcagaggc gtcggaggag aaggcggact ggccaccacc gccgccgccg
    95401 ccttttgaga ctgggcagaa gcggcagaag tagagacggc agcgtcttgc gtagcagagg
    95461 tagaggagga agaacacacg agagcggcct ggttctctag cgtcgtggtc gcggccacag
    95521 cctgccgcat ccaggctcgc ctgtgagacg ccctggaacg tcgcaaaggc gcgggctgcc
    95581 acgggcgacc cgactcggcg gacacagaac gaggacgaga cttgactttg gatcgagttg
    95641 ccatggtggt gacaacttgg tttttattga cacaaaagtt cagtcctctt cccccaccaa
    95701 atccacctca caggtattgg acacggagtc gacaaaggtc tcgcacacgt cctccaccgt
    95761 gtccttcagt tccattaaag agtccagaag ctcgtctgcg tccgtggcct tctgcagggc
    95821 gcgagcgcgc tggagctcct tcttaaggct ttcccgttcc cgcaccacgt tggcagccac
    95881 ctgtgtcacc gccacctggc tgtatctggt ttgctcgcga gccgccgttt gcatcacctt
    95941 cagatggtgg tgtttggtga ctcgatgctg aggtccataa gcgcgtcgca aaaacagatt
    96001 ctgcttcttc tcgagctcca ggcgcattac cgccttcaac aggtccttgt tggccgacgt
    96061 catagattaa gagacacgat gcccgcttcg gtctcggtga gcgcgtccag cagcttccct
    96121 acgtgataca caggaaagag ggtgaccgcg gtctggccgg gcaatatatg gctgagcgtg
    96181 acgtcagtca cagccgcggc gcaatcctgg atgacgatgg ggctgtagtg caccgtccgc
    96241 gcctcgtcgc gagcgaggtc cagacacaag cggttctgac tgtagagcgc gcacaggagg
    96301 caggtcctcg acgacgcggg ccacgtcggg acctcgcgcc ccgagaagcg cccgcggacg
    96361 gctttcagga cctcctgcag gcgatcgagc gacacggcct ttaaaggcaa gcgcagctcg
    96421 tcgtcaccgg ccccagcggg cgaatctgaa gccgagggaa agtcatagcc gcgataccac
    96481 acgtacacgt acagttccgc cagattcata tacgtcatat aatcgcgaac gggttcgtaa
    96541 aagatcttgg gcagcagagc ggggaacggg cacccgtgct tctcccgccc gaaacacgtg
    96601 tcccgcgagc agaagctgcg gggtccgcag tacagcaggt agagcagccc ctccagatca
    96661 cacacgttgt ggtgatccaa caggccaggt gtgtacgcct gccgcaacac ggcctccacg
    96721 tactgcgcct tgttgctaga cagggagagc tccacgtggc ttttgcggta catcaggtag
    96781 ctcccgtaca ccaagtcccc ctcgtaggtg aggcgatccg cattgtgcaa cgcgtaatca
    96841 cgaaccccga gcgcaggtag gggcgtcgcg gacgtgcagg cgaagcgatc caacacgtcc
    96901 tgagaccgtg agggaaagcc gcgctccgcc gcctccgcgc cgatcgccgg catctcggcg
    96961 ggctccctgg gaaccacgtt ggtcaccagc aagaaattct cgttgggggt ctcgattaag
    97021 cgaaagcggt cgtagggaga cacggcttcg caggcgatca gagccatatt tacggcttcg
    97081 tcaaaacgca acgtttcctg cacctcgaaa tcggacggcg gagtctgcgt ggagagctca
    97141 accattcgct ccaccgcaca cagcgacgtg gaaatcgagg agcacgaagc cgccgccgtt
    97201 gccgcggtcg ggcgcggctg ctgttgctgt cgtggctgcc gtcgcggctg ccggtgacag
    97261 cctccctctt cttcgtcgtc ctcctcctcc actgacaacg gcatttccga gggaggagga
    97321 ggaggaggtg gagaggagga atcgttggga gaggagaaag aggaattggt ggctgtcgcc
    97381 atgctgcgcg gggaatccgc ctcgcggatc cagcagcgct acgaagagtt gcaaaaacgc
    97441 aaaaacaacc ccagctcctg catctctacc tccttcacta acgtggccgc cctatgccgc
    97501 aagcgctacc agatgatgca ccccgagttg gggctggcgc actgctgcaa cgaggcgttt
    97561 ctacccctga tgacgttctg cggccgctac cgcgactatc actctgacga agacagacag
    97621 acgctcgtgt ttcacgagaa cctcaagacg gccctggatg acctgaactt tctgccgtgc
    97681 cccgaggagc agaggcagtc ctaccagaag ctggacgccc tgactgaact gtatcgggac
    97741 cctcagttcg tccagatcaa caactttatg acagacttca aaaagtggct ggacggtggc
    97801 ttcaccaccg cggagggcga cgccaaaccc attcgactcg aaccgtttca aaagaattta
    97861 ttgattcacg ttatcttttt tatagcagtg accaagatcc cggtgctggc caatcgcgtg
    97921 ctccagtatc tggtccacgc cttcgagatt gacttcctgt cgcaaacttc cgtggaagtg
    97981 ttcaagcaga aggccacggt gtttctggtg cctcggcgcc acggcaaaac ctggttcatc
    98041 atccccatca tctgctttct gctcaagaac atgattggca tcagcatcgg ctacgtggcg
    98101 caccagaaac acgtgtccca gttcgtgctg aaggaggtgg aattccgatg tcggcacacg
    98161 ttcgccaagg attacgtggt ggagaacaag gatttcgtga tcagcatcga ccacaaggga
    98221 gccaagagca cagcgctgtt cgccagctgc tacaatacca acgtgagtat ggagatgtgt
    98281 gttcacccat ccatcatccc gttcttcatt tttgacaggt ggccattttc aatgcactag
    98341 atttttcagc accggacagg cgcacactat catccgagcg atcggatctt ccagtttcac
    98401 cagttgccaa gcgttggcat tcaacggcac ccagtcccca tccgcattct tggcgcctat
    98461 gtgataatcc aggccttccg ccaaagttat tttcccttta ctcttggaac ccacagagca
    98521 caggtaagta gccctctcca catcgcaaaa gaaggccacg ggattctcgt tcgtgatagg
    98581 attcatggat ggagagttgc acaaggtata acacagacag ttaccccgat ccggaataca
    98641 tcccacgtaa catccagtag gatcgatatg ccctccgtga tccttacagt agttgcaccc
    98701 catctgtcca caagcggtgg ccagagccat cagcctcgcc atggaaggca actcttcgtt
    98761 gttgccacac acggtgaata aatcataaca cagcaggtaa aagtacaagg cgtagccgcc
    98821 gcttctgttc accagccaag ccccggcgcc gcccagactg atggctttct ccactccggg
    98881 ctcgtacgat ccggtacagc ctttcactcg aattctctca gcttcttccg gaggcaccag
    98941 ggtacacacg tcgtaaatca gctgcggagt gatagagcag cgaggcacca cgctcatcat
    99001 aggcgaaaat cctggaacaa agtctatgcg ggccggacct aaaggcccca agaataacaa
    99061 cttgtacgtg gccggcagtc ccacgatctc ttgtcgcatt ctttgcactc gaggacacga
    99121 gtacacaccc atgaagtggc cattgcacgc aaaacagatg atgttctcac cgcctcgctt
    99181 gaacagatac agttgacacg ccatgcacgc attgtccccc tccacagaga aaatggccga
    99241 tctacaggct atacactgaa actcccggaa ctttaggcct cggcccacct ctctccagca
    99301 gcactctcct tgcaagaact ggcgcagaca tctggaatcg ttcgaagtga tccctcccga
    99361 cgccatcgag gcgcactcga gacgagactg tgaagcctcc gggcaaaacc cagtggaaga
    99421 ctagtcccgg ggtgacatac agcacataag tgtcaggctg cgtcacccac ttccttagct
    99481 gtccgtcacg gcctcgggtg atccacagat ggctgtgcgg acacgtctcc actcgtacct
    99541 ccacccccaa gtccacctcc gctcgcacgc agcgcaccac atcggcatac caagtctcgc
    99601 aggtattatt cgttttatcc accgcgacag agtctccgtg gacctgtttg ccggtgcgca
    99661 acctgtgagt cagcgcctta ataatgcagc tgttgacatc cgctcggtcc ctccaaatgt
    99721 ccagggcgca atcgaacagt tcccaaacta agagccagga ggtctcgata gacagatgac
    99781 aggaaaactt ctgaggtagc atacggtccg ttctgaccac cgccttgatt tcgcggtaca
    99841 cctcacgagc cagttcgtac tccacggcca cgctatcgaa gtaggcgtcc agagtcagac
    99901 gcaggtcctc ctcgcggtcc tcgtaccgga gtccgcgcga cctccaaaac gagtgcgcgt
    99961 accagaggac gtggaggcgc agacgctgct gcacatccca gacggagcgg agtcgcagca
   100021 agccgccttg ctgccactca tccgtcttgg agacgcggtc gtcgtcgtgc gggccagagg
   100081 cgtagatgac atcggggttc acttccagac gcggctgcac gatctcgtgc ccccgaatct
   100141 tcgaaggagg ctccagaggg cccgcgtggt acgtaaattc agagtcgccg cgcagaaagt
   100201 gcaccgcacg gcgctccgcc tcgctcgctt gcgcgtcctc cccctcgccg ctcctcgtgg
   100261 gcatctcgaa aaacggagtg gcggccgatt tggccttggc tatctccacc gccgagtcgg
   100321 tgatgagcga cgagacgttg ctctcggcgt tcgcctcctc cgcctccgaa acctctagct
   100381 ccccttgcaa caggtcgcga accagaaact cccagtcccg aaagcgccgc cgatccccat
   100441 ggccgcctcc gccgccgtgc tcgtcctccc acaccacacg cagatacaac atctgcgccc
   100501 ccgagatgcg ccgctccagg cagcggatcc ccagtgtcgt gaacaacgca tggtgtagtg
   100561 caaccctttg cccgataggg ggaaccgtca cccctgcctc tcgcaggtag gtgagcagct
   100621 cgaacggccg caggaacacg cgaaacgccg cccgtcgcca gttctccacg ggatccgggt
   100681 cgctgcggta atagacgtac cgcacggttt tggcctcctc gaacgacagg tcaacggggt
   100741 ccaaaaccac atgcagagga aactgcagct cctcgtcgaa ctcctgctca aacgccaggt
   100801 ccgaaaacag gtgcgtttcc atattcggaa cgcatctgct tcagcaacgc gtcctctcgc
   100861 tttttgcgac tcaccttgat gacgcacgaa tcgtacttag tttgtttcga atagatgccg
   100921 ataataagct gaataaacaa ttgactaata ataggcacag agatccggtt cacgttctgc
   100981 atggaacgga agactttatt gaaagtgaaa taaatgctat cctccacctg ctttttgagc
   101041 cggtcccgtt ccaccacctc ctgaatgaca tcggcgtatc gcgcggcatg gctcatgagg
   101101 tagcgataca cctcggtcaa cacggccccg atcacattga cgtcgtccag cgacgtctcc
   101161 tcgatgggct ccagcgcgtg ctcccgcgcc atggggtaca gggcctcgta caccagcccc
   101221 gtcttgacac acaccgagcc ctcgagcgtg gatatgaggg cgcagctgct gccgagatcg
   101281 cacagatgag tccggaaaca acgtgtgcac acgtacagcg agtggagctg aatctcctcg
   101341 gtgaacacgt tctgcacgtg ccgcatgtca caagcccccg agacgtcaca actgtccggc
   101401 acggccgacg tggtgccgag cgtcccgctc tttggcggcc ggccccgcgc cagtcttggg
   101461 tgctgcggcg gttgcggctg cggctgtggc tgtggtggtt gctggtgatg gtgactgctc
   101521 atcgccgctg ccgccgctgc tgctacacgc gtccaaaatg tcattcacgc actccactgt
   101581 gaggtgttcg aagagagaag aaaccaaatc tatcttccgg gggccagatt cctcggtctg
   101641 aaagagaaac ccaaagttgt gaaacacgtt ctcggcgaaa gtaaacacat cctcggtcgt
   101701 caggtgcgcg acgcccagtc gattcagttc tgccaacaat gcattcatgg ccgtcttctc
   101761 gcgcgagacg gaaggaacct gaccttttat gttgccacct gacacccatg ggcgtccgcg
   101821 taacacacca ccgacacacc cacactaatc cccgcctttc tgttttctct ccgcagagca
   101881 ttcgcgggca aaacttccac ctcctgctag tggacgaggc gcatttcatc aaaaaggagg
   101941 ctttcaacac catcctgggc tttctggcgc agaacaccac caagatcatc ttcatctcct
   102001 ccaccaacac caccagcgac gccacctgct tcctcacgcg cctcaacaat gcgccctttg
   102061 acatgcttaa cgtggtatcc tatgtgtgcg aggagcacct gcacagcttc acggagaagg
   102121 gcgacgccac cgcctgccct tgctaccgcc tgcacaagcc caccttcatc agcctcaact
   102181 cgcaggtcag aaagaccgcc aacatgttca tgccgggctc gttcatggac gagatcatcg
   102241 gcggcaccaa caagatcagc gaaagcaacg tcctgatcac ggaccagagc cgcgacgagt
   102301 ttgacatcct acgttacagc accctgaacg tgaacgcgca ggagcacttt ggcaaaacaa
   102361 tctacgtgta cctcgacccg gccttcacca cgaatcggaa agcctccggc acgggcatcg
   102421 ccgccgtggg gctgtaccgt caccaattca tcatctacgg cctggaacac tactttctac
   102481 gtgacctgtc cgaaagctcc gagacggcca tcgcggaatg cgccgcgcac atgctgacct
   102541 cggtcatcaa cctacacccc tacatcagcg agctgcgcat agcggtggaa ggcaactcca
   102601 accaggccgc cgcggtgcgc atcgcttgcc tcatccgaca gaacgtgcag tgcaacagcc
   102661 tggtccccgt gctgttctac cacaccccgg atcagaacaa catcgagcaa cccttctacc
   102721 tcatgggacg cgacaagcgc ctggccgtgg aacagttcat ctcccgtttc aactcgggct
   102781 acattaaagc ctcgcaggag atcgtctcct acactatcaa gttaaaccac gatcccatcg
   102841 aataccttct ggatcagatc cagaatctgc accgaatcac gctggcagaa ggcaacacca
   102901 cctacagcgc caaaaaacaa caccgatact ccgacgatct ggtggtggcc gtcatcatgg
   102961 ctacgtacct gtcagacgac ctgtacaccg ccaagtttaa gatcagctag gtccgcagaa
   103021 tggcaatcaa ctgctttcga gtcacgttgg cgtccagcgg aatgtgaacc cccaggcgcg
   103081 tgagactgga gaacggagaa aacgaatctc cgtagtactc caaaaacttg caggccgcgg
   103141 ccaccacgcg cgactgcact cccgcatgat gtcggtagta acgccgcaga gcgatggtca
   103201 cgaggtcaca ctcgtctacc cgctggttca cctccggcag acgttcctga tgcttgtgca
   103261 aacaatttaa aatgaacgcc acgcaggccg ccaccttcat ggctttgcga tgtaagagga
   103321 atttcgagtc cgcatcgctc accttaccgc acaacatgcc caacagttcc tctccgacct
   103381 catcttcatc cagctcgtac aaacacacct gacataaaaa aaagttttcc agccgcggca
   103441 agtccagtag taagagtttt ttggaagcgg ccagattcac acagtgatcc aacagacgac
   103501 gtccacctcg tggaagattg ttcgtcgaca gtcggtcgta ggcagcgcct acacgctgat
   103561 caaacacctt cacgtcacca cgagacaggt tcaacagagg aaacaggcgt tcttccactt
   103621 cgaccggaca aggacataag tcgtcattcg gtctctggtc catccaaaac atagaatctc
   103681 gaaaataatt aacaaaggac cgagccacag tcaagcggcg ctgcactaca cgaatctcga
   103741 cctcgtccaa ccagtgcaca ccggttcccg gccaaaccac atttcgagac gtgacagttc
   103801 catccgatgg tcggataaca tagataccgg gatggtcata gaacttttca tcgcccttgg
   103861 gtccccctac ctggccgcat tcgatcacaa ttttagtaca atgggtaatc ccggtcagag
   103921 cataaatgag ctggctgtga ttttgccaat aaatggaaaa gatggaacac actcgattaa
   103981 aacggccgct ggcatagaag gccagctccg aagcgaatac acagccttcc tcggcatcgg
   104041 gtggtgacgg gatcgtgcgg cgaaccatgt cggccacgtc ggggtgccgg atcatgtgtt
   104101 cgcgcaccag tccgttgggc agaaccagag ccgcatcccg ccagccgggt cctggcaact
   104161 catccgcagc gcgaccgtcg ccgttcgcgg aaggagtact catatcgaca cggaggagga
   104221 ggacgccgcc gccgctgtcg ccgacaacga gccgcagagg cgcaggagtg tgtggcgaat
   104281 gacgtttcgg gtgtgagccg tctcactcaa cgcctggaga gtggacaaga cgtctaccag
   104341 cactttcaga cgcgcgcgag agattttgtt gacctccaag tgacgacaga ccgtcaagac
   104401 gttggcgttg cgcccgagat ggtccaactt aatcttcttg ttgcgcgcca aaattttcgg
   104461 aacgttgttg gccagacggc ttccgattaa agcgcaagtg tgtttgatct tggtgtgcgc
   104521 cgtgatgttt ttactgtaat cgaacacgcc ccgttgcacc gcctcaaata ctaatcgatc
   104581 caagtagagc cgtttatccg gcccgtggag cttgagcagg caggcgcgaa taaacagaat
   104641 caactgcttg gacagaaaag gaatctgata ggagtttcgc aactccatct tggtaaacac
   104701 gcggtgtagc ccgtaatcga tacacacgtc cctcatgctt ttaatgcacg acagctcttg
   104761 gagcagtatg ttttcgagat ccgagcccga gacccgaggc acgatagccg tggcggcctt
   104821 gaaccagccc acgttgacat tattagtgtg ggaaatcata cacgggaagt tagtggtcca
   104881 atacacttta ctgcgctccg accggatgac cgtctggtcc tccagtccgt gcacgtccag
   104941 cgacgaattg ctgttacaca ccacggcagg gagaaaaaag tgatcgatgt tgacatgcag
   105001 gcgatacaca cccaacgagt agagaaactc agggtacgag cctcgtatgt tcacgttcag
   105061 cgagtttgtg tacacggcat cgttcgacac gaacgtgctg acggtacacg cgggttcttt
   105121 gaacgtgtgc ttgtacatga caaaactgtg agtcatgttc ttgggaagcc gattgacgcg
   105181 gcagcccaca cgtcccgata gagccgcctt catattaatc acccgattcg tgttgaaagc
   105241 gttgaccgcc acgcgatcca ggctgacgcc cgtaatttcc gaaaactcca tccccccgat
   105301 gaatttccgg cgactggccg cgtaacgctg cgccgacagc tgtttctggc gatggtgctc
   105361 cagcgcggcc tgtcgcagag tgtggccggt gaaatcgaac gcgctctgct gcttctctcg
   105421 acgccacaac tgcccgtagc gaacaaacat gagtctcgag atgatacaca cgtaccgttt
   105481 gaggcggtcg ccggtcgaat ctcggcgatt cgcagcggcc gccacggaag ggggcacccg
   105541 agcggccacc agacacgcgc ccgaggccca acggggagga ggggtgatct ggggcggctg
   105601 acggctacga ctcatgggtt cgccgcggcc tatttcgtaa tacacgtaaa acatattcct
   105661 ccagacagtg tcattgtccc cgaaagtcag actgagacgt cgataacaca gcgtgttccg
   105721 cgccaccccg gctttgtact tgccgtagat gattgacagc ttaaagtaca acacttgccg
   105781 tttgaaacgg cccagggcaa aatggttgag atgacacacg gtctggtcgg gcactcgcag
   105841 ggccatcatg acgcgccccc gatccctgtg cagttcggtg aaaacgcggc caaaaaaatc
   105901 cgccgtcacc tcgttgtggt actccacggc gagccacatc ttctgcagtt ccagaagaaa
   105961 gaactcgcac gtggagctca gggccagcgg ggccagaggc ctgacgttca ccccaaacaa
   106021 caacttgtag tgaacctgca gacgaggtgt gacggcgtcc cccaagtaat tagtcatgag
   106081 gttgacatag tcgtccacct cactcacggt gagcacgcgc ccgatctcca ccatgaaata
   106141 agggtaatcg ctgatataca gcgtgagatg acgcggcagg caggccatac tgtaccgatc
   106201 ccgccgactc acggtgccgc acgggcaaaa catgtcgagc aggtgctggt tccactcggt
   106261 gagtgacagc agccctctga aaacatgcgt ggcgatgtgc ccttccatga cggtgaaagc
   106321 cagcgagcgt cccgcgttgg gacagtgaca gcgcctgtgc acatagagca gagggcccgc
   106381 gcaaaactgg ggcgactcca ccatatagtc attcgcctcc cattcgtcac agtagcaggg
   106441 cacggccacc ggccccagta gcaaacgtcc cagaatcagc ttgatgcggt cgctctcctc
   106501 ccgcatatgc ggggaggcgg atcggtagag cgcgccgaaa acagcgcgca cgcgctccgc
   106561 gtccacgggc cgcgtctggc agaagcgagc gtcctcgacc gacgacagct cctgagtgag
   106621 attgtacgaa ttcacgtgca cgggcacatt gactacctgg ggttccgcca ccgaatccac
   106681 tattagagcg tcttgagcgg cgcggcaccc aaagacggtc ggcgaggacg ccatcgccgc
   106741 acgccgtcgt catggagaac tggacggcgg tcgagttact cccgaaagtt ggaatcccag
   106801 ccgactttct cacccacgtc aaaaccagcg cgggggaaga gatgtttgac agcttgcgca
   106861 tctactacgg ggacgatccg gagcgctaca acatccactt cgaggccatc ttcggcacct
   106921 tctgcaaccg tctggaatgg gtttatttcc tccagacggc cctggccacg gccgcgcacg
   106981 ccatcaagtt cgacgacctg aacaaaatga ccacggggaa gatgctgttt cacatccagg
   107041 tgccgcgcgt ggccagcggc gccggcatgc ccacctcccg ccagaccacc atcatggtga
   107101 ccaaatacag tgaaaagagc cccatcacca tccccttcga actcagcgcc gcctgtctgc
   107161 tgcacctgcg cgaaaccttc gagaacacga tcctggacaa gattctcaac gtggaggcca
   107221 tgcataccgt aatgcgggcg ctgaaaaaca ccgccgacgc gatggagcga ggtctcatcc
   107281 actgcttcat ccaggtgcta ttgcgcaagg ccccgccgta ctttgtggtt cagacgctgg
   107341 tagagaacgc cacgctgtgc cgacaggccc tgaaccgcat ccaacgaagc aacatcctgc
   107401 agagtttcaa gacaaagatg cttagcacca tgtttctgct gaaccgaacg tccgatcgcg
   107461 actacattac gaaattgctg actaaaatgg tcgaggccac caccggcagc atcctcgaaa
   107521 accccagcac gtacgtgacc ggctccggca aacagctccg gggcgtcctg gtcagcaccg
   107581 cgcaggtggt ccagaccctc atgtcagtcc tcaaaagcag catctccaaa cagaacgtga
   107641 ccgcccccgc cacttacggc aactttgtcc tcagtcccga aaacgccgtc acggcgatcg
   107701 cacaccactc catcctagcc gactttaaca cgtacaccgc tcacctgacc tcgggtaacc
   107761 ccgatctcac cggctcctcg ctagagaaag ccgggcagaa cagtcacacg tcgttagcca
   107821 tggatgtcat tcaactgggc gaacacgcgg tagccctaga acaccatcgg gacgtgtaca
   107881 aaaacaccga caccaaaaac cccctggaga gaaacgttga tctcaccttc ttcttcccgg
   107941 taggccttta ccttcccgag gaaaaggctt acaccacggt ggaaaataaa gtgaaactcg
   108001 ccgaaaccaa agcgaatgcg ctccccacct ccgccttcct cctgaatcgc gagcgcaccc
   108061 tgcagcgact cgactttgtc gacgcgctgg ccactctctg tcaccctgtc attcacgagt
   108121 ccaacgcgtg cctgcagacg ttcatcgaac ggggagttcc caccgacccg gccgtagcca
   108181 gactcaccga atgccggttc cagcaagaac agatgggcgg catggcccgg cgcctcgtgc
   108241 acttttaccg cgtgcgtcga gaagtgccgc gcacgaccaa cgaaatcaag caggactaca
   108301 cggtgactga tttttacaag ataggtaact tagcactcta caccgaagtc catcccttct
   108361 tcgacttcac gcaccaccaa ttgaacgggg agaccgcggc cctctgcacg ccacgcatcg
   108421 tcattggcaa cataccggac ggactggccc ccagcggctt tcaagaactg cgcgccgcac
   108481 acatcgccga gatggttcga ctccgaccgc ctccggacta cgaagctacc ctgcaattgt
   108541 tccgaagtac cgtgacctgt cccacttacc ctgaactgtt ctacctggtc gacgcgctgg
   108601 tgcacggcaa cgtggacgct ttcttgacca ttcggccgtt tatcgcacga tgtatcgtca
   108661 acatgttcca aaaccgccag ctgttggctt tcggccacag ctacgccatg atcgctatga
   108721 tcgtcgaaca cctcggcgac ggcctcatcc cttccaacat tcacgcgcac taccgcatga
   108781 tcatagtcct gctgcgactg gtgacccgcg tgtcttcgct cccaggcctc aacaacggcc
   108841 agctggtcga cgaacctctg agcgcctacg ccaacgcgct ccacgatcac cgtctctggc
   108901 cgcccttcgt gtctcaccta ccccggaacc aagaaggcgt ccagatcgtc accgatcgcc
   108961 aaccgctcaa caacaccaac atcgaatccc gtcaccacgg cgtgtcagac ataccgcgca
   109021 tcgcagctat ggacgccgac gaacccctgt tcatcgacga acaccgagct accgacgacg
   109081 aatggacgat gcagaagatc ttctacctgt gtttcctccc cgccatgacc aacaaccgcg
   109141 cctgcggcat cggactgaat ctcaagacgc ttttggtaga cctcttctac cgtcccgctt
   109201 tcactatgcc cgccgagccc gaggctcttg gcgaaatgct gccgcagctg gtgcaagaca
   109261 ttggcaccag cgacgacgtg aacctctatg aggcctgccg agagctcttc ctggtcctgc
   109321 agtacgtgcc cgagcacgcc aaactcttag aagtgcgcgc gcctctggat ccggcccagc
   109381 gccacggctc cccagacttt acgtcgctgc aacacgtgct gtacaacggg tgctgcgcca
   109441 tcaatgcccc caagatccta gccgagtact gcatcgccat acctttccac cgtttctact
   109501 ccgatcccac catctgctcc gccatcagcg acgacattaa gcgatacgtc accgaattcc
   109561 ctcactacca ccggcacgat ggtggttttc ccctggcccc cgctctctgg cacgaatact
   109621 ggaactggct gcgatcgccc ttttcgcgct acacggcggg atgccccaac accctgcaat
   109681 ccgtcctcac gatcgcctgc atgctgtaca aaatctctcc cgtctccatc gcgttgatgg
   109741 ccaaagccgg cgtgcacccc ggcttcgctc tgacggccgt acggaccgac actttcgagg
   109801 tggacatgct gctctatagc ggtaaatcgt gcacgtcact catcatcaac aaccctcaag
   109861 tcaccaaaga ggagcgggac atcaatacca cgtatcacgt cactcaaaac attaactccg
   109921 tggacatggg tctgggatac acttccacca cttgtgtcgc gtacctgaac cgctcccgca
   109981 gcgacatggg cgtgcatgtg cagaaccttt tccgcgtctt ccccatgcac gtgcatcgac
   110041 acgacgaggt ggatcgctgg atacgtcacg cagccggtgt agaccgtccg cagttgctgg
   110101 acaccgaagc catctccatg ctgacgtttg gcagcatgtc ggagaaaaac tccgcggcca
   110161 acctgcacgg acagaaggct atatgcgaac tcatcatcac acccgtcagc atggacatca
   110221 attatttcaa aatccccaac aacccgcgtg gccgcacctc gtgcatgcta ggcgtcgatc
   110281 cgtacgacac ggacgcggcc atgaaaaccc tgtacgatca caccgaaccc gacgcccaaa
   110341 cgttctcgtc cacgcataac ccttgggctt ccaacagggg ttcgctgggt gacgtccttt
   110401 acaacattcg gaaccgcgag cgtctgggct acaattcgca gttctacagc ccgtgcgcgc
   110461 aattcttcaa cacggatgac attatcagcg ccaacaagac gttgtttaaa accatcgaag
   110521 aatacctcct ccgagccaaa gactgtatcc ggggagagac cgacacccag tacatctgcg
   110581 tggagggcac cgatcagctg atcgaaaacc cgtgccgcat gctacaggag gcgctgccca
   110641 tcctgtccac caccacgcag gcgctcatgg agaccaggct taaaaactcg tcggcctcgt
   110701 tcgcctcgtc ggaaactcac tttggcaact atgtgatagg cgagtgcatc ccgctgcatc
   110761 aacgtatgtt atttaactcg taaagaacga attcgactat ttgatgcggc acgctagtta
   110821 aagctcgcca aaccgacggc gacatggcgg acttctccat cttttgcacg ttcgagcaga
   110881 aactgagcct caccgacgtg ggtaaactca ccaagctcac gggagccatc atccccgtcc
   110941 ccagcagaca tcatctcatc aaacaccatc acctgggtct tcatcaatac atcgaccaca
   111001 cccgcggata tgtgcggctc cgtagtctgt tgcgaaacat gacgccgacc atcctacgac
   111061 gcatcgaggg caaccagctc gccatgcagg tgcccaccca cgggcacctc tacacggttc
   111121 tcaacacagg acccgtcacg tgggaaaaag gcgacaaatt gtgcgtccta cccccgctct
   111181 tccaaggtcc ggtggcgcgc gagtatcccg tgtccgtggg atcctggaac ctggtgctcc
   111241 cgtggctcct accctctcaa ctggccgtgg aaattaacca gaggattctc atcatggccc
   111301 tgttttcact ggaccgctct tacgaagagg tcaaggcggc cgtgcatcaa ctacagcaca
   111361 tcacgttccg cgacgccacc tttaccattc cggaccccgt cacggacaac caccatctcc
   111421 ttctcgatat gaagaccgcg tgcctctcct tgtccatggt cgccaacctg gcctccgact
   111481 tgaccatgaa ctacgttcgg aagttagccc tggaagacag ctccatgctg ctggtcaagt
   111541 gccaagaact gttgttgcgc atggaccgtg aacacgccgc cgacgggctc cgcggaagac
   111601 ccaacaacgt gtcacctgac gaagaaattt ctagactctc ggccttgttt gtcatgctga
   111661 ggcaactgga tgacctaatt cacgagcaac cggttttcac ggtctgtgac gtctcacccg
   111721 ataacaaatc cgcgacctgc atatttaaag gctgaaccgt cccactgaga tcagtctcga
   111781 accatgccgc gagcggacaa aaccatgcgg aatggacctc gaggccgccc ccgaaaggcc
   111841 tccgttctcc tccagtcaga cgagaccatc ctgaccctca cggaccagca ccacatcaag
   111901 aaccccctga cgcgccatgg cacgtttcgt ctgatccagc tgcacgtgga cttccagccc
   111961 gccgacctgc agcatccatt ccagatcctg ctctccgccc cgctgaagct cgagtccatc
   112021 accccgcacc gcgatcccga agaacgaggc ctcctctgcg ccgtagccaa tggcgactcg
   112081 gacattttcc ctaacctcac cctcttcccc gcacaggccg ggagctgcaa tatcatccgg
   112141 gcgctcgtgg acgaacacat gacccagatg tccatcatca ggctgtctct gaacatcttc
   112201 gccctcaaga tcatgccgcc gctgaggcac cagctgcctc tccggcgcaa aatcacgcaa
   112261 cacaccacac tacacgactg cgtttcgctc cacatgcccg acctcgactt tacgaccgac
   112321 gaaaaccaca acaacagcaa caacggcaac gacaacacta gtacgcccga actcaccatc
   112381 cgcgtcaagt ccgccctctg ctggcacacg gcagagggcg gcatctcagg accgcgcggc
   112441 ctcaccagcc gcatctccgt gaagctctcc gaaaacgcga ttcagaacat ggggcctgcc
   112501 atttttggac agctctacac cgacgaaggc tctccggaac tcgttctctc ctcgctgatt
   112561 ctgtatcagg acggcctcct ccgattcaac gtgacctacc gcagcgcgca gcaccagctg
   112621 ccgtcgaatc ccatcgtgtc gttccgattg cgcctccgac gacacaccgt cgcgcggccc
   112681 ttcttctcgg acacacctct cccttacttt ctcccgcgac acgacgagaa cggcggcctg
   112741 gacgtgtgcc tgccgtacga tctgtccctg aaatcgtccc acctgatccg gatttaccgc
   112801 cgcttttacg gtccctttct gggactgttt ctcccccaca accgccaaga cctcgtcatg
   112861 ccagtcaccc tctggctacc ccggacttgg ctggaaatca acgtggtggg cgagaacgcg
   112921 cacatcccca aaaacaccgt tctgggacag ctgtacttta tctcttccaa acacaccctg
   112981 aaccgcggcc gcttgtccgc cctcacacac caggtgaagt cggcggtaca caacgtgccg
   113041 caccagctgt ccctcctcgg tgcctccctc tccctgcagg accttgtccc catacaggtt
   113101 tcccgcccag atccagaggc aggacaacaa caacagcaag cgagtcagaa accggttacg
   113161 ttcgccatgg tctgcgacca tcaaactgta tctccattgt aataaaaacg ttttgttttc
   113221 cacaagactc gtgttgtgtg tctagcgcca tctatattgt atctaaatag cgacacgaac
   113281 ggaacgggct cagtcggcag aacccatcgg gtcagtcaac atggcgagcc acgcaccaga
   113341 agaagacgaa ttcctaaccg tcatctcggg gaacgtggtg aaagccgtgt ttaacaaaag
   113401 cacaaccacc atacaaccgc atcagagtta tacgcttcgc acgggcatta aggtcgaagt
   113461 caatgaaccg gccattatcc tcgcgacaca gtttacgccg gaatcgcagc cgtgtcagcg
   113521 ctacgacacc gacattcaga tcaaacacgc ggcgttggag gctcggagca tcgaaaacgt
   113581 gaccgtacag gtgcacaacc ccaccgaccg gcctctctct cccgctacgg ggccgctgtc
   113641 gctgtacatt tacgccattc cgctagaacc cgtctccatt ccccaattgg cgctgcaacg
   113701 cggagaaaac cgcaagcatc gccttcccgt ggccgatgcg gtgatccaac agatagacgc
   113761 ctcgtggcac agccgtctca ccgtctctcg tctgatatgg acgcggaacc agagccgcta
   113821 cagaccgcac ggcgtgtttc acaccacatc gttcgtcttc aatccgcaga acatgccgct
   113881 ggacgccgtc aacatggcca gcgagctcgt gtgctccctg cccgaaacgc acgtcacgaa
   113941 cgttcagaaa atcagcagac aagagatcaa agtgtatctg gaatgccttc aagaagaggc
   114001 tccagacacc aaagccttta ttcacctgtc ctggacacag ggccgctatg acatcgctcc
   114061 gagccgcaac cccaagccct tcttggtccc acacgacaga aatggattct tcattttgtg
   114121 tcctcaaact ttccatctga aaccaggcaa aatctcccac atcatgttag acatttcatt
   114181 tgaatccgac gattacgtgg gcatcatctg tcctaaatcc attccaggag tcagtttcac
   114241 ctgcaacccg ctcatgaacg cacaacctgt gtttatggaa gtgagagccg agcacgaaag
   114301 catctacctt gaaaaattcg aacccatcgg ctggctgcac tttctgaaac gcaaatcgct
   114361 tctcgtgaaa aatcccacgg ccgctgagtg tcccggcttc atagaccagc accgaatcat
   114421 ggccaaactg gaatacgatg acatctacag cgaacgcgcg gacgaagagt ccagcgactc
   114481 gtcatcgtct tcggagtccg acacggaata ttcccgtccc ggtaggagcg gtcgacgaag
   114541 accgccacca cccaaacgaa caccatccac cgtcagaggc aaacgcaagg ccagcgacgc
   114601 tatttcagac gacgaaggag aggctcgaga taatctcatg ctgtgctggc ccaactggca
   114661 atgcggaatg aaagtgcaaa acctaacgcc gctcatcgcc accgtgagca gcgaattttt
   114721 cccaaagaag gagttcttct ggggccagga tgacgaatac cgaaccttcc actccatgga
   114781 aggcgaatgg cgcccctacc aatcgcagag acgccgtcgc cacacgcgct cagaatccgc
   114841 agcagcggcg cccagccagc cgccgtacat cggctcggtt agcaaaaagc accggagcta
   114901 agatccgcgc cttgtaccca gcccacaatg acgacaccga cttcagtcga aagcaccctg
   114961 gtaaccagtc gacatggctc tggcagcgcc gcgcgagccc gaattggtaa ccgaaatcgg
   115021 tcccatctcg ggaaaaattt tcaaaaacgt gttgagcgaa gcccacgagc ctgtcaattc
   115081 ggaagagacc aaggtcgtca agacaggcat cgacgtgcaa gtcaatcaac actccctcat
   115141 ctttgtcacc caactcacat ccaaatcaca ggccgaatac taccatgagc cgaacctcca
   115201 gattaaacac agtgtgtttg aagaacaaga agtgaagaat ctcaccttgc acgtgtataa
   115261 tcccaccggc aagcccatca taccctcgga ggaaccactg tctttttacg tgtacgccgt
   115321 gccactcaaa cccgtcatcc cacccgaact aacactgtat ccatccggat cggcgaagaa
   115381 acacaatccg gccagagctc gggtatcggt ggaagcgttc accggaggat ggcacaccca
   115441 aattcacgtc aaagacctgc tatggaccca acgcgaaagc cactggctac aaaacggcac
   115501 atttttttac acgtcgttta ttgtcaaaac ctatccgatg ccgctacagt ttatgaatac
   115561 tgccaaggaa ctggtgtgct ccttgcgcga ggcgcgagtc acgaaagttc aactggttga
   115621 caaggacaag ggactcgtca aggtttacat ggaatccctt caacaggaaa cccccaagac
   115681 cacagccttc attcacctgg cctgggaaca aggcgacgcg tccatcacca tgagtcgcaa
   115741 tcccaaaccc ttcctcagac cccacgaaag gaacggctac accatcttgt ctcccaaacg
   115801 attgcacctg aggcccaaaa aaatcgcgca agtgtttatc gatatgtact ttgaatcgga
   115861 tgaatatatc ggcatcctat gtcccaaaaa cattcccgga gttagcatct cctgcaatcc
   115921 actcatgtca gcgcagccca tctacataga aattcgaagc atgagtaaaa acacagacat
   115981 taaactcttc cagcctctgg catcgttaca tttcatcgaa cgtaaactgc tgttccgtcc
   116041 caaaaaggcc gattgcatct acacggacca gttccgcgtc ctagccaagc tggaatacta
   116101 taacttttac gacgcccatc cacgcgatga tgacaccagt tcatctagct cctccggcag
   116161 ctcatccagt tcatctgaat ccagcaagtc tagtgattct tcgtcgtctt ccagttcaga
   116221 ctcggaatgt gaaatcatgg aagtgttccc tcctcccgag ccgatcgctt ccacttcggc
   116281 tgcaatccag agacctaaac tgtcggcgat cattcgacgc aaacgtttca ccaaatccca
   116341 tacggcgacc gattctgacg acgacgatcc cgataaacaa ttcccagtta tttactggcc
   116401 catctggaga tgcggtgtta ggtgcacaga tctcaccccc attatcgcct gcgttcacgg
   116461 tgatcagctg cctttccaag agtttaagtg ggacgccaaa gaagactggc gccgtttcta
   116521 tggcctatct ggcgcttggc agtcactgca cgctcccaga cgtcgtcgtc aacaagccac
   116581 ggaagagata tcggttacgg atgacgatcc gaataccaaa aagccctgcc cgtgaacccg
   116641 aacgcatata aaaaccccga caccctaaga tcacgcgccc gtttcctggg tcagcggcgg
   116701 gtgctgtatt tgcggacaac gtcaccggcc ggggcactcc gccaactctc gcataccctt
   116761 cgacatggat cgtcctcaag aggaaagaga acccagaccg tccacttctc gacccttatc
   116821 tctgtccgcc actttcgaac gcctgtcatg tcaagtgatg cgagtcatct ctacccagaa
   116881 caccaccctg gaaacagatg ccgtgaaagc ggtcaactgg catacccacg tacaagtcgc
   116941 caacccagcc gtgatctgtg ccttccaaga gtccacatgc acccgcgacg cccttcagct
   117001 gacggacata agcatcaaag gacgtgcgtc ctctactctc agggatcaat tgcggacgga
   117061 cgtagccaac tatgccaata agcgactgaa gagcggtgcc cacacgaaat ccttgctggt
   117121 ttttgcactg cctctgttac gagtgccagt caccggcatt cacctgtttc gcgggaaagc
   117181 gaagaacgaa aaccgcccac tcaaggccaa cgctcgagcc accattcgcc ggtcccagta
   117241 catgtggaaa gtgaagctga atctagataa gattgtctgg aaccgccgaa gagacccgaa
   117301 catcgaaaac ggtcagtttt tcaccaccga cttcatcttt cccacagagc tcattccgct
   117361 aacggtagtg gatgccatgg accagctagc atgctcggac gccgatacct atatccagaa
   117421 agccgaaacc gtggggagcg aaaacctgat aaaagtgttc ctcatgaatc tgtctcacca
   117481 cccgccgcaa gaactgtttt tgcaactctc cgtgtattcc caccgagccg aggtcatgtg
   117541 ccgccacaac ccagcaccgt ttttccaaag acacgcggac aacggcttta tcgtcaagaa
   117601 cacaaaaggc gttaccattc ctccgcatca cacccacgtg gtgcatttca acaacgcgtt
   117661 ggagacgcag aacacctgct ctgtcctctt ctttcccgtt gacattccgg gcctcagcat
   117721 agaatgcggc ccattgcaga accgcatgaa aattaccctc aagatgcaga acatcaccaa
   117781 gacggaaatc agcgtgtcct tcatgcaaac actgggttta atccacttct ttcctcgagg
   117841 cacgttgtat accatgccca acaaaacggt aacgtccgcg tgctcccaga tccgcctgcg
   117901 cgccggcctc tgtcccagag agtccatcgc tcgcggcatt tctcagttcg ccgagcaaca
   117961 ttcgtcttcc agcgaagacg aagatgacga cttacccggc accaccccgc cgatcatcac
   118021 cgaggccatc tttcatccgt tccaaagcga aaacgaatct acctcagacg aagatgatga
   118081 gcgcaaaaaa cgtggcggga aacgacccgc gacgcctcac atctccgacc aactctcacc
   118141 cacatctatg ctgctcaccc tgccctgttg gaacatgtac atacacctag aaaacctaat
   118201 gcccatcacc gccggcgtcg aagacagcgc ggttaaaaac acctcttacc tcaaaagcga
   118261 aatggacggg gacatctgta ccgccgccga catcgacgtg gcctatcaaa ccctactcgc
   118321 ccccttcccg ttgtcccaca gatccccttc tacctcccga cctcgaatat aataaccgcg
   118381 tactctagaa accagacgac acacatgtat gtatagctat cactgtttgt ttcatgtacc
   118441 tgtcaatcaa tcataataaa gtcagagcca ctcagcatca tctctttgta ccacgggtgt
   118501 ctttattcca ttttattcaa cgccgccaca aacaagcggc gatttaggtc caccatgtcc
   118561 ttaggaggaa tgccttcccc cggcacagcc acacgacaag aggcgttcac caccccgcgg
   118621 tccgccgact tgctgctatg ggccgaaacg gccgatggag cggcaacaga gggagttttg
   118681 gaaggaggtt cgctcgtggc caccacctcg ggctggtggg acgtggtggt gggggaggac
   118741 actacgggcg tcgctaactg ggtaggagtc aggagagccg gcggcgccac ttgccgcaca
   118801 gccaacattt cccgtttcaa ctcctgcaac gcctctcgaa tctcgtcata gcgatctcct
   118861 cctttagagt ctgcggccgc actattgtcg ccgcgcgcgt gatgagcctt gagccgcttt
   118921 cgagccttgc cgtggtcagc ttcgccggga aaactcatgt cttcgtcatc gtcggaagat
   118981 gcggcgtctc gttcccttcg cctcttcagc gcgccgccgc gagcgcgcga ccacgagccg
   119041 ttgccgccac tagcagcgcc gtagtggtcg tacaccgaag gcgcgtaacc gcgctcccag
   119101 gcggcacgct cgacctcgtc catcatcggg tcccgtcttc gatatggcag gggaatggcg
   119161 gcggggggag gcaaggaagg cccggcgtca tagccaggcc gtcgtagcca agcgccatag
   119221 tcataatgac gggaggggtc ctcgtaactc atgacaggat aagcgggcgg cggatgggca
   119281 gccggatacg ctgcgcgcgc tcccgacgcc tcggccatcg gccgactggc cccgatgagc
   119341 gagaagaagg cgtctttagg taaataaaca ccgtccgggg ccagtgccaa ggacgcctga
   119401 gagggcgcga cggacgaagc cgccggagta gccacggcgc tcagagggtg agacatggtc
   119461 tctgcaggta cgtggctctg ctctggctcc ttggacctct cttgatctgc tttaatatcg
   119521 cacggctcct gctcgccggg cgaaacactg gctttcacgt acgactcgcg accggcgacc
   119581 ccgaccaggc gcttatcgta acgcaacttg gggagccgct cctggatgta aagcgcgtcc
   119641 acactgttcc ccaagaggcc gtacgaatcg gactgaaagg ggtcggcggc cgacgacgag
   119701 gagtcgtcta ccttgttcgc gtccgccgct tccccacttc ccagaacctg cgcccgcaag
   119761 gcttcccgat cggcctccgt gagatccggg aaacgttcca tgacccaatc tggctgcctg
   119821 ccatacaccg ccagcgtgcc acgccggcgg cccacgctgc acagagccac atgtttgaag
   119881 cacgctgttt ctgaatcgcc cgcggcgcta tcggccgcgt ttatatcgcg gcggctggag
   119941 agcgacagcc cggaataact gccgctcaga aactccacca cgccgtcggg ctgcagcgag
   120001 gactgcgacg gcggcccccg cgacaccagc tcggattttt ccgaggcctt ttggacgatc
   120061 tccagaaact tgggcgacgt gacgcgaccc aggcagaaca gaccggcttt gacgttctga
   120121 agcccggcca cggagcccac ggtggcagat tcgtcgtgat tgacattcag aggcagcggg
   120181 ccgcgacagt cgcgcagcca gcggtccacc acggcggagg gcaagaagag ctccgcttcg
   120241 ccgggcggtt cgtcgtagcg caccagaaaa cccccgacgt agacgggatc ggccatgtcc
   120301 cacacggacg aagaccaggt ccgaacgggc aaattctcct ttacttgtgc caatcatcta
   120361 atattacaga tcagcgaaaa gatgtcgcgg ggacagccgc tcgacacgct gcggctggaa
   120421 gaactcaaga tcctgagact catctgcgtg ctcctctttc accgcggcct ggaaacactg
   120481 ctgttgcgcg aaaccaccaa caacctggga gtgtccgaca acgccgtcct gagccgcaag
   120541 acgccgacct cgtactggcc gaacctgtac cgcgagctgc agcagacgtt cccccaggtg
   120601 gacttccacg ttgttttcca cgaggagcag gccgcccagc tgagtcagcg gctcagccaa
   120661 ccgcgactca gcacgacact gttaagccgc ttcgtgcaac gccacacggg cctgctcatc
   120721 tccttcccgg aagacttggc acgcgacggc aacttgctgt tctccttggg cacgctgtac
   120781 ggacacaggc tgttccgcct ggccgccttc ttcacccgtc actggggcac ggcgacctac
   120841 gaaccgctga tccgcatcat ctgccagaaa atgtggtact tttacctgat agggacgggg
   120901 aaaatgacaa tcagtagcga cgcgttcgaa atccagagaa gcaaacacga gatgggcatt
   120961 ttcacgttta ttatcgaaga ttataaagca tttgcaggca cactctctct caccccccgg
   121021 gtcacactgc accccgaggc cgtggcgtca gccagagcct tgcacatgcc cacggcctgc
   121081 ggtgacatgt aaccaccaca cacaagacgc tattttcccc acgcatggtc atcatgaatc
   121141 tgtacatcca tcaactgctc cctgtcacgt cgaattaagc tggagacgat ccagaactaa
   121201 acaccgccga acaactcggc gtgacggtca cctcgaccgc agagtcactg gtagccatgg
   121261 gttcttcatg ggtggtgaga tgcgcggtat cgtcacgctt ggtaaaacgc catgtcacca
   121321 tggcgcttag cttatccatc acgtgcagcc atttcctgag gagggattcc gagacctgca
   121381 gatccaaagc gctctgatcg atagcctgtt cgactcgctt cagtggatcc atgtcacaca
   121441 gagccaaaat gaacatgcta aacaccgtca ggcggaaatc ggcgagcact tcgcaacaaa
   121501 aaagtatgta atccacgtag tctgggtacg ggttaatcac ggcagtgttg ttgactgaga
   121561 acaggccact gcgcacggct ttcacgtagt taatggggaa cagcaagaag aacaaaaccg
   121621 tgtaaaacac cagcgctctc gatgcgtatc tccacatgaa atcacgattc cgatgatagg
   121681 aaatctgaat gatcaaagcc acaaccgtta caaccggagc caaaaacaga aatacgacct
   121741 tcaaggccac ctccacggcc gtgtagcctg caggtatttg acagccgaac ccgctgcgac
   121801 cgctgggaat ggccaccgag gcggtaggaa tagcggccac caagcccata atgtagctaa
   121861 acaccacggc atagtaactg agctccttgt tgtacttggt ctggtgtttc caggaatagc
   121921 gatcgtgaag aaaagcagcc agacggtcca ggattaaaaa catgaacatg attgacgtga
   121981 tatagacgca gccgtggtca aagagaacag tcaatctgca gaagttagct gcggccgcat
   122041 ttttgtccgc agcgatgtac ctggacagca tcatcacaca gatagccacg aactggatgc
   122101 ctatgaggtt ccacacaaaa atggtcacgc tcgtcggcaa tcgcgccctc ctcaatatca
   122161 gcaggcacat gagcacgaag gcgaacgcca taaaactcga tgcccccatc atcatgttga
   122221 gcaagttgag actcatggta cccgtgaagg cgatcatctc gaggccgcca caacccgccg
   122281 cgccgtccac aaacgagcag ctccgcagag cgaagagcgt tctccccggc tcttgggagc
   122341 caaatagagc gtcctttatg ctgttcacgc atccaaagtg cttacatcac ggccactacc
   122401 ggaagaaaac ctaataccag aaagtaaatg cactcgtaaa tatcattgac gttgaataac
   122461 gccgttccca gggcgaaaac gcgaagacgg ggcaaggcca ccgaaagaag ccgtccgagg
   122521 ccgtgctcgt aatgaaacag cagcgcgtcg tgcagttcca gacgcttcag atcgccgtac
   122581 tgcttagaac tctgcgcgaa catgaagtcc gccacgggat tcaccttgct gatctgcatg
   122641 agcacggtgc caccgccgtc tcccgcctgg ctgtctcctc gccgcgacgg atcccaaccg
   122701 cttcggacgc tctcggtgat ggccaacagc gccatcccgg ggaaaagttg ggacacggtg
   122761 acggtggagt cgcgattata ccaaggaatg atgtaatgct ccaaaaaaaa ctcaaagttc
   122821 ctcacccgat tcccatagcc gtagccgcca tcatcctggg aggatcgcgg aaacgcatcg
   122881 tgccccagaa tgtcggcgag ggtgaacttg ccggagcggg gcgcgaaaac gctctccgag
   122941 ttgacaacct tccagatcag cagcagggtg gccacacagg ttatcccaga acgaaggtac
   123001 tgttgttcgt gtacgaaaat aggtacatca cggcccacct tgctcgccag tagccgccta
   123061 caccacagcg tgaggctgtc atccgacatc tggcccgaca ggcgctcttg caccattgtc
   123121 gcagtttgcg cctcatatcc aggcaagtgt tggatgacct gtctccggtg aaacacgcgc
   123181 accaagacat tctgatcgaa cgttcccgga gagtaatggc gaccgctgct caagggcatg
   123241 tagtacttga ggtccgcagg gtcgcgatag gcatagtaat tgacggtggg tgcgccctcc
   123301 cacgtcgcga tctcgcgact cacctcgtct gacagtttat gtaacaaatg aggcagctcg
   123361 gtcagcaccg cctggatgga gctcgggagg tcgcgtccgt cccagtggtt ctggccgtag
   123421 gcggctaaaa ggcacatcgc ggcctccaaa tcggagacca cgcagtcgta ggcagggtac
   123481 actgttacgt tttctaaagc gttcacggcc cctatcagca actcctggga aatggagaaa
   123541 ttctccatct gcgctaaccg aaaggttttt ttccaccggg gttgtgtata aaggctgcgt
   123601 ttgagacggt aataccagac cccgaaggtg aaggtccagg tggacgcgtt ctcgaacatg
   123661 gtgttgacca gctcccccct gaagtccgtg tggaagcgga tgaaggggtc attcttcgtg
   123721 attccaaaaa acagaacgtc cttgccctgg tcggaacact gcgcaaccca ggttgcggtc
   123781 tggccccggt cacgcgtgac ctgaggcgcc gcctcagagc cgttgccagc actataagac
   123841 tcccttcctg cctgtccggg aggctcctgg cacggcggcg gcggctcgac ctcgcactgt
   123901 tgtttgagca gcgcctccgc ttcggacacg cgcgtttcca gatcttcgca gtaagtttgc
   123961 accttttcgt tgagcgcgct gagctcctcg cgcagatacc gctttcgcac tcgattggcg
   124021 accacttcct ctttgtggag ccccgcgaag gagtcgtcca ccagcctttg cagcacgtga
   124081 ggaggacact ttaggatgtt gtctgcgtga ggctcgaagg cgacgacgat aggcagccga
   124141 aagtaaggct gtaacagact catgctgccg gcgtctcagg tagtcaatga ccgagtcagt
   124201 gcgaagggta aagggcgccg aacggaaagc gcgagcgaac gagggttgcg cagcctgctg
   124261 ttggaaaaag ataatggtag ggatgatggc ccatgagtca ccccgaggca ccttgagcgc
   124321 gtcaaagtcc gtcagcgcgc ccttgagctg cttcaggccc tggacgtact gcaagttgtg
   124381 tgtggcgtgt tctcgcacgg actgcccggt ggcatccgag caagtggtct taaactctat
   124441 cacgtagcag agagcgcgcc gcggggtgtc gggggacacg aacaccagca cgcagtctgg
   124501 aatccgctga gtcaggcgca cctcgaaaaa gagccagcga cgatagttct gacagtacgc
   124561 tggaaagagc ccccccagaa gacgattaaa cgccgcgaac gagggaaagg cccgtagcat
   124621 gcgacgataa atgtctaggt gctttttttg tccgtttcgc ttgcaaaagc tgggtaacgc
   124681 atccagagag gtgatcactc cgcttctcac cgacatgacg cgcgtttcat tgcaggacaa
   124741 tagcgaccca acgcgacgtg accgcgcatt gcgtcatatt aaataggcca gagcgcaagt
   124801 tggaacccgt cccggtctta tctgtgaatc tgctgccgag acccgccatg cttcgaagcc
   124861 tgttgctggg ctgcgcggtg acatggctta taatgcaagc agttttatgc acagacgttt
   124921 ttccacgtat gactctggaa ctgaaccgtc gacccatcaa attcttacga gagaactcca
   124981 caaaatgtga caacaacggc accgaaaaaa acatcactac agttaaggag agtgctatta
   125041 ccttcaattt ctacaaagac aagaggtaca catcttttca gttacctcga tgcctcttta
   125101 ccggtacttt ggctgaaagt tttctaaacc aagtggattt atcaaaaacg cttaaacaat
   125161 atttcgacac actaaataca tacgccaccg tatctgaggg taatctccgt tacaaatatt
   125221 acggacaaaa cttaacagaa caagaccacc tgaaagacca accatctacc atacctcctc
   125281 ccgcaaacat caatctgcaa aacacgctat tctacggtgg tgacatagct actatcaatg
   125341 cctctggatt tcataaaccc atgttcaacg gaacatgtga tttatttcaa gacagtgaac
   125401 ttctttttac cgttaaagaa acatgccttt atcaagcttt ctacaccgaa gagaacgact
   125461 acatgcaaat aacccttacg gatcaatttt tagttcttac agtagttatg agaggaacac
   125521 ccctggtttt aatttttgga aatatcactc gacttgcatt taaagcccca tacagaccag
   125581 aaaactttat tctgagaaaa acctccaaac atacgctaat acttatagtc aagaaagaac
   125641 acctcatata tcatacttac gttaaccaaa aggacttttt agatttgata ttatcatcaa
   125701 actaccaaaa cctagaaaca gcattgttaa tttggaacca atacgccgtt catgttcttc
   125761 aacatggaca ttgtcacacc atgacaccac aaacggtcca aactgccttt acctacggac
   125821 tcctgctgta catagcctcc acgtctgcaa acgacaaagc ctcagtgtca cgcgtaatag
   125881 accaacacgc ctccattctt cttgctcaag attttgtaac aagctgcatg tccagaatgc
   125941 agccacgaac cactctgcta ctatatccca ctgccgtgga attggccaat ataactatga
   126001 agaatggaaa gatttccagt gttttgacct taagcagatt aatctacata ttatcaaaac
   126061 agaaccagca caaccttata accctcaagg acatggaaca ccttcgcgac cttattctaa
   126121 gtatacataa atcacatttg gcatcattta tatcccggtt cgcccgccag gaattatacc
   126181 tggccagcgg catcattcac tccatgttga attactccaa cgccagacgg gaaatctttg
   126241 tactcgagac aggactatgt acattagctg aactatcaca ttggtcacaa ctcattggaa
   126301 gcgaagaaca cgtccacgtc agcgatcttt acagcccttg tgctggaagc ggtcgccgag
   126361 accacgcttt agaacactta tctgcaatgt tcccaaaagc aactaattct aaaactctga
   126421 gaacagcgct atctgtcctg aatactcttc gaccgcaaac gtttaccact ttcccagaag
   126481 taagctgtat atccactgaa aaatcttttg ccgtcctcac agtatcacca acaataacat
   126541 acaccatctc tagcgagtac attgtaaaag gagtgtcttt tcccgttgta accactgttg
   126601 ttggtcgcag catcatcatc actcgagtta tcgctaatgc aacctgctca tccagtagta
   126661 gcaagcatga aagtttacca attgttatga ttagaaacat taccctggaa caatgtgatt
   126721 tttgtcaaag cgccatggta gagtacgacg actcccaagg cattgtgaac gttctgtaca
   126781 tacacgacag acaagactta ctctttgctc tggactcaag caaccagatt tttcaaaaac
   126841 atcctcgaac ccattacctc atgctcctaa aaaacggtac aactgttgaa gtcacagaag
   126901 ctgtggttga tatgacggac acccacattg cactgattgt tatttatgct ttggctgcaa
   126961 tatttggact atatcttttg tatcgtgtaa ttagactgtt gtaacaataa aaacactgac
   127021 atctgatttg tgtgtttgag tatttatttt agtaagacgt attatacagg ccttggtaac
   127081 acgccttgaa aaccattagt gatcgagtca caacatcatc ttgaaagccg accagacaac
   127141 gataactaac cagcagcaac gtagtcaaca tcaaggcgta cacaaaacac accagtagac
   127201 tggttgtcaa cgaagtcatg ggttctggaa taacaaaatg gtatatatta gtcatgacaa
   127261 ttactttaac gtgtaccgca aaaacaaaaa ccagcaaacc taaaacacaa caaacaaata
   127321 gaaatatagc aagtgcactc gcaagaaatc catcctttag atactttgaa tacacactcc
   127381 ccatgccgca tttccctgac aaaaatatta tattggccgg tcctattaga aacacaagta
   127441 ttacatattt ctggtacgac ttttacagtc ctatactccg aaaacctaat aaatatgtaa
   127501 tgtgcaaata taaccacacc aactcatcta tgactctagt accgccccca tgtggttctg
   127561 ttccctcaat ggaatgtcta tcatcgatgc ttaacatctc aatgcagaat gatacagggg
   127621 aagaaccttg caaactcaat actactttta atccaatgct atataacatt ccacgatgga
   127681 ctacaataat atatgtaggt gcagatcgag taactattaa tagtgaagac atctatttcc
   127741 taggacttgg cgaaattata tttagaaatc ttcttagaca taactgtaca aaaagctttc
   127801 atgtaacaaa cgccataagc cgccatttgt ttagagtccc tcgagtgagt ctctggaaac
   127861 taaaacagac aatgcgacgc cttaaacgga gacaaacgga aaaagataca cacaaacaga
   127921 aaagatctca aaaagccggt aacacaacca ccgcaccccc tacaacacaa acaacatata
   127981 attacacaaa cgcaaccatt ctaccagaaa atatatccga aacattttat ttcaaacctc
   128041 cagttattat tacacaactt aaaactatga ttacctggct ctacacaggt ttacgataca
   128101 aacaaaaacc tttttgtaaa gaatccagga acaaaaagcg tcaatcagca tgggcaaacc
   128161 atagtcgcca aattttatat aacgacaccg tatggactat tcacggcaaa atgaatttta
   128221 cagatttata ctatacacta cctccttata ccacaaacac cactatcaac agcagtttat
   128281 ttattactcc cttatgggac cacattgaca gcctatcctt tattgaagaa attaggcgaa
   128341 acaaaagcca tttagaaact cgacaacgac ccaccaattt gtctctcagt atcctgccac
   128401 cgtagtcgtg gtgaagttct ggaaacagca atgtcgcaat accacagcga aagaaatcac
   128461 caacagcaat atgttcagac aaatccaaac agccgcaaac gatttcatag acacttcata
   128521 catatgagaa gtgcattgcg cactaaaaaa gtcatcgtta tgatgtttcc taattggctt
   128581 taaagttgtc gtagcggttg tgctggtgct cgttggactc gatgtggagg agttcgccac
   128641 acataaaact gccatccatg tccacagaaa cagtctcatt gctgtcttgt tcctcatgac
   128701 tgctccgcta ctcggcaccg agccacaatg ctcagcgtgc tcacggacaa gctagatcaa
   128761 cagctgatcg tctcgcagcc gcacaaatcc cgcttccaac gcttgtggca aaaggcatct
   128821 ttaataaaga atggcgaacg tcaggaaccg caggaaaacc aaagcctcaa cctgcgatac
   128881 tgcctgctct tcgccagcaa cctcaatttc caaaacgcct tccgacaccc gccagtggat
   128941 atcttctcac cgagacgaaa tattccatac aagtggagcc cttccagctt catcgtccgg
   129001 cagcagaaca cgcagctcac gttctttaac aagcacatca tctggctctc cgaacaaccg
   129061 cacacttgca cacccttagg aataggactc tacatcccgc tgggatactt tggaatcacg
   129121 ttttacaaat gtctggacgc acaattcgtc tgcatgccgg atctcatcga acccggtctc
   129181 cgaaacctca gcatggaggt catcaatctc agctacacgt tccaggccat cacgccagga
   129241 agcatcgagg gcgatatctg catctttccc tctttctgtc cggaaccctg gcagatgatg
   129301 aacatgctgc cccccaacga aaacaatttt ttcttcctgc gcctgcctca acggactacg
   129361 attcagcctt accactccca tacagtgtat ctggacgccg cctacgtcca cgctcccacc
   129421 acctgcgctc tcattgtagg aacccgccag atggcccagc taggactcat cacccgcccc
   129481 accatctggc tgccaggaac cgtagcctca gtcacgctag tcaacacctc caacacggcc
   129541 gtgcacgtgt ccagcagtgc cactatagct aaggtagttt tcaccacccg cacctttgcc
   129601 tacctcatac tagagaccca ccccataggc cacctgttgg taccccccat accagatacc
   129661 ggttttaccc acacgcccga acaccacatt ttacaacaac tcatgccgcc ggaataaaac
   129721 aaagaaaccg aatgcgtttg tttttttgtg tgtgttttta ttgcatgcgg ggacgggaat
   129781 ttgttaaaca gagggatgcg ccgacgaccg ttttcgcttg ggtttagcgg gaggaggagg
   129841 acgcgtcgtg acaacctgtt cgacatcgga cagcacctcg tgatctggca catgaggaat
   129901 catggccagc acctcatcct ccaaaatgtc ctcctcctgc accacaacct tgtccgcact
   129961 ggcagctgca gccgcgtcta aaatagaggc gctctgatcg cagtccatat ccaccaggcc
   130021 catcaccttc tgcacttcac agagggccaa ttggtccgtg gagaatttat tgagcaacac
   130081 ctctaacgtg tcgtcctccg acatggagaa ctcgcccacc accagtttca acatcatcac
   130141 gtccagcgcg tgcaaaatcc gctgagactt ttgattctcc acctcggcgg cgggacgcgt
   130201 gtgcggctgg caattatccg ccaagtagtc ctgcagcagc cgacatttca tctggcactg
   130261 gcggtagaga ggtatgagct tgagcagatg cttcaccact tcctgatcct tggcaaaagt
   130321 cttcaagtcc tcgggcgtga tccccagtgt gctgaagttc tcctcaaaga agtgctgcat
   130381 ctcctggagg ttcatatcct ccgagggctg cagcagcacg tagtccgctc tctccgagat
   130441 ccgccgctgg cagcccagga aaccgcacag gcgccgtgcc agctccatac tccaccggca
   130501 atgacgctag ttctgttcgc gacagagtat gattctgctc atatagtcgc caacgtgcta
   130561 tccaagtcgg cggcagacca ctgtgtgttt cccttactgg ttaaacacca cgcctccaac
   130621 ctcgtctact tctgtttgca gacccaaaaa tgcaccgatt cgcagcgcgt atctccggtg
   130681 ttcgtcgtca acaacgacgt tttgaatctc gcgcactact tgcacgcccg acagcccatc
   130741 ccgctctcgg ccctggtgga cagcctcaac gaagacgaga cgcgacccat ctacaaccat
   130801 ctgttccgca ccgtcatctc tcccgagcac ggcggcgagg tgcgcgagtt caagcacctg
   130861 gtgtacttcc accacagcgc catcgtgcgc tacctcaacc tcatctttct gtgccctacc
   130921 tctccgtcat ggttcatcag cgtgtttggg cacaccgaag gtcaggtgtt gctcaccatg
   130981 tcctactatc tgctcgagcg acagtacagt accatctcca ccgtcgaaga atacgtacgc
   131041 agcttctcgc acgacttggg ggccattatc cccactcacg ccaccatgag cgagttcacc
   131101 cgactgctcc ttggctcccc cttccgttcc cgcatccccc aattcgtgcg atacgccatg
   131161 gcgcgcaacc agcgagacta cgacgagctg gtccatgtcg acacgcaaat caacacgttc
   131221 cgcgagcacg cgcgcttgcc agacaccgtg tgcgtgcact acatctacct ggcctaccgc
   131281 acggccctgt ctagaagccg cctcctcaag taccgcgaag tggtggccta cgacgacaag
   131341 accgccagcg aggagcagtg ccagaagcag cccttgtttc tgggtcgcca cctagaggaa
   131401 gacctgctga acgtcatgaa caagtacttt tcgctgccca actacctgca ggagtacatc
   131461 gagagccgcc tgatgtgcat cgaacccaac caacacctgc gcctgtcggg gtacagctac
   131521 cgaaccgacg ggcccgctct cacgggtttc tttggcacgt catcccaggc gatgcgcaag
   131581 gtggatcaca tcaacagcat gtccgattcc gtgttccccc ctctggagag gtctctctcc
   131641 ggactgctgc gcctgtgcgc gtccatgaaa accgccaaca cgtacgccac cgacaccctg
   131701 acccgctact cgcagcgcca gtttctgctt cccagggaag cgcagtcgga gtaccccatc
   131761 cctctgttcc gcgtccagct tcccagcggc catcatgtat tctgcgcggt ggcgtcggaa
   131821 aactggaacg agagcatgtt tcccagcgac cttctcaaac acgttcccga tagccacttc
   131881 acggacgaag ccctgactga catggtctgg ctccacgacg acgatgtggc ctgctccaat
   131941 cccgaaaccc agttctacta tgcgcgccac gagatcttta acgaccgact gcctacgcac
   132001 aacttcgtag cagatttcga cctgcgcctc agagacggcg tcgtccgagg gctgtccaaa
   132061 gaagttgttt tcgaaatctg tcggggactg cgtcgcgtct gggtgacggt ctggcagagc
   132121 ctgttcggcg acacggatcc agagcgccac cccgtctact tctttaaaag cgcctgcaaa
   132181 accgcctctc cggacttcta cgacgacgac aacccgccgc cgtcctacga agcccgaaca
   132241 gattattgta aatgtacaga caagttaggc cttcgcatca tcactccctt ccccgagcga
   132301 acgctggtta ttaacccctc ggttttacgg gccatcgcac aggtgttgaa ccacgccatc
   132361 tgcctggata ttccgctgca ccaacacctg gatcccatct cgcatcccga aaacagcctc
   132421 gacacgggaa tctatcacca tggccgctcg gtccgcctgc cgttcatgta caagatgaac
   132481 caagaagacg gctacttcat gcaccgccgt ctgcttccca tcttcattat ccccgaggga
   132541 ctccgagatc atcccttgaa cttcgtccga gcccagctgg acgtccgcaa cctgctgcac
   132601 caccatcccc cgcgctaccc gccaggttcc gcgacgaccc caccgcagtc gggcggtggt
   132661 ctccgcgtcg tcctgagcgt ccgagacaag ctgtgcccat ctcccgacat caactttatg
   132721 gaaacgcgct ccgtcaatgt gacgcgatac gagaagcgca gcctctctga cgtaattagc
   132781 taccatttac acggcacggt tggccgtcct ccaagtcaca acgactcaga cgacaccaac
   132841 gacctccaga ggctggtggt cacacgcgtg tggccgctgc tgctggaaca tctgacgcag
   132901 cactacgagg ccaaggtgag cgagcagttc acctcgccgc acacgctgac tttccagccc
   132961 cacgcccccc actgcgtctc cgtgaagcgg ctggacggct cgcgcaccag agacttccgc
   133021 tgcctcaact acacccaccg caaccctcag gagaccgtgc aggtgttcat agatttgcgc
   133081 accgaacata gctacgcgtt gtgggcaagc ctgtggagcc gctgtttcac taagaaatgt
   133141 cactcgaacg ccaagaacgt gcacatttcc gtgaaaatcc ggcctcccaa cagcgatcag
   133201 tgaccgcaaa cgacggagat gcacgtcaca ggcgctcggc ccattcgcat atatacagcg
   133261 tgccgaacac gcagaattca gaacacgcca atcatcacca cccccggtac agcatggacc
   133321 tgcaccagag gcaccgcagc gggccggcgc tgtcgcagct gagcgaccga gaacgccgtg
   133381 ctcggcgggc acggcgtttc tgcctggacg gcgaggatga tctccctcgc tcgttcaagc
   133441 gacccaggta cgagcaacag cagcagccgc cgtcgtcgca gaccacagcg acgacacggc
   133501 acccgagtcc cgctgcgcct ccagtacgcg actcgcccga gtccccgccg ccaggtcctg
   133561 attctggacg ccggtcagcg tctgcgaaat cccactatac caccgtgttc aggcacgcaa
   133621 ccgccgttcg tcagtcgtcg tcacaccatc ggcacagcgc cactgccacc accaccgccg
   133681 ccgctgctgt caatcacagc cacggcgaac gtgtcaccgt ctcgccggcc agcagcagca
   133741 accggcagat gctggcgatc atcaatcatg aacttgacac catggacgac gtgcagttgc
   133801 agcacctgag ccgcatgatt gaaaagaaga aagaggaacg ccagaagctc ggcaagagcg
   133861 gcgaggtgag ggacgatgcg tccgtaccta gttccacctc cccggtgtac gacctgcaga
   133921 ggtacacggc cgaagccctg cacctcactc cctaccccga tgacctcaaa aaacccacgg
   133981 cgttcccaca ggacacgaaa cagccgggcc gcttgctgat ttcgcacgag gaactcatga
   134041 acaccgacta cctgctgaac atccgtcagc agtttgactg gctgtcaccg tctctgctga
   134101 gacgcctggt gatggagaga acgttcgccg tgttcaactc ccccagcctg cacatgctgc
   134161 tggccatgac ggaagaaacg ctgagttaca tcaagtacca ctttgtccac agccttccca
   134221 ttaacccgta cgacccctac atggccaccg tgtcgggcct gcggcagttg ttgttcaaca
   134281 aactcaacaa cctggacctg ccctgcatca tggataacag ccccgaatgg tcgcacaact
   134341 gccacgtcct gaaaacgttg attaaaaagc ccgtccacac agcgaatgat tggcagcgcg
   134401 acgacacgct ggacctgcag aagcaaccgc cggagtcgtt cacaaacccc gttcaccgtg
   134461 ccgtggccta tgtgtgttcc ttcgcacggg ccgtggcggc gctgcggcgt cgcagcaggc
   134521 acatacccaa cgtgccgcac tttctggacc agtatgacga caacggcgcc atggagtctt
   134581 accgctgcgg catggtttcg gaactcattc tccagactct gcaccagcac cagtgtcaga
   134641 acgagatctg cgagatgcgc atccagaaag gcctcagcgc ctaccagttc atgctggcgt
   134701 actgcccgtt cgacaccaaa tgctttctgg acgtcgccgc ttttgatagt actactgctc
   134761 atgatacctc ctcgtcctca ctccagacca tgacaccgtt gccgtcacca gcggtcccca
   134821 tgacgccggc ggccactgct gtccccgtgc caacagagcc gtcgtaccca gaaccagcta
   134881 tcgctccccc tcagtacacg tcagggatct ctccgttgaa tcggaaccga acagtttctg
   134941 agactcagaa cagtgaagta tgttgcgaac ccgtgactgt tcagccccca gccgtgttgg
   135001 cggaacctca gatgcccggg accgcagaca gtgctgcggc tgcgaccgcc gcggacctgc
   135061 tgatgagtga tctgacgggg tttgtagaac accacgagct gcctcagcca caattgacgt
   135121 ggccgcaact ccagagtccg ccactgagcg gcacttcgga gaccggtacg gtgatttgct
   135181 cgcaaacagc gcagccggcc gcggagccgg actggatggc tgccatctct gccctcaaca
   135241 ccctgcccga ctcggctctg agcacgccgc agcagccaca gcagcagcca cccacgtttg
   135301 aactgtttac agactccatc tcgctgcgct gccaaacgcc cgattgcgag gccatgtgct
   135361 acagcgacga tgacgacgag gaggacgatg agggcttttg atggacaggt ggatcagata
   135421 atggacaggt cgggagcggg agacggtgtt ttttctgttg tgtctaaccc aaaagccggt
   135481 cggctggccg gcgcccgtgt cgtacgacaa taaagatatg cacgctgttg cggaatgtga
   135541 acgagcttgg ttttattttg tcttgttact gctattctgg ataagttaca aactgagtgt
   135601 tgtgtgaatg acaggtttga taggtgactg cgcacatggg ggaaaatgag gcagggaagg
   135661 cgagtgagtt tctttcacag cacacttcta ccagataatg ggccgagaac acgaggatga
   135721 agatgaactt acacttgact ataagatgtc tgagtagtat tagtagtaat attcaggaca
   135781 atgagtagta caagcatgac tcaagtgttt cgaaatctcg aatgacagat gaggcacatc
   135841 ataaaaaacg ttgcagggaa aaggcggaaa caacacaggc aacaacacat ttatatttca
   135901 acatgtcata taagacgcag cgtcgccatc gcgcaaaagg gcaacacgat ggcgagacga
   135961 ctggtggttg tacaattgat agatttctat attatcatga tcagtggcca tgacgatgcg
   136021 gatctataag caaaatacta tcatgtctta cttttgacgt ggctaaaaat gctggctttg
   136081 gcccgatatg tttgtttttt aagacagacg atttgttcac acagttaaag cacatgctag
   136141 tggggattgc atcattgcgg tagagagcta tagtcgtttt tctctttttg ctaatcttga
   136201 caagggaggc cagacgccga gacagcgcag gccgcgagaa aaacacacag tagcggccac
   136261 cgcgcgatcc cgacggctga cccgcgcaga gagagcgcac cgcgcgaccg gttgtcgacg
   136321 gctgtggcag tgatatctaa acagaataca caagaacaag tgaatttaca aatatctgtc
   136381 acgatgacgc gcgggggact cccgcatctc cattgagtcg tcattttttc tctagatgag
   136441 cgaatgaacg ttggctcctg gcgtcccgag aagccggcct tcctatgaaa gggctttaaa
   136501 ggttcgtaga cattttactg gtgcagacac attgctacaa atatataata aattgttcaa
   136561 cagttccagt ttttttcgta tcatctttct ttttcacgca gttactataa gtacaagtcc
   136621 gtttcgcttt tttactttgc tttttttact taatgagcca gcttgaaaac ccggccgtat
   136681 ggggggacac acgagtccgg cgttgtaatg atcgccgaac ggaggagtgg atgagtgttt
   136741 ttgttctgta cgtacgtgtc ttctggtaaa agctagatct ctgacggttt tttttgtcgt
   136801 tttagagcgc acatttctca agcagtccct aaaagtccga ccggcggcgc gacctgcccc
   136861 agtcccggtc ccaaaccacc accgttccga cgacagcacc ccgatatatg acagccgaaa
   136921 cgcgatttaa aatctaaacc cacgtcgagc ctggagccgc gcccggcgtc caggtcggac
   136981 ccgacccgcc ggctgtacaa acgccgttcg ggcccgaaat ccaacgtgac gacgctggtt
   137041 gtgacggcga cggtggttgt ggcagtgctg gtgctggttg taggggtggt ggtagtagcg
   137101 gtgccggctt gcgtccagcc ggatcctgcg tggaaacgcc gtggccgcag cggttgcgac
   137161 ggcgattgcg gctgctgtgg cagctgctgc cgccgccggc cgcctccgga gcccgggcga
   137221 ggagctccga acccgggttc ggaccgcggc gggcccgctg gatccctggt tgtcgccccg
   137281 gaaagcgggg tcgcatcggg gctggatgcg accgccgctc cggagccagg gaaccaggcc
   137341 ccgggcaggc tgggccgcga tgccgtcgcc gccgccacca ccacggccgt ggccgggtcg
   137401 ctggatcgta gggccaggcg gagcgcggcc tgcgcgggcc tgggagccga gccggaacgt
   137461 ggttccggag ccgcgtcgcc gccttccagc ggggccatcc tgcggcctag ccggggtgca
   137521 gggcctcggt cccctggtcg ctgccaggcc tccgtggcgc ccggccgggc tcgcaggccg
   137581 cttcccgctg gcggggctcc gcgaccgctc cctaggcgcc gcgcagggcc acgcccacct
   137641 ggaacgatcc aggggggcgg ctcaggcctc gcggggccca tgctcccgga atcgaaagcg
   137701 aaaccgggag ctggaggagg ggggaggtgc cggaggggga gggggtcgcg cctggacgcc
   137761 accccgtccc cccgaccagg ggggaggggg cccgctgggg gaagggatcg cgcctgggcg
   137821 ccagcccatc cccccgggct aggggaggga gagggtgggg gaggggtggg gggagggggt
   137881 gaggtctacc ttttgtaccg gctccgcccc cccaccgagg tggaggcccc agtgggcggg
   137941 gggtgggcgc agtgtgcaag ccgcggctat gcccaggtcg ccactggcga ttgcccggac
   138001 ggcgccgcgg actgcgccac cgagctccgg gtgcgccggc ttataaagac gaaaccggaa
   138061 gttctagaaa gttctactcc gcccagaatt tgcataaaca cgcccatttc ggattgcaaa
   138121 ccggagagcg gtggccgctg ggtaaaaaat tgggggaggg taaatccaat gcaaccctat
   138181 ggagcggtcc ccgcggaggt gtgggggagg ggcgggcacg tagcctcggg cgccgtgtcc
   138241 gctggttgac cccgaattgg gggctgggag cacgcatgtt gggtctgggg tcccccaacc
   138301 accaggacca ccgacccaga atgggagcct ggagtggggg ctgggcacca aaaacaccgt
   138361 ccgattgaaa tgcattgagg tgagggcacc gcatgcgcac atcgcgctac cccacgtccg
   138421 gaacccgcct tccgcggcgt cgatgttcac aatgcgcacg cgcaccaaac cggatccccc
   138481 ccacactggg ggagaggggg gtttgggggg tgaggggttc tagattatca atatcaggtt
   138541 ccctaatcat tagcttttat atatgcactg tcgatgaacg gtctgcatta actagggctg
   138601 agatcatagg tatcctctat gacgtagata cctacgtcat atagaaaggg gcgtggttat
   138661 aacgttacgt catattaaaa ggggtgtgtc tataaccagt aaacaatatg gggtgtggtt
   138721 atgcatatac ggatacgccc ccttttccga cctccatacc tgaaagccta tgggtctata
   138781 caggctagag gtgtgtccgg ttccgtattt acctgaatta attagcgttt gtttatattc
   138841 gtatgttaat tagcgagtgt taattaaccc ttatcaggta tcatattcta atgagcctta
   138901 ccgtaatacc cttaccgtac ctacagtatt cgctacccct gatatacata tgcatatcag
   138961 atgacgtcat atcagtgtag ctacacctag atttacggta ttcgcagtcc ctccctctat
   139021 ccgaaaacct aatgcatatt caaatttgag tatcactgct gattatcata attaataacg
   139081 cgcgcgcgag gcggggcttc gcggtcacgt ggtacaaacg ccgttttcga cgcggatttc
   139141 aacgtttcga tcgaaccttt cggttccgtc gaaccacgtt gttttttgag tcgcacagaa
   139201 aacaccgttt tcgacgcgga tttcaacgtt tcgatcgaac ctttcggctc cgtcgaacca
   139261 cgttgttttt gaaacaccgt tttcgacgcg gatttcaacg tttcgatcgg ccctttcggt
   139321 tctgtcgaac cacgttgttt ttggaacgcg cgtgcggaac ggtgttgcgc ggccgtcgaa
   139381 cggcgatttt gcttgcgcgg acggagaaaa tcacactgcg acggcgcgcg agggggggtg
   139441 aaacctaaaa cacacatgcg ggggctgaga atactcacac tgctttatga attcctaaac
   139501 tgttcggcgt ggaatgtgac actttgccgc gtacgccgac catcgaatat caaaaaccac
   139561 gccgcacaca cgcaggtgta tgaaaaagtg ccgtttttat tgacctgtca atcatcccga
   139621 cgtcgaaagt gacacaaaac gacgtggtac cacgttgtat ttttcggaca ccaggtggcg
   139681 catggacacc atcgggcacc acgctatttt cggaggtgcc tcgacgggac agttctccga
   139741 gccggcggag ggtggcgcgg agcctgtttg ggtcgaaaag cggtccccta accgtggaag
   139801 ggggcggcgc gcggccgaga gtgtgtacat ttccgcgatg gtaggctacg taatgcgtca
   139861 accgtgacgt cttagctcct cctcggtata aagttcactt ggtattagcg tcgttgttac
   139921 acgaccacta tgagcaacga ggaactcagt gctctcgctc ccgtgggccc cgccgcctat
   139981 ctgtacttca cgaagacgaa ccccgagaac aacgaggttt tgagcaccct gtcgctatgc
   140041 gatcgctctt ccaccgtggt gatcgcccct cttttgatgg ggctcaccgt ggatcaagat
   140101 ttctgcacct ccgtccgcac cccggtcgtc tgttacgacg gcggggtgct gaccaaggtg
   140161 acatcctttt gcccgttcgt catgtacttc cataacaccc atgacatagt gagtttctcg
   140221 gagccgcacg gcgacgttca gcggctgtgc gaggaaacgc gccaaaggta cgcggtggaa
   140281 agctacgtgc cggaggatgg acgggtgcca accgacctgg cggctctctg cacggcggcc
   140341 ggctgtgacc cccaagaagt gctggcgcac gttgtagtgg gaaacggcct caaagagttt
   140401 ctgtacgcgg gccaactcat cccgtgtttc gaggaggcgg tgcctactcg actgaatgaa
   140461 tgtgacgcgg tgcgtgtgcc gctataccct cctactctct ttggttctct gcaggcggac
   140521 gccgattcgg acgacctgtc cctggacaaa cgcagtccct tcgtggagtc caggggtttc
   140581 tacgtgcccg cggtaagtga gaccctgttc tactatgttt acacttcgtg gtgccaagct
   140641 ctgcgcttct cggagaccaa ggtgctcatc gaagcggccc tgaagcagtt cgtgcacgac
   140701 agccagcagt ccgtgaagct ggcgccgcac aagaagtact tcggatacac gacgcagaag
   140761 ctgagcagtc tggagaaaga ccacctcatg ctcagcgacg ccgttatctg cgagttggga
   140821 tttagcttcg cctcggtgtt tctggactcg gcctacggga cttcggattc catggtgtat
   140881 tccgaatggc ccgtggtggt gaacgctact gaccacgctg acctcattcg agctctcacc
   140941 gagctcaaac ttcatctctc cacccacatg agtgcactgc ttttcagttg taattctatt
   141001 ttgtatcaga acaggctggt gtacgtgacc tccagcaaaa atgcaagcgg taccggggcc
   141061 agtcaggagg cgttgctcag gtccattcac ttcgccaacg gcctcacggg gctgtgcgag
   141121 gacacttaca acgacgcccg aaagctcata aagagttccg gcaccgtcgt caaggacgag
   141181 cgttacgctc ctcatcacct ggccctgatc tgcggtacgt gtcctcaact gttttcgtct
   141241 tttgtgtggt acctcaatcg agtttctgtt tacaacaccg ggctgaccgg ctcgtccacc
   141301 ctgagtaatc atctcatcgg gtgttcgtcc agtctgtgcg gggcctgcgg cggaacgtgt
   141361 tgtcacacct gttacaacac ggccttcgtg cgagtgcaga ctcgcctgcc tcagattccg
   141421 aggctgccga agaaggaacc ctgcgtcgtg gtgatgcagt cccgctttat gaacgatgtg
   141481 gacacgctgg gcacgtttgg gcgccgctac aacgcggagt ccaaagaagc cagcctggac
   141541 gcgaaagccg acgacggctc cgcgtccacg tcgaaccgca ctgccaattc cagcgtggat
   141601 cgcaccaatc ggctgaaccg catcatagac tactgtaaaa aaatgagact catagattcc
   141661 gtgacggggg aggataccat gactgtgaat agtagggccg attttgtgaa cctggtgtcc
   141721 gcgttgaata agtttgtgga cgacgaagcc atgagcttcg tgtccgaggt gcgtatgaaa
   141781 agcagtcgcg acgaggttac gggagccacg caggctttta acctcgatct aaacccttac
   141841 tccgtggcgt tcaaccccat tctggcgtac gagtattacc gtgttgtgtt ggctatcatc
   141901 caaaacgtgg ctctcatcac ggccacgtca tacattgtgg acaaccctct caccaccagc
   141961 ctggtttccc gctgggtgac tcaacatttc caatccatac acggggcttt ttcaaccacc
   142021 tcttcccgaa agggttttct gtttattagg aacgtgaaat catccaaaaa cgcggaccat
   142081 gaccgcctcc ccgactttaa gctctatgcc cgcggcacgt actccgtggt gtccatggag
   142141 attaagctct ccaggctctc ggtgcccagt ctcctcatgt tcagggtcaa aaaccgtccc
   142201 atctccaagg ccagtaaggg gaccacggct cacgtgtttt ttcgtcgcga acacgtgccc
   142261 aagaaaaacc cggtgaaggg ctgtctgggc tttctgctct acaagtacca cgacaagctc
   142321 tttcccgatt gcggtctctc gtgtttacag ttctggcaga aagtctgcgc taacgcgctg
   142381 cccaagaacg tcaatatcgg ggacatggcc gaatttaaca atttcgttaa gttcgtcatg
   142441 tcagtcaccg ctgattacaa cgagcacgat ttgattgacg tgtcacccga ttgcatgcta
   142501 aactatctcg agaaccgctt tcacaataag ttcctctgtt tctacggttt taaagattac
   142561 attggaacct tacacggcct caccactagg ctcacctatc agaaccatgc ccagtttccc
   142621 tatctgctag gggaaacacc aaatttcgcg tcgccctctg actttgccct gcgctggagg
   142681 gatctcaggg cgaccggtgt gacggcgccg ctggcgtcta cggtcacgcg agagtccctc
   142741 atgcgcacca tttttgagca gcggtccctg gtcacggtga gtttttccat tgagaagtac
   142801 gcgggggtca acagtagtaa ggacatctac cagtttgggc agatcggtta cttttcgggg
   142861 aacggggtgg agcgcagtct gaacacaaac tccatagggg gccaggatta taaattcatg
   142921 cgccagcgct gcattctggc caccaagctc tcggacgtcc tcatcaagcg ctcgcggcgc
   142981 gagaatgtgc tgtttgacga ggacatcatc aaaaaatcgg gtgatggcgg ccctggactc
   143041 ggagaatctg gacgtggatc ccgagctcat ggccgtgtac gagatcctca gtactcggga
   143101 ggagattccc gaacgggacg acgtcctgtt tttcgtggac ggatgtcagg tggtggccga
   143161 ctccctgatg gagaagttta cgcggctgcg ggaaatgggt gtggaggact tttcgctgga
   143221 taacctgcag caggcgttgg acagccggcc agatcccggc ggcgggggcg aggtgcatga
   143281 cctttcggcg ctgtttcccg ccgcggccgg ggaggcggtg gggaactctg tgggcatgaa
   143341 cgcgggcggg ggggagtacg cgttcgacga ggactctggc ctcttgccgg ccaagagggg
   143401 ccgcctgtaa taaacgccgt ggacgccgtt atatattaac gttcggcgtc gcggcagact
   143461 gtggaacgag cgagttattt gtgtgccgtc cctatgtctc tctccgagca catcacggag
   143521 gacgccgtgt gctactcgga cgagcagaac acgggagatg aatttgttgc agaaactgtg
   143581 cgtagtgtgt tccaaatgca acgaatacgc catggaactg gagtgtctaa agtactgcga
   143641 tccgaacgtg ttgctggtgg agtcaagtcc gttcaggagg aacgcactgg ctatcgcgta
   143701 tctgtaccgc aggatctacc cggaggtggt gcggcagaac cgtacgcaga cctcgttgtt
   143761 gagcctgtac ctggagatga ttttgaaggc tctgtacgag gatacggagc tgctggaccg
   143821 cgccctcaag gagtactcca ggaagccgga ccgaatggag tactaccgta ccatcctccg
   143881 cttagaccgg tgcgacaggc atcacacggt ggagctcact ttcacggatc gcgtaaagtt
   143941 cagcgtcagt ctagcaacgc tcaacgatat cgagcgcttc ctctgcaaga tgaactacgt
   144001 gtacgcgatc ctgtcgccgg agagcggcct ggaggtgtgc tcgcagctcc tgcagatgct
   144061 gcgtcgcctg tgcggagtgt ctccggtagc ctgccaagag gcgtacgtcg agggaacgac
   144121 gtgcgcccaa tgctacgagg agctgactat catccccaac cagggccgct cgctgaacaa
   144181 gcgtctccag ggcttgctct gcaaccatat cgtggtccac cggccgtcga gtcagtgcga
   144241 tgtgaatatc cagacggtgg agcaggacct cctggagttg acgcagcgca tccccagcct
   144301 ttctggggtc ctcacggccc tcaaaaacct cttctcttct tcatcggtct accacagcta
   144361 tatccaggag gcggaggagg cgctgaagga gtacaacctg tttacggata taccggcacg
   144421 aatatattcc ttgtcggatt ttacctactg gtcccgtacc tcggaggtta tagtcaagcg
   144481 ggtggggata agtattcagc agctaaacat ctatcaccac ctctgcaggg tgctcatgaa
   144541 caccctcagc aactacctgt acggggagga cgtggaggac attttcgtgg tcggggaaaa
   144601 ggcgctctct cgcgaggagc gtcttttcgt ggggtcggtc tttgccgccc ccagcaggat
   144661 catcgacctc atcacatccc tgagcattca agctttcgag gacaacccgg ttttcaacaa
   144721 gctccacgaa agcaacgaaa tgtataccaa aatcaagtcc ctcctggacg agatcaggcg
   144781 ccccgcggcc gatggggcgg cggtggcggc ggcagaggcg gggggcgggt ccgccattcg
   144841 tgggcaggac ccacagaata tgtccaacaa cagtgacggc gccgccgcgc aggacgaaga
   144901 cgaggacttt ctggattacc tggacgcgcg gacacgggcg cataacgtga cgcgcgaggt
   144961 gaacatacgt aagcgggcct acctacaaaa ggtctccgag gtgggctacg ccaaagtcat
   145021 tcgctgcatc aagtcccagg agagactcac cagcaagctc atagacgtga acctcatcgg
   145081 cacggtctgc ctggacttca tctccagact catgaatggg ttcatttacc gcacccagta
   145141 ccgagaaaac ccagacgtag tggacgtgtc gcaaatgttt agctatgacg aacacctata
   145201 tgtagtgaac aacatcattc acaaaagcct ccctgcagag tcccttcctc tgttaggtca
   145261 acagatctac caactgtgta acggtcccct ttttacgcac tgcaccgatc gttatccttt
   145321 atctcacaac gtagacatgg cgtacgcctg tgataacgcc ggggtgttgc cccacatcaa
   145381 ggacgatctg gtgaagtgcg cggaggggac ggttcaccct agcgagtgga tggtggtcaa
   145441 gtatcagagc ttttttaatt ttagcaactg tagcgatctg aacatgttgc agaaggagat
   145501 gtggaaacac gtccgggaac tggtactttc ggtcgcacta tataacgaaa cctttggaaa
   145561 acagctcacg attgcgtgtt tgcgtgacga gtttgctacc gaagaggatc tcatattgac
   145621 gtacaacaag gagtggccgc ttttgttgcg tcacgaaggc acactttata aatcaaagga
   145681 tctatatctc ctcctgtaca ggcacctcgc caggccggat gaacaacgcg aggtgtttcg
   145741 tgaacccgac agtgcctgcg tgccaactag cgtttctcgg agggtgagag tgtctcggaa
   145801 gcgtccgaga aacgcgtctc tgttgctgga tctggtgcgg gatcaagatg aacaagaact
   145861 ggtcccggct tctctatgtt agcctgtggg cggcttgcgt ggtaagtgtt tcttctggta
   145921 cgaatacgtc caatgcgtct gtggctacat caactcacgc ggcgtcttcg aactctgctt
   145981 cacagttatc gtcgactaca ccaaagccta ccatcaacac gactactgga gctctcatag
   146041 aaaacacaac tctgagaacg catgaagtca tcaaggccaa tatatccaaa ttcccatatc
   146101 gtgtttgttc aatagctaaa ggaacggact ttcttcgatt cgaacaaaac atccagtgtg
   146161 aatcattcaa gcctaccaaa gacgatttcg atgagggcat catggtggtc tacaagcgcg
   146221 acatccgtgc ccacacgttc aaagtgaatg tgtatcagaa ggttttgacg caacgtcaga
   146281 gttactcgta catttatatg aattatatgc tgggacagac tgtggagcgt ctgcctattc
   146341 caatgtggga agtgcattat gtgaacagaa ttaacaggtg ttacaactct gtgaagagac
   146401 atatagcagg ccaatggtac gaagtgtacc ataaagacag ttatgtaaat gaaactatgc
   146461 ttctgctgga agattactcc aatacgcaca gttcgcgctt tgtaaccgtg aaagaacttt
   146521 ggcataaacc tggtagcacg tggctgtata caacaagttc taatgtgaac tgcatggtga
   146581 ctgtaacgac cgccagatca aaatatccat atgattattt tgtaacgtcg tctggtgaag
   146641 tggtggacat ttctcctttt tacaatggaa gcaatggaaa acattttggt gaaaacaggg
   146701 ataaattcca tattatgaag aactattcca tggtgcaata ttacggaagg gagaatgttc
   146761 cactggttgc ccacgatttg gtggctttct ttgaaagagc tgactctatg atgtcttggg
   146821 atgttttgga tgaaggtaac agtacatgtc aattcacttt ctgggaaaag tcggaacgca
   146881 ccattcgctc tgaagctgat gatacttacc atttcacttc taacagcatg acggcaactt
   146941 ttttaacaaa gaaggatccc gtaaatgatt cagattctgc tttggattgc attaaacaac
   147001 aggctgaaaa taaaattgag gaaattttta acgctacata taattctaca tatgtaaaag
   147061 caggcaatgt aactatctat gaaacaactg gtggattgat tgtattttgg ctaccagtaa
   147121 aagaaaaatc aatttgggac atgaaaaaac ttgccgatgg atacgcaaac atgacaaacg
   147181 ctagtacatc ctcacgtact aagcgatcta caagtgacag tacattattg aacaatactg
   147241 aagtaataca caacattgtg tatgcgcaat tgcagttcac ttatgatacc ttgagaaatt
   147301 acattaaccg cgctctgaga caaattgctg aagcctggtg taaagatcaa agaagaacac
   147361 ttgaagtcct taaggaactg agcaaaatca atcctactgc tatgttgtct gccatctatg
   147421 ataaaccagt tgctgctcga tatgctggag acgttataag cttagctaag tgtgttgaag
   147481 ttaaccaaac tacagttcaa gtgctccgtg acatgcatgt aaaggatgac cgtgaacttt
   147541 gttattctcg gcctgtggtg ttgtacagat tttacaacag ttcgcatgtt cagtatggcc
   147601 agctgggaga gaacaacgaa attttgttgg gacgtcatcg tactgaagca tgcgaaattc
   147661 ccagcgtgaa aatttttatt gctggcaaca cttcgtacga atatgtgaat tatctgttta
   147721 agagagaagt ttccttgggt agtattccag tggtggaaac catgatttcc ctggatattg
   147781 atcccttgga aaacacagac tttaaagctt tggaactgta ctccgaggat gaactgcgtg
   147841 ccagcaacgt tttcaatctg gaggagatta tgcaagagtt caacgcttac aagcaacggg
   147901 tcgttcacgt ggaaggaaag gtgttcgaca ccgttcctac atatctcagg ggcctggacg
   147961 acttgatgag cggtcttggt gtagcgggca aagctttggg tgtggccatc ggagccgttg
   148021 gcggtgccgt ggcttccttt gtggagggca tcgttggttt catcaaaaac ccgtttggtt
   148081 ctctgactgt catactcttt ctgcttgctg tattgggtgt tatttatttg atttacatgc
   148141 ggcaaaaacg cgtgtaccag cagcctatcc agcagctttt cccgtatatc gctccaccgc
   148201 ctgcgcctgc taaagagacc ccgcctccac cttcgtacga ggaaagcgtg tatgccagca
   148261 taaaagagaa atcgtcctct tcggttaagg aattcagttc ggaggaggct tttcagatgc
   148321 tgctggctct gcataaactg gacgcagaaa aacgtcaaaa gctaaaggag gaatcagaac
   148381 aggctgcctc gcagagcggc aaggttggcc ttctcgatcg cgttcgcaac cgccgtcgag
   148441 gctacaaacc ggtggaggag aacgagtacg aggtgtgagg aggccttttc ggcagcgaac
   148501 atgttcttca atccttacct gggtggagcc cgaaaatcgc cagcgtgggc tgtcaagcgt
   148561 cctgtgcaga agacgtttct ggagatcgtc cctcgcggtg ctatgtatga tggacaatcc
   148621 gggctgatta agcataaaac gggtcgggcg cccattatgt tttataagaa cattaaacat
   148681 gtgctgagtg atgacatggc gtggccgtgt cctttacctt cgtcgtcgcc accgctggaa
   148741 acgttcttga aacgagcgtc tggacctctc aagtttcaca cttacgacca ggtggatggg
   148801 gtgttgcctc acgatacatc cgagggaata tctcctcggt accgtcatca catcacacca
   148861 tcgggaaacg tgttgcgttt cttcggtgct accgagcagg gacacagtat ctgtgtcaat
   148921 gtgtttggac agaggagcta cttttactgt gagtatcagg atgccgacct gctccgagac
   148981 ctgctggcca gcgcttcgga gttggtgtct gagcccagga tgtcttatgc cttgaccatt
   149041 gtgcaggtca ctaagacatc catctacggg tacggcacgc ggcccgtccc taatttgtac
   149101 caggtgtcca tgagcaactg gaccatggcc aggaagatcg gggagtatct gctggaccag
   149161 ggggtggcgg tgtacgaaat ccgcgtggat cccctgacca ggctggtgat tgacaagaag
   149221 atgacgacct tcgggtggtg ctgcgtgaac cgctttgagt ggcggctcaa gaacaagtct
   149281 tcgacctgcg atctggaaat cgattgcgac gtggccgacc tcatggccat acccgacgac
   149341 gcgtcgtggc ccgtctatcg ctgtctatca ttcgatatcg agtgcatgag tgccagcggc
   149401 gggttccccg cggccgagca agtggacgat atcgtgattc aaatttcgtg tgtgtgttat
   149461 gaaacggggg ggacgggtaa tgaggcgagc acggtgtatg ggacctcggg gatgcacttg
   149521 ttcacgatcg gcgactgtgg gcgggtgggg accgccgacg tgtacgagtt cccctcggag
   149581 tacgagatgt tggtggggtt tctcattttt ttcaggcgct attcgccgtg tttcgtgacc
   149641 ggctacaaca tcaacgcttt tgatttcaag tacattctca cgcggctgga cacggtgtac
   149701 aaaatcagtg ccaatcatta tggcaagttg gcctcgaacg gccgttttca cacatacact
   149761 cctgccaaaa aacaccatgc catcaccgcg gccaccaagg tgttcatttc gggttgtgtg
   149821 gtgattgaca tgtaccccgt gtgtatggcc aagaccaact cgccgaacta caaactcaac
   149881 accatggccg agctgtacct caagcagcaa aaagatgacc tgtcctacaa ggaaatcccc
   149941 gtcaagttca tcgcgggttc cgaggggcgg gcggacgtgg gaaagtactg tatgcaggat
   150001 gccctgctgg tcagggatct tttcaacgtc attaatttcc attacgaggc cggagccatc
   150061 gcgcggctgg ccaagatccc catgcggcgc gtcgtctttg acggacagca gattcgtatc
   150121 tacacgtccc tgttggacga gtgcgcctgc cgggggttca tcttgccgaa ccacaaaggg
   150181 gccgcggcgg cggactcgtc cgacgccccg gaggtctcct cctaccaggg cgcgacggtg
   150241 ttcgaacccg ccatcgggta ctacaatgac cccgtggcgg tgttcgactt cgccagcctg
   150301 tacccgtcaa tcatcatggc ccataacctg tgctattcga cgctcattat gcccgacggc
   150361 gagagtccgc cggagggcca agtgttcacg gtggagctgg agaacggggt gacgcatcgt
   150421 tttgccaaaa gcaccgcgcg tctgtccgtg ctctcggagc tgctcaccaa gtgggtgtcg
   150481 cagcgccgag ccgtgcgcga aaccatgaag ggttgccagg atcccgtgaa gcgcatgctt
   150541 ctggacaagg agcagctggc gctcaaggtc acctgcaacg ccttctatgg tttcaccggg
   150601 gtcatcaacg gcatgatgcc gtgcctgccg atcgccgcca gcatcacgcg catcggtcgc
   150661 gatatgctga cgtccacgtc aaagtttgtg gaagaaaacc tggcggagcc gtgtttgtta
   150721 cacaattttt ttaatcggga ggactactcg ggagatccgg tggaagtcaa ggtgatatat
   150781 ggggacacgg acagcgtgtt cgtgtgctac cgcggcatca ccgccacggc cctcattcac
   150841 cgcggctcca gcctggctga ttacatcaca cagtgtcttt tcatagatcc catcaagctg
   150901 gaattcgaaa aggtctttgt gtccctcatg atgatctgca aaaagcgcta catcggcaaa
   150961 gtggcgggcg agtccacgct tagtatgaaa ggggtggatc tagtgcgaaa gacgtcgtgt
   151021 gagttcgtca agaatgtcac gcgcgatgtc atccagctgc ttttcgacga tcccgaggtg
   151081 tctcgggcgg ccgtccagct gtcccacctc acgttcgaag agctcaagac gcagggcgtt
   151141 ccctcgggtt tctggcgcat cctgcaacgg ctctgtaagg ctcgggacga cctgtacacg
   151201 tcgcgggccc gggtcgagga gttggtgctc tcctctgtcc tgtcgaaaga catttcgctt
   151261 tacaagcagg cgcacctacc gcatatcgcg gtcattaagc ggttggcggc ccgttcggag
   151321 gagctgccga cggtggggga ccgcgtgttc tatgtgctga cggcgcctca cgacggccgg
   151381 acgaccgggg tgtgcaacta cgaaatcgcg gaggacccca cctacgtgcg cgagcacggg
   151441 gtgccgatcc acgcggacaa gtatttcgat caggtggtga aggccgtgac caacgtgctt
   151501 tcccctgtgt ttccgcccgg agccctgaaa aaggacaagt ttctagtagg cattctgccg
   151561 cgtcgcgtgt acctagagtc ctcgttcctg ccgtactgtg tcaaggcgaa cgcgcactgt
   151621 tgacatgaca gagttcattc aggaggtcct tgtagcgctc gaaagactcg ctgacgtcgt
   151681 tcgggatgtc catctcgtcg atcttgcgct gcagcacaga cacgtcgatc ttgacgctgt
   151741 tggcgaccag gttgtggcac accacgctga tgaccacgtg gcctttgatg atatcgaggg
   151801 tgacgtgata gtcgtcgcgc gccgccgaca gcatctgcgc tacgcactcg caggggatgt
   151861 gcacgtcggg gttctcgaag atgatgtgca tgtgcagccg ctcgcgctcg gcgtgcatga
   151921 agggcacgat gtcgtggttg gcggcgtgga tgatgtaata gatctggaag atggacggct
   151981 gattcgtaga cattcgcagc agttcgctgc tcttacagaa cccataataa aaatttctgt
   152041 ttttcataat gttggacgtc tggttaatga acgccaccat ggcgtccgag gcggtgggga
   152101 ggacctggtt ctcgctgcac gacgtgcagg cgatcttgga cacctgctcg tttccgtacg
   152161 gcgagatgtc caggcacgtg tgttggcggt gggattggaa gttgaagggc aggcagatgg
   152221 actctttgcc ggtgatggcc atcttcatca tgttcaggta cttgagctct aggtccgggt
   152281 ggtccttgaa gatgtcgtgc agctcgtgca gcgtcagtcg cggtcggggg gcagaaatgg
   152341 ccgtggcggg attgggtttt ttgttctggg tggtggggga caccaggctg ccgcgtcgcg
   152401 gtcggcgctt gcgggtgaac gagcgcaagg cggagcgccg ttcggtggag cgcacgccgc
   152461 taaacatact tgtcgacgac gaacgactgg tccaccagct taatctcgca agcttccagg
   152521 agctgcgtaa actcgcgcat aaagtccgac agctgagttt tgttcttgta gctgcgtttt
   152581 gtaatctgga aggctttgaa ggtcgtgata tacatccaca cgcgtctggg catctggctt
   152641 atatagtaat tgtcgtgaca aatcaacact tttagttcgg ccaggtgctc cagatgaatc
   152701 ttcccgaaga gaacctcctc gcgagtgatg cggatgttgg ccgcgcactg cggatcgcaa
   152761 aagaaatgct tgtagatgcc ggtcacgccg gcctgtcgca ggatggtgca gaagacgggg
   152821 tcggggcgga cgttgtgcac ggcgagatag tcggtgggga tcgggaggcg cgtgaatcgc
   152881 gacaggtcgt cggactgggg gcccgcgggc accgaacact ctcgcagcat gtcggccagc
   152941 gccagctgga tgcgatccac catcttcacg ttgttttcgc agtacgaggt gatgcgctcg
   153001 tacaagttac gcagcaccag gttgtcgtag tgcgagcagg ccatcagctc gcacagcagg
   153061 cacacggtgg tggtctggtt cttcacttgg aacacgggca cgggggacag gtagatggga
   153121 cctacgtctt tgttaatctc cgggtcgtcg gcgtccgcca cgctgtcgag caggtgatgc
   153181 ttgctctggg tgagctcggt catgggggtg ctggccatca ctccggtgcc cgcccacatg
   153241 taaaagagca ggtacgcgaa gcggtcggga gacggggtgc tgtgttccct gaacgtttgc
   153301 aggagctgct taggggcctc ggggattttg accacgattt tctgcttgtg atggctaaag
   153361 cgccggtgct tcgtgtacgg caccgcctcg tcgcccatca ccagggcttt caccacggcc
   153421 agatggctga gggtgatgtt ttcgttctcc accgcgtctc ccagctgttt ttcgaaacac
   153481 cggttgatga aaaagtgcag atggaagtca aacaccgtca agatgtgctg gcggaagagc
   153541 tggtccacgc gcaggtccgg gaagtactga cgcaggagat gaatcaactc ggacatcgtg
   153601 actagcatgc tgagggcggt gcgcggcgcc gaattgcatt taaagcacag caggctgtag
   153661 tcgagcagcc aggcctggtc gggatcttgc ttcagacaga tgctgatgat ggcgcagagg
   153721 ttgcatcgcg tgtcgatgtc gagcggggtg cacagtctct tgagccgttc cgtgtccgag
   153781 aactcgaagt tggctagttc cgagtcgaga tcgcagaact gcaggccgcc ggggccggtt
   153841 aggtgatcgg tggtttggga ctggctgaag aggaagttgt ggagcgcgcg ggattctccc
   153901 cctccgccac cgccgccacc cgcggcggag gatccggatt gcgacgcgcc ggccatgtcg
   153961 acggctactt gacgagggtg cgcgtgccat agcagttcat ttgtcagttc gtttagcggc
   154021 tgcgtgagct ccgtttccca gccgccgtag atgtagctgc gggacgagag ctgtggttgt
   154081 ggtggctgcg gttgttgctg ctgtggatgt gggtggttca tgtcgccgag tggttggtgt
   154141 cgtctgtagt gatcaagtgc aaggaggtcg cgtgtggtga ggtgtgtggg ggtgggtggt
   154201 aatcaatcaa tcacagagat cgaaaacaat ggcagcgcgc cgggatgggg aggacgtcgt
   154261 ttacgaggac ggcttcctgg accccgacga cggcttcgaa gtcagcttcg agccgatgct
   154321 gccgcgcgtg tacgagctgc tgctgccgtc actggacgcg aggctgaatt tcgtcaacgc
   154381 gggccaaaag tacgcggcgt ttctcaagta tgtgcacggg gagtgttcct cttgtagtca
   154441 tgcgcagatt ctgcaggaaa agacgaaact attaacggcc atcgtcaaca agctcatgga
   154501 cattaacggg attttggagg gaaaagagga atctgcgggt aaataaaacg tgcgccagcg
   154561 cgctcggcgt catggaaatc agcaagggct tgcatcacga cctcgtttcg gccacgcgac
   154621 gcattttgaa actggggccc gccgaactgc gggtcacgga cgcgggactc atctgcaaga
   154681 accccaacta ctccgtgtgt gacgctatgt taaagaccga cacggtttat tgcgtggagt
   154741 atctgttgag ctattgggaa agtcgcactg atcacgtgcc ctgcttcatt tttaaaaaca
   154801 ccggctgcgc tgtttctctg tgctgtttcg tccgagcgcc gttgaaactg ctctcgtctc
   154861 gacacgtcgg cgagttcaac gtgctcaagg tgaacgagtc gctcatcgtc accctgaagg
   154921 acatcgagga cattaagccc tcggcctacg gggtgctcac taagtgcgtg gtacgcaagt
   154981 ccaactcgcc ctcggtcttc aacatcgaac tcatcgcctt tggcccggag aacgagaccg
   155041 agtacgagaa cctcatcaag gaactctgcg ccaagaaggc ggcagccgcg ggcggtgccg
   155101 ttctccgaac cagcaggctg gttcactcgc gataccagag cagcagcggc ggccacaagc
   155161 ggctgcactc accgcgaatg acgatcgcgc cgccgtttcc accggccacg ccgcctccac
   155221 ctcctccggg tggcttctat ggcgtgtgtc gctgccgaac ctccgaccac gggtgctgta
   155281 gcgctcggcg ggaggaggag cagcagcagt tacagcagcc gcgctacggg gcggtggcca
   155341 gggggagcaa tagctcgttc gcgcaggtgc gtctaggcgt gacgcgcctg gtggacgtgc
   155401 gctggcttct aatcggcgtg gcgatgggaa ttgtcttctt cctgctgtat cgctatgtcc
   155461 agtgactttc accgcgcgct ccggcggctg ttcgttcccc tctgcgtgca cgatgagcac
   155521 ttccacgtgc agatggtgat cgggcgcggc gcctggcacg ccgacgagcg ggtctgcgcc
   155581 ctgcagctct ttgttaccga caagcgcttt ctcaaccgcg aactcgggga ccgtctgtac
   155641 cagcgctttc tgcacgaatg gctagcctgc gagcccgggg aacgagaggc ggtgaccacg
   155701 ctgtttcagc gcatggtcat gacgaagccc tacttcatgt tcctggccta cgtgtacggc
   155761 atgagctgct ttcacggagt ttcccgggta gtgtcttttc tgcgtttcga gcgctacgat
   155821 gctcactttg tgtatgtgcg cctgcaacag tacccggtgg aaaagctgag cgcgctcttg
   155881 gatggcatga cctcgtctgc cctgggcgat ctgcatcgct ttctcttcgg ggtggatctg
   155941 cgacttcccg tgctcaacca gacgagctcg ccctgcctct ctctcttgcg tgccaaaagg
   156001 ttcgacggcc gcaatgacct ggctgtctat catcgcaacc agtggacgcg gcgcggcaaa
   156061 ccgcgctccg ctcagctcgg gttgctggtg gcggcgttgc gccgtcacgc cggacccgtg
   156121 ccgtgtggaa atcccctgta cgtgatggct cgccaggcca tgcagatgtt ttgtgacacg
   156181 tgtccgcgct acctagtgcc cttgcgcgcg ctgggactga acgacgaaat ccgcgcctac
   156241 aagcagccgc ggcccctgga gcccaccaag atcgtcatgt acggactggc ggcggcgttg
   156301 cgcgggggac tgattggcag cgtcctcgag cttccgctct ggtgcatgtg tcgcctgaag
   156361 tgcgagcgcc acctagacga caggtcgctc atcgccgtgg tgtgtcgcca ctgcggccac
   156421 tgcctgaacc tgggcaagga gaagctgcac tgcgagcaga attttcctct gaactccatg
   156481 ttctattata gagaccgcca agaaaagagt gtgattttca acaccaacgc cgaactggtg
   156541 cactgttccc tttgcggaag tcagcgtgtc attaaagagc gtgtttatga gatcgtgtcc
   156601 gaaaccattt gtgggcatcg ttgcttgcgg gttggttgga aggcggttct ggggctcaac
   156661 gccgcctgcg cggtctatga ccacgtcgtg acgttcgaca tcattctgcc gtgcgccgcg
   156721 cggacctgcg attccaccgt ggtggtgcgc tccgtcacca tcccgcggct gttcaagctc
   156781 acgagtcacg gcaacgggcc ggtgtgctcg cgctgccaaa cgggcgagta ccgcgacagc
   156841 tgtctggaac tcgaggattg cgagtcgctg tgcaggggct gcgccttggt gaagcagacg
   156901 gcctgtcacg gcagtcacca ccatgtctag ctccagcaac acgggcgccg ccgccaagaa
   156961 agatgaagag aagcgacgtc acgtctgcct caatgtgctg gatctgccac aggagtcgat
   157021 ggaacacccc gtggtcggca ccatgttgac caagtacgtc cgcatgtcca gcttcttcac
   157081 agacaagagc gcttttaagc tggatctact gcgcatgttg gcagtggcca gaactcgccg
   157141 ctagcgggcc gcttctcctt ggttgtacac ttccacgctt tgatccgcga ttacagcaga
   157201 tagaggaagc gcaggcggtt aatggtttcg ttgaccgatc tcgccatgga tcgcaaatcg
   157261 acgcgcacgg atctcaggat ttgaatggca tttatcacgt tttgagttag ggtggtgatg
   157321 gggggatttt ggaagctgga ggtggcggcg gcgggagaaa cagtaatgac atcttccctg
   157381 cggacgatgg tctgcacggc cgattgttgg aacaccggtt ccacgaacgt gcgcgtggag
   157441 ggaagcgatt gttgttcctc ttccgagggt cgtctctctt ccaacgccgc tagtacctct
   157501 tcttcatcct cggatgtggt gacttcctcc tctgtcacgt cggagacgtc cgcagccgcc
   157561 gccaacgagc tcgtgggtct actgacccgc gcctcctgag gaacggcggc ggatgcctga
   157621 gccaccgttt tcttcttgga aacggctttg aggattttcc tgtccttgcc gccgcctctg
   157681 ctcacgtttc cactaccgct accgcgacct ctagggcgcg tgactggtgg tggatcttcc
   157741 cgaagaaaat cggtattaat gggaacacgg tcgaaagaca cgagatcgga ctcggggaca
   157801 tcgaccagtg gcagggtggg gaacgggttt tccactacga tacgagacgt gtctcgttcg
   157861 ctgctggtgg ggggacgcac caccgagtgt acggttctgt cgttggagtt gtaaatgatt
   157921 aaaggaataa agtctaactc catgggggtt ctcagactct ctcgaatgcg ttgaatttgt
   157981 gcctgaaacc agcattgctc gagcggggtg ttggtccacg tctgtgtcac catatggttc
   158041 agattcagat ctttggcccg ttgcacgtgc ataaagtctg ggtcgcggtt ggtgtattcg
   158101 atgtgacgag ccagcagcag tcggttgcca ccgaggattt cggacacgta gatggcgcaa
   158161 cacaccggaa tgccgaacac ccagctccct aagacgtagt cgatggcggt gtcggtctca
   158221 ataaaaacat caagcagagt cttgtcggtg tagtctttgc gtcgaacacc aacggtctgt
   158281 gtgatgggct cgcccgtggc caggtggctc tgggcgttgg attcccgggt gatatcgtac
   158341 tggtgggtga acatcacaaa gagagtctga aagaagtcaa acagcgtggc gaactcctcg
   158401 gcgaacttgg gcctcagttc cagccacaga cactgtaaca ggtcttgagg gaaaatgacg
   158461 atagctacgc cgtattgcca cagcttctgg gctccgttct tacgaggacc gacatcgcac
   158521 aactgacgca cgaggttctg gtcccacata acgcgactca gattgacaga cggccatgtt
   158581 ttggggttga tgcagaagcc tttcatctcg tccgcgttgt acgcgggtgg catctgaacc
   158641 acgttgttaa tggcctcgtg catgatgtct ttcttcaggt gccgcgctag cgaggacagg
   158701 gtggtttgga tggggtgttt cacgataccg tagatgtatt ccgggtacac cgtggtgata
   158761 gcgatacaca gatcctcgat gttcatgcga atcacggggc cgttgtaatc ttgcaacgtc
   158821 atatccagtt gcagattcca ggccgagacc acgatataaa tgaagatttt caggttcacc
   158881 agactgttcg tttctcctag gcctatcatt gcctgaccgg agaggagcgg tttcagatcg
   158941 tactgggata tctgggacca gaaagttttc agggtctgag ccactgccac gttcaccatc
   159001 accactttgt atctgcccgt caccacattt ttcgtctggg caaacttttt agccaggtgt
   159061 ttgtcatcgt ggtgtagtgc caggtacttg aaaaacacgt ttccataact catgatcaga
   159121 tggaggggaa cccccgttct ggtcatgaat tgatgaagac cgaacacgtc caccacttca
   159181 tacaccgtgt cgttcttttt actgaaggcc aggcgcttta ggcggtccat tgctgccctc
   159241 ttgtggtcga ggtcggtcga tggcagcacg gccggaatgt catctatgcg ctggcaaacc
   159301 agcggctggc ggttgataca ctctgtgaga tattggtagc ctgccaatac gtatctttct
   159361 agggcctcta ggcctctcac gaacgaaacg ggggacgtgt tcgccgtgtc tcccgacagg
   159421 agagccatgg gaaggggcac ttgttcggag gcgtttagat gctgctgctt aatgagatcg
   159481 ttgaagcgca ttttcaagtc gcgaatcttt tgtaatggcg tcgaaaagtc cagactgtaa
   159541 ccaaaggcct ggatcgcggt caacaaatta tagtactctg tggtcagggt gtcctgcagc
   159601 tccacatcgg atagcgattg cttcgcgcga agcagcaatt cctgaacttt tttgtaacgg
   159661 gcctctcctc cggcgacgcg tttggcctct agagtcgccc acacactttc tatggtttca
   159721 ataacttcgc gatccgcggc cgaggaagcc gagtcgtgtt gcgccacaaa gttttcgcac
   159781 gaagcgttgt tattcacgtg tacggacaca acgtctagtc tgctctgagc ctgctgcatt
   159841 agtgtgggaa agtttggcag ctgtgcgtaa caggggtgcc ctaagttgcc ttcgatctgg
   159901 gtatatgctt cacgcaaaaa caatagacac cactgtaacg ttttcttggc ctccagatac
   159961 ggcatctgtg tggaagcctt ggctagcaat tgtgtgattg cacctacggg gtcttgaatc
   160021 agaaccttgg cgtctggagt ggtaatctcc atggcatcca ttttcaggcg tgtgaccaga
   160081 tcgccccatt gctccgacag ggaggttagt ttggcctgtc ggagctcatt ttcagatttc
   160141 agtttggtgt ttgttaactc cgtttcgtct ttgatgattt ttttatacgc gtccagctgc
   160201 tggtccagca cgtcctggaa gaccggtcgt tggaagggcc ctgctgactc agtttccagt
   160261 ttatcctcga ggtttttgcc taccgtcaga gtctgaggcg tgatgcgcgc ggtgggctgg
   160321 tgcagcgttt gctgcgccat agcggactgt tggtacagtt ccattctggt ctgtgtcaat
   160381 tgcagttcca gttgtttctg agcattcctg tagcgtttgt aatcttcagc gtaatcggtg
   160441 tcgaaaaaca ccgtggtcgg atctcggagt tgacactttt caatgaacat ggatcgtcgc
   160501 accaggccgg acagggcgcg gatcgtctct tgtgacagtt gggactccat catcatccac
   160561 acgtggttca gcgcttggcg catcgttctg gcctcttcct gatactgtag gtaatgtgta
   160621 tcctggccag ttagcagatc ccggatacat aaggagactc gctcttccat cagtttcatc
   160681 agagtggaca gtgaggccag caggttgcgg ttgaactttt ccaatatgtc acgaccgtcc
   160741 gctccaagtg agttaatcac atcctggatc gactccagtt tgagggttgg aatgactgac
   160801 agggtttggg cttttacagc gtcagtaata cgagcgagct ccgaggcgac catgccctgc
   160861 tgttctttga tgatggtttt cctgtcctcc tcttgtttct tggcctcttg ttccaggaaa
   160921 gcctgtagtt tggcttgaag ttcgggtcgt gcgagctccg cggcggtggg actaggggcc
   160981 gtctgaagga attgctgcac catctccact gaagtgactg taagcttctt agcttcttgt
   161041 agccacgcgg cctccgcctg ttgcttgtgt ttgtcctgca attccatctt taggttctcg
   161101 tacagtaacg ggagcgttgt tttgcctacc tgtaggttca tgagatggct aagcaaggta
   161161 ctgttggaca caaagtattg tacgagttcg gtgagtatct ccattcgttt gtctcggggc
   161221 gctttggtca aggcttccag ttgtttagcc agctgacaca gggcggcgtt ggcggtgtgg
   161281 agctctttca cgacggctga tgtattgggt agctgattga tgagtgaatt catgatatca
   161341 aacacctggg ctttcgggaa tgttttttca gatagacgat ccagcagatc attgaagatg
   161401 tcgagaatct tttgaatgta ctgttcgtgc aggccgtcgt cctcgcgcag cagtggttgg
   161461 aggcgccctt gcctcttgag cgcttggtcg tttggtaagt tgtcgtagct gagttcgtag
   161521 acgaataatc tggccgcctg ttcttcctga tagagggact gtagtgtttt ctgtaccgcg
   161581 tccaagcggc cggctatgtc tgcgatctcg gcgcctccga gctgtcggag ctcgttcagt
   161641 tgttcctgga ccagagccat agcgatgttg gagttgcggg ccacgggatc ttggacagca
   161701 gtttcgatac caaccatcag gtcgtgaatt ttgctttcgg tgtcttcctt caactgagtg
   161761 gcgaacagga actgcgaacg gagctgcatc agttcgtcgg agaaggacat tgagttggca
   161821 gaggtgtgtc cggtaatcag gtaactcaat tgctcgttca tgtctctgaa tggcgtggac
   161881 agattcacgt cgcacagatt aaggccggcc atctcgtggg ccaggttggc ggcctgattc
   161941 agtcgttttt gcatggcttg gatttcttcc acgggaaggg agccgctaat gatttgattg
   162001 tatcttttgt gtaggagcgc gctcacctgg cgtttgagat cgtccagtag ctcggttatt
   162061 tttgtgtttc cccgttgtaa caaggttgtt cgcgcttgac tatcgagcgt agccagcatc
   162121 tgttttgtgt ctttgttgtc gaaagatgtt ctttctaggt cgtggctgtc gattccgtag
   162181 atggcggctg acagttgctg cagcgctagc tgtacctgtt cctgttgctg attggtgagc
   162241 tgtcgtctgc tgttgaccgc gttggacacg gccgacaagt cctgctgtcg aagacaaacg
   162301 aacgtctcgt cgacgtccaa tgggttctgt tctgcatatt ccatgagccg catgggaagg
   162361 tgtgtatatt ttgttttttc gatggctttg agaatgtttt tcacccacgt aagcacctta
   162421 ggtccgtgaa tggaaccata atgttggaaa atggcacgca gtttgtctag catggcgcgt
   162481 tgtaacggtg tgaggtgtga gggtgcgaaa tttttcatgg tgttgtacac gtctatgatg
   162541 tgtagttggt ggtgtagcaa catgtttagg aatcgatcga tgtcttctga gaagccccgg
   162601 aggagacgta cttgctgata cattggtgag gatgttcgcc agcggatgtg aaggcagcac
   162661 gtgtgttcta tgtggctcat gacgatttgc tccattctgt ccgtaaggaa cgcttcatcg
   162721 aaaggcaatc cagaatggga gaacaaaatc catcccgatg tggctggagc tttgagggtc
   162781 acgttttgaa tctcatgttc ggcttgtgta attaatcgat tgtacctagt gagggctgtc
   162841 aaggcgtcgc tacagtcgta aggagcggtc gtagtgacgc gtgacgaacc cttgtctttg
   162901 gctgctgtag ctttcttctt cccaccgtgg gacacgttcg gtgtggcttt tctcttctct
   162961 ggggttttct taggtgtagc ggtgtctggt ggcgggaggc tcgggaggat ggtcacgggc
   163021 gagccgggta gtgctggcag aacggacgca ggtagggcaa tgtcggggtc gcggaacagc
   163081 gagatgataa tgccgttaat ctctgattcc ggtacctgtt gaatggacag atctatcatg
   163141 tacacgaaca gagcgtcgta gtaaaagtcg gccagacgcg ttccgaaata ggtgagcagc
   163201 atcaccacat cgtagagcga atcacactga tacaccgcgg cattggaaga acgctcggta
   163261 gcgtgcgggt cgaagacgaa gatgtcatgt tccaggagaa ttaccgcgcg tgctagtgcg
   163321 ttcacggtca ccaggatgta cgtgggtctg ggtttttggt aggcgtgcat gagaaagtcg
   163381 aagatgccat agcacgtgta gccgtccagg tcccgagtct ccgcggtacc gttgaacggc
   163441 ctcgagaggg cgtgggccgt tttgccgaag ctgctggtaa tgatgttagg aatatcttcg
   163501 cccaatcgaa acacgggcag ccgttctccc ggccgttttg tcttcagaag cgcttccacc
   163561 tcgctgtcca gacgcgcgcc ttcggtcaaa atcaagtcta gagtgtctgt gttgagcgtg
   163621 gtgtgcgcgc ccttcaggtg aagggcgtgc aggtacagaa aacagttgga gacgcattga
   163681 cttcccgctc gcggaccgaa tcggctgtgg gtttggtcgg atcgtgcttg atagattttc
   163741 atgtttcagg ctcgcgtggc gatcacgcat gccggccttc ggggtggatc gaagttaaga
   163801 tgtccatctg cgcctgatct tttgacgtaa tataccagtt taataggtcg tttgtctggt
   163861 tcgacggttg gtagcggttt gttaacacat cgggtatggg gatctgttgt tgactatccg
   163921 tgagagggct catctgcagc gggctgtgtt ccacgtttcc ttcgcgaaac gctctgagga
   163981 aggcgcgtag cttggattcc gcgttgctcg gtatgtgttc cagagccgac ggagggatgg
   164041 ccgccattcc ttgatgcgtg cggagcagac ctcgggcctc ggcgatgcag tagcgtatgc
   164101 cgtggtcctg gatgttgctg ttgctgaggg ccgtgcaggt cttttccaca cgtttcagag
   164161 agttcacgat cagtctattg gactttttgg cttgctccag aatcgtcagc agacgttgtt
   164221 ctaggttttt cagagttcgg gtggtttttt tcagggactt tatcatgtct accgctaggg
   164281 ggtgagtttt ggagtactca ttaagctggg tgaaatcttc cttgatttgt ttcattcgct
   164341 gattaacgta ctgtaaccgt tcttcaattc tctgtaaatt ctccgttaac ctctgatcct
   164401 ttgtgatcag agccttggtg agttccagaa actgggtcat gggtattttc gcaatgagtt
   164461 tcgattgtaa actcagttct acggtaacca tgtctgggga cagttgtccc gtagtgtgtg
   164521 cgaaacagta acacagatgc gtatgctcta gatagttggc aatactcgcg ctattgtttt
   164581 gcattacctc ttccagtagg gggtttactg tgttttccaa gttgtgtgac agtgattggg
   164641 ccatgagctc tactaacagg tctagttctg gggacacggg ctcgccgcat aggttttcca
   164701 gtatggcgga aatttccagg gttaggctgt acacggtgcg aaacacgccc gcgtcgatct
   164761 ctgacacaaa ggtgattagg ttgtacagag acactagctt gttgtataac gtcatctgat
   164821 ccggtgccaa aagacggcac gcgtgaatga gcctcagcag acgaggggac ccgatgctaa
   164881 tgaactgatt atacgggata gtcaggattt gtaaaaactc tggcacgatc acaaggttca
   164941 tgaacgtgtc cagaaaatta gggtgatgga tgaggggcag tagtgattcg tagggtacac
   165001 tcgtctcgga caggttaatc atggcacaac gtttaatgac atccgcggtg gtaacgtcct
   165061 ctaggggtgg tgactgtgca tcggggatga ggagttgcgg ttttaacaca aacaaaatgt
   165121 caccccattt ggtaatcaag tctcggtaca ggtaatcctt ctccgcttct gtggttcctt
   165181 gtgtacacac gttaaactcc tcttcggtga acatcacatt gaaatcttgg tagatattac
   165241 gggtgacatt gtcccagata aattggagtt cgtgacggga tccgatcagt gtggatttct
   165301 gctgttctaa aatcatcttc cgccgatgta aaaataaaaa cgtgggactg tacacccaga
   165361 gacacatgaa aaacacgtag gtgttgtaaa tcatgatgag tagctgttgt cgaatctcaa
   165421 accacatctc tcccccttgt ttgggtgcaa tacggctggg ttggagaagt gccatctggg
   165481 cgtatatctt tgaagtctct cggttcagac ctagagccgt gaacgtacga atgcgtgtca
   165541 tgaggtcccg tagtttcatg ggtttgtgtg ctgcggcgcg gaaaaactcg ttggtcatat
   165601 gagtgcacat ctgcgatacg aggtctaaac gagtgacttc gctggtgctc agtttagatt
   165661 cgtcactcag gagtctaaaa atgagacctt ggtgaaaaaa aacgttctct actcccatgt
   165721 ggttcaggac ggggagcgag gttaacaaga tgggaaatgc cagacctgtt gtgtcgcggt
   165781 cgttgaggtt ggcattgaaa atcttaaaac taaaatcttt aatgtgctcc gctcctatct
   165841 gctggtctcc gtccgcttcg gagaccataa aggctgcgag atttcgcttt tcgctagtta
   165901 caaacgtttg aaattcgtta ttgagatcgt tgttgacaga tttgtagtat ctgtaaaagt
   165961 aattcatttt gagcataatg tcgagttcac cgtcgtttgg atttgcgaat gcatggtatt
   166021 gcatcaacgc gctagcccat tgcagtgtgc tgtgatacag aatatccaac agttccgcaa
   166081 tcagccgaca gttgctgtag ggtcgtgtct cttctgtgat ggtttcgatc tgtgtaaaca
   166141 cgttccgcac gaggtattgc gtgccattat cactgaggtc tcgctgcgac tttttggttt
   166201 tacgatccgg tagagtggcg gctagaaact gattggtgtt aaacgacgtt tgcagttctt
   166261 gcaccttttc gaggaatttt ttgaagctcg agagcgtggc ctggttgttc aggatctcgc
   166321 atggactggt gacgttcttt ctttgagtgt gtttctgtaa ttctttgtaa aggtcttcag
   166381 ccgcggctag ggggtcacga gcggttcgca acgtggtgtg actcagcagg tagtagacgg
   166441 cattttggcg aataaatgga aagtgataac cgtccttcgg taaaagttgc aggaactgtt
   166501 gtattatagt ggcgttgatg gtctcaacat cgatcgcgcc gatctctatt tggcttaagg
   166561 tatttaatac ggtctgatta tccgttgaat tctgtttcag ctcgcttagg aacgtctgaa
   166621 agtgtatcgt gcgtttcctc atcatggatg ttcgcgaggt cgccaagcga ccgagggacc
   166681 cgaacgacga agataacgaa ctcgtcctcg ctactaagct caagagagaa gtaaatacac
   166741 tagcggtgca ttacctgtac gaggccgatc atcaggccat cacgtcacgg ttctttgtac
   166801 cggagggctt ggtggagttt gaagtgcacc cgggttcgct catgtttcgc atggtcaccg
   166861 gcgcggagtc accgcggtac ttgtacatca gtatgtatct gctggccatc aaggcctcca
   166921 acgtgtctgt ggctgctcgg tgtcagttgg aaggcatcta cacgtcgggg ccggcgaagg
   166981 ccgctcttac ctggctggac atgggaaaca aactgttgca tcaccgtctg cgcaccatag
   167041 gttgtgtgaa atcggtgtcg ctgggcatta cgtcgttatt gacctgcgtg atgcagggct
   167101 atgtttacaa tacgttgaaa acacagatct tttcgttgtc catcccgaag gacatgtaca
   167161 tgactttgga ggaaacccac gagagactgc aaaatgtgta tttaattatt gtgtacgacc
   167221 acgagccttt ggaaactaag gctgcgattt atgtggccac gtccagcatc tcgaatcgcc
   167281 atacgttaac ggacgtggtg cggcaaaaat tcactcgaga gcgttgtagt tttgtcagca
   167341 ggcgaatcac taggccacga cacattcctt tatgtactgg ggtgattcag agacttggct
   167401 ggtgtctgaa tgacgatatt cacgcctcgg tggtaaccca ccaagaggtg aaactatcga
   167461 cgttccgtct ggataacttc aacgtggagt tgggcgagtt tctggagttt gtgtaaccta
   167521 gccatcgtcg ttgggtggtg ctgttctcat ggctcgcgca tctcataaaa acggtatcgg
   167581 agggctcgaa gcgattatgg aggaggaatc tgagggctcg gacgacaacg gggaggctat
   167641 ggatacgaca gtttcttcaa caacaggaga ggataaaaac cgcccgccgt ccagggcgag
   167701 taacgcgacc accaccacta cctcccgctg gtccacaggc gatgagggga cgctgaagcc
   167761 cggaggttcg tgttcgttgg cggtgcacat gccagggatg aattccgtgc agctcctgat
   167821 gggcaagaaa tgccactgtc acggccgttg gggcaagttt cggttctgcg gggtgcctga
   167881 ccccgtcaag caagtggatg accgcgctag cacgtggcgc gagatcgatg ttatctcgcg
   167941 ccagcccggc atcaggggcg cgtatcgcct ctttcagatg ctcatgaagt tcggaccggc
   168001 cctgatcaag caagtgcccc gttcggatct cttgatcgga cgcttctacc tcaagatcaa
   168061 ctgggtgcgg gagagtcgaa acgcgatgat gtactcttcc tcgctctgcg aggagtccat
   168121 gcgtgacttt gtcttgcgac attcggacga attgcccaag ctcatggagg agaccaatcg
   168181 ttatctggac ctggcaggct gctgggggtt ttactccgcc atcgtgctgt ccgacaaaat
   168241 ttgtcgtcag atatgtggcc aggatgaatc gctagggggc gcgtttgtca gggtcgccat
   168301 ggggctcacg ttggccatag tcaacagtcc ctgtgccagg gtttaccgct tccacctgga
   168361 ctgtagacac gagggagaag tcttggaggg tgtggtcagg cgcattcgcg acggacacat
   168421 ctccatgtcg cctttctgca tgtcgtctat gggcttcgta gagctgccca aatatgactc
   168481 tttcattgcc tcggacacgt tttctcgtga tatggactgg atcactctgc acaagtggct
   168541 gtacgagaat atgactcgcg gggtgtccgt gtccatcaat gtcactcgac tgaacgtcga
   168601 agccgtcagt gtcatccgct gcatcggtgg tttctgcgac atggttcgcg agagagaggt
   168661 gcacaagccc atggcgcgca tcttcgtgga cacgtgggac gtagcggcgg ttcgagtctt
   168721 gaactttatc ttgaaagaga atgacatctg cggggtgtat tacgcgttta acgtacctgg
   168781 agtgctcatg aagcgctatc gcaccggcga ctctcagtac tctctgtttg ggcgctccgt
   168841 ctctcggaaa ctgtctgagc acggcaacga aatgactttt gagaaggagt atgtgcgtta
   168901 tgagcagtcg actgccaaag tcacggtcaa agccagtgac tttttgcgta acatgctgtt
   168961 ttgttgtctc aaggggaagt gtggcattgt gtttgtgcat aacgtggtga aatattctcc
   169021 gctagtggga gacattcccc ttccgccgtg tttgagccct gacttggcat cgtgccattt
   169081 cgcagactgc gatctgccgg tgcagcgcct gtcaatcaac ctgacacgtt gtttgttcgt
   169141 gcgcagcgac aaggacgcgc tgagcaaaaa agatgtggtt ttgggcaaca ccaggcgtta
   169201 tttcgatctg cagatcctta ggaacctggt aaccgagtct gttatctggg ctaacgcgcg
   169261 tttggacgcc ctgatagcga ccggcgagtg gtcgctagag tcgtccgtgt gtaaattgcg
   169321 gagtttgagt atcggggtgg tgggtttgca cactacgttg atgcgtttgg ggtttaccta
   169381 tttcgcttcc tgggatctca tcgaacgaat ctttgagaat gtgtactttg ccgcgctgcg
   169441 caccagcgtg gatctgtgta aatctggcct gcctccctgt gactggtttg accgtaccat
   169501 ctacaaggac ggcaggttca ttttcgaact gtttcgaaag cctcgactgt cgctttcggt
   169561 gggacagtgg gagaccctgc gggctgacat gcaacagtac gggacacgca atgcgcagtt
   169621 tttagcgctc ggtcccgatg aggaggttgc gtgtctatgg agcgtcaccc cttcggtctg
   169681 ggccgcccgg gaaagagtgt cggaggaaca ccccaccgtg ttgcccgtga gtccgcctaa
   169741 cgacgactgt tattttccga cggtcatgca gaaacgcctc aaagtccccg tcgtcaacta
   169801 cgcttggatc gaacaccagg acgaactcaa gtgtaagaac ccccgggttt cccaagtttc
   169861 cgattgtgtc tttcagcggg cctcggaact ccattccgac gtcgaaatgg ccagtgtcaa
   169921 tatggccatg tacgtggacc agtgtctagg cttgcctttc tattgcgact cctccatgac
   169981 ccccgatgat ctgatgaaga ggatgttgaa atggtaccac ttgcggtgta aggttggagt
   170041 atataagtac tgtgcttcct agatgggact tgtatgctag ggtagagatt cgcagagctg
   170101 tattaaacgc tatcgaaccc tgctgtgtgc tgcaatcgct ccactttcag cgtgcttatt
   170161 ttgcggcgcc gtctgtcgtc tataaaagtc aattatttaa cgcgtttcag cttatttgac
   170221 tcctggttgc ggacgaggac acatctggga gctggcggtg ggtatccata gtgttcgagg
   170281 cgcacctcac gaccggcagg tatggataga aaagcccgtt tacccgagcc gccgacgctg
   170341 gctctgaggc tcaagcctta caagtcggcg attcagcaac tccggtcggt cattcgcact
   170401 ctgaaggaga acaccactgt cactttcctg cctacccccg cgctggtgtt gcaaacggta
   170461 cgcaatcagt tggtgtcgaa aatcacgttc aacagcgctt gcctgtacat taccgacaag
   170521 tcgtttcagc cgaaaaccat caataactgt acgcctatgc tggggaattt catgtatctc
   170581 acgtctagta aggacctaac caaattttac gtgcaagaca tctctgacct gtcggccaaa
   170641 attcacatgt gcgctcccga ttttaacatg gagttcagct ctccctgcgt gcacggccaa
   170701 gacctgatgc gcgagagcga caatgcggcc gtgcacgtgg atttcgatca cgccgtcgtg
   170761 agcgagctca ttaagtggat ctcgcctcat acgcgcgtga aacgcagcgt caagaagacc
   170821 ccctgtccca ccggtacggt gcagattctg gtacattccg cccccccggc catcaagttc
   170881 atcctcagca gcggcagcga actggagttt acggcgaaca cgaaagtcag ctttcatggg
   170941 gtgaaaaaca tgcgcgtgca cgtgcaactg aaaaatctct atcagacgtt gatgaattgc
   171001 gcggtcacca agctgccttg cacggttcgc atcgtcacgg agcacgacac ggtgctgcac
   171061 atcagcagtc acaacggtct cttcgccgtc gacaacttcc tcacggagga gcctttccag
   171121 cgcggcgacc tgagcttcga taagagtttc aaacagcaga gggcggtcgc ggtccctaat
   171181 tcaggctcta tgcacgatga cggctcggga atggatagcg agatgctttc ggaacccgtg
   171241 ggtcgcaagc acgagcggct gtccagccgg aagatgaacg aacacgagca caacgccaag
   171301 gagaaatacg agcagcacaa gattactagc tacctgacgt cgaagggggc tcccaactcc
   171361 ggagagagaa actcggggta cttcaacgac gccaaggaag agagtgacag cgacgagtct
   171421 gtcaatttcg agtttgtacc cagcaacaaa aagcaaaagt gtacctaaaa acatgacgca
   171481 gatgcagatt ttgcggtcgg cacgtcagtt ggcactgaac tatatctgct tcccccggga
   171541 acgggcgcgt ggactgtgtc caacgctgtg tgctgtcaat catcatcatg attgtctccg
   171601 acatggatcg ctatgaaatg cttgcccgtc aagcctttga ctgctccgtg agtagcaaag
   171661 acccgtcagg gcgcttgatg aagtttgttc ggaaagtgaa cggagagacc tttcctatcg
   171721 cttggccagc tggatggtgt tttacctttt gtagtttttt acgacagacc tttttcggcc
   171781 atctcaatat taaagaattg gagaagaaat acctgtgttg tgacaattat ctgctgcctg
   171841 tgggtacggt gagcgacagc gacaagttgg ccagagtccg ccgcgtgctt gtcattctcg
   171901 ttggcgaagg tgggagcgtt ttcgtgcacg acccttgcca tgacagcgtt cacctgatct
   171961 cgcgcaccgg tttgcatgcc ctgaggaccg aaggtctcat caactactgc cctcttcgag
   172021 aaaagtgtgg acctgttcgc tacagtatcg gagaatctgt ggcttttgat ttccagaagg
   172081 accatagttt tatgggactg tttcgtctct gtaagaaata cgaggggaga gagtttgcct
   172141 gggcgtgcaa cgaggatctc atgagcgctc tgatcgtatc ggtgctcgcc tacgaaaatc
   172201 cggcgcatca ggactggata aaaagtactg gctctatcaa cgttctgcag gtgtttctgc
   172261 tgctagcgca gtggaagcag aagtggcgcg aaatcaccat cttcgtgaac cagcagctga
   172321 gagtcttcgg ggtcaatccg gagacggggc gccctgaata cctagccctc aacctgccag
   172381 cgtttttccg agtgggactg cttcgcctgg gaaatcaaca ccagtactgg cgtgattgct
   172441 tcaattccaa gaaagaccgc gacgccgcac ctgcctaccg gcccaccggc tgtcccagag
   172501 agctcttctg tcgcaagctg gtccataaga agggacaccg ctgcgagcag aaaaggggaa
   172561 gctttaaaga ccgctttctc tgtctcggct caaaacatgt cagcgacgaa tgagcagcag
   172621 caacagcagc cgcggcgacc acagcagcag caacagcagc taccacaaca tcagcagccc
   172681 accaatgatg atgcgccccc cagttacgaa gaagctctgg gaatggcaac ggtttcgttc
   172741 actgccatgg gacacggtgc gcccaccttc tcagatgatt ccgcacctcc tccttattgt
   172801 ttggtggtcg gggaagtccc tccgcgccct gataactttc aaatggacat gtcagacttt
   172861 ccacctacct cccaccctcc gattgaagcg tattacgaag atggatggaa atggactgta
   172921 ggggtcttta ttatcgctat attagggatc atcttactcg ctgtcctggt ctccgtgctt
   172981 atgcagatga agagtcgaaa ctgaaatcaa accgaactgt gcttgcattt gcgtcaataa
   173041 cactcataac taccactgca acctgtgtct gtgtcttttt ttgcggggtg atgtgacggt
   173101 tggcacgcac cgctcctctt ttcaacatgc ttatggtgtg gtgtaatggg acttttacgg
   173161 agctcaagga ccagtacttt ttaccctgtc cttggctagt aggagttgcc tgttttgtat
   173221 ttgggttttt cctcatagtc ttttcctgtc tgctgcgagc ggtgtgggac cggagaaagt
   173281 atgctgcctt actgaattcc gaggacgatg aagatgtggt gtgggagaaa aagccggtag
   173341 ggaaagacat tgacttctaa aaatggaaaa caatttgcat gaggggcaga cttggctcaa
   173401 taacttcaga ggacgcggga cgcggtgcca gaaacaactc accatggcgc tgttcgctgt
   173461 agcggtgatg gctcccagga cattgctctt ggtagttggc gtcctcactc tgctgttgac
   173521 cgccactgtc acatcggcga gtcggacaca ggcttttacc aactgttcgg tggtgtatcg
   173581 tggtttgctg tacgtgttga atggcgagaa ccaggacgac ttgactaatg tagccgtcga
   173641 gggacgctac tgcgtgttgg aagctacgct aaacattttg ttaaatgcta ctgctgcgac
   173701 tgcgaaggga tgttcgaact cttcagtctt atccaacatc acgcgctaca caaacctgac
   173761 tgtttatgga cttcaacaaa actggacgat gattgacatg gtctcctgcg ctgaaagcaa
   173821 aggctcacag ctcttcgatt ggattcggca cagcctcgga ctgtaccctg tgctgtctct
   173881 cggcttggaa actttgggac tgtatatttt gtgtactttg gctctcagtg tttttgctgc
   173941 cttttacccc cagatggcgt atgtggataa tgctttgcct aagacaccct tgtatgatac
   174001 tgcccccaat aaaaaaagtt gacatgattt atgtttttga tacgttttta tttctgacgg
   174061 ggaacataca caacggtggg tggtgggaaa ggggaagtta gtaggggatc ggggttattg
   174121 cggttaggct catgattgac acgcgtacac acgtacgcgt tactcacctt gtgcaattca
   174181 acgcggcagg tgtgacgctg gtgagatgaa cgcccgtcat gtccggaacg caaaacctgt
   174241 gtgtatataa gattaccaac cttcaacaga gcacgcagct ttcaccatgc ctgccattcc
   174301 tctccagtac gtcaatactg ctggcgccct aggtctggtg gcctttggct actttagtta
   174361 ccagtggatc gagcgcaaaa gacgcgaagg tcctctgcct cgatggttca gagaatatgt
   174421 gagggaggtg aaacgccaac ggggcgaatt ggaagaagag gaggacgttg ttgctcctgt
   174481 ttctactctg tgtcctgccg acggagtcgt gggcctggtt cgcgaggcgt acgaggctct
   174541 gaagtcaagt ttggcccggc tccagcggcg tcggtgtctg actacttatt agctgcagag
   174601 agttccgctc ggtaagagac gctcgtcgga gccatggctg catgtctaga atatgagcag
   174661 gagcgggaga ggcagcaggc acagctgaac ataggatatc tcgttcaggc ttccatcatg
   174721 ggtcccacgg cgcttagggc tcaagtcaag aagctgatgg cgcgcgagac acgcatccga
   174781 cacgagttcg gtgttaccgt ctgtgtttgc gattgcacct atccgtttct gtgcatcacc
   174841 gtgtccaaaa tcgcgtgcct ggagcgcaac tgcccgcctc tgcagcacgg gctgactatg
   174901 tttggggtga ttgaagcttg ggaggaggct gcccctaggc cttccagaca ggtggtgctg
   174961 ttcatgagtg acaattatga tatattcgct tatgatgccg gcatcctgtt ttacatggca
   175021 cccaccatgt cggacttttg gactgcgccc atcgtctttg agtattggaa cgggattttt
   175081 cccgtggaga tcaggcaccg ggttcggcag tacgccagga ccatagacga cctgattgtc
   175141 atttttcacc aggtgtacca tcagcgggac gtcttggagg ctcgtcgttt gaaaaaccac
   175201 aacagtcctc ggaccttcgc cagattcctc tgcggttatg tgcgcgccct cttggatgcc
   175261 gagagacgtg tccgagaggg aaagataccg gtgccgtttg tagatcggga cagcctgatg
   175321 ctcaacgtga tagctcctcc gacccctaaa caggattcgc cagaacctgg caacacgcca
   175381 ggaaagaaag cactgactcg ccagtgttcg ctccctactt ccaatcctaa gaaaagggct
   175441 gaagccgatc ccgatagtag cgacgaagag attatcgatt taacgatgga aggcgtagat
   175501 gccttgtaaa ttgcactgca tgtatttctg aaccgcactg ttccatgtac atagacacgc
   175561 cctcactgtt tataacgatg tcgctttggt aataaacatg ttttgtgtgt aaacctgcag
   175621 tcgtgtcttt catcttgtgg ggtgatgagc acctaccacc gtgtctggca ggtaatggaa
   175681 caactgggag ggttaaggtg ttttcctgtg tgggtggaat gttcaacgtg tcctgttcaa
   175741 tctgttgttt agatttgcct gggatccgtg gtgttgtgcc tggcggttca tggctggtct
   175801 ctcaagtgtc aatacagcgg cgaagcgaac ggcacgataa cgtgtcggct gaactgtaca
   175861 tacaacggca cggttatcta tcaagggcct tgttcgttgg ctataactaa actgaaactc
   175921 aacgtgacac ttctgaagcg tggccggagt tggcaacaca tgattttgcg aaacggcctg
   175981 gagtattatt tcggtggcaa gattatgcac cgtttgtatt tactgggtag tggattagca
   176041 gctgtgtcat ttacgggtag tttgacatgt gcactaaata cctccaatga gaacgtgact
   176101 catggaaaaa tcatgttgta tggcacgtct tgggggcaac atgtgttgaa cgtgaccagt
   176161 cgttggcgat gggatccaag acgtcagtgg taccacgaaa aagttaacgt ttcagaaacg
   176221 tcggccacta atgtgtctaa gtggcttgac gatcatgtgg gcacggatag atttttcctg
   176281 agtgatgttt gcatgcggtt gtttaaccgt ttgaaaagat tcacaaaatc ggcgaggaat
   176341 gtcaccaatg aaagctacgc agaaaacatc acgtacgaaa gtctgccaga atggcccaca
   176401 ttggccgaaa tcactcagat gttgacaggt gtcaacgctt ttcctcgact tgctttatgt
   176461 gcctggagtg tgttcagcgt ggcctccgtg gtcctcggcg ctgttgtgct gctcagtctc
   176521 ttctgcggaa tcgtggggcg aagccgtcgg cacattcaga acgatcttca cgaaatgcgc
   176581 gttaaacctc cgtataaccg tatggacgtg aagcctaatc ttttttacat taatgagtca
   176641 gctgatttgc aggattaagc ctcaatgtcg catataaata gcgtgcagcg tagcccggtc
   176701 acacttcact gcttctgtct ggagcgctac ttcaacttgc catattcgcc gcaacggtct
   176761 ggtgctattc aacatggaag atatacacga tactctgatg tcttatggct gcgtcgcggt
   176821 gcacgccggt gagcccgaca aactctttga attcctgaat cgggagtgtg gaacccggct
   176881 gcaggtggcg tggcccgaaa atgctcgcct gcagcttcgt cctcgtaatc ttatgggaca
   176941 tttcagttcc aagtattacg acgtgtgtct ggacggtaag tgggaatgcc cgggggaggt
   177001 ggagggtgtg tatgcgctaa cggtgattgt gaaacttttg cacttttttt tccatcccat
   177061 aggaaagtat ctgtgttgca acgaagccat ggaacctttt ggagtgctgg aacttcccaa
   177121 actgtccccg tatcaaatca ttttaatgat tggccgcagc ggtggcattt actgctatga
   177181 agatgtggaa aagtgcgtgt attgtctggc ggaagacatg aaaaccttta tgaaaatggg
   177241 atgtcgccgc tgcgaatacc ttcaggcaga agaggcttat caaagtccgt tgattgaata
   177301 tgatgacatt atgaagcggt tgctaatcac gtttaattgg gaagacaatc agcttcataa
   177361 cattgtgacg gacaatagta acatctatga aattcacgat cccacgggtg acaatataga
   177421 tacccatttc gttctgtggt gtagtgattc tagtgtgcag tttaaagata cctgttgtag
   177481 tgttatgcgg ggtgaaggac acaggtcttt tgaaatcatg gtgagaattg tttctcgcat
   177541 ggtgtgtatg catcagatat ttggggcact aggatgtctt ctagaaaatg gtgaatttct
   177601 ggtgagaatc tacgtcatac tggacaagtt tggcgtgctg tacggtttcg atccagccat
   177661 gaacggtctc taccgcttgg ccgagagtat caaaatgttt acttgcatga tgggtcgaaa
   177721 gagctacagg aattaccggt acgatctcaa acgcactgga attgcgagat tggaaaaagt
   177781 tccttggtgc tgtcacaccg gggagcccgc cgaccccatg aacatgttcc aggaagatga
   177841 tgagccccaa ccgcttcaga aaacgccgga ggaaacatgt aggcgcattt acgaggccat
   177901 caagagtgat gtgcgatacc acgtggatat catgatgcta aacctgcctt ttagccagag
   177961 agtgtggcct cagcaactag aagcccttgc agactcatgc ttgttatcct tgtcctcggt
   178021 gtacgagccg gatgacgtga aggctaaact gctcggcgga atcgccaaca tgagagcctt
   178081 cgagatgcat tacaacggcg ccaatgatga ttcagatcgc gaagatgaca cggttcatgg
   178141 ctatctattt gatgacactg tctgtcggcg ctgtgtgtcc agccgacgtc tctttctatt
   178201 ccgtgtgggt cgcggctttc agcgcgaagc ccgcgcccga gtttcttatg tgtagagtga
   178261 ggcaataaaa tgtgtttttt aatcattttg tacctttgtc atctcaataa acacgcttat
   178321 cccgaatata caaaaatacg tttttattgt ctcatttcaa aatcgtgacc atccctcccc
   178381 ccttacagtc ggttctgcaa atcttcagct agattgtctc ttgggtcctc ctcggaagca
   178441 gacgcagaag cggatgcgga ggtcatgtct ggtccttggc gagaagtgtg cgccggtccc
   178501 cgcgggggtg gagggggacg ccttctacga tgacggtgtt gttgacgggc cacggagtag
   178561 ggcgagaagt gatgcgtgct cagaaaccgc ctctgtctgg gagcttgttc cagtccttca
   178621 cggcgacggg gcgatgagga atgatgagta gaggaggtag atggcgccga ggaagagtcc
   178681 gaagacgacg cctgtgcggt tctcacttcc acgtcggcaa acaagtcgcc gtgatctaca
   178741 ggctggggtt catcgtgtcc cgctgcgact cgctccatgg cttgcgcgaa tcgtctggcg
   178801 gtggtgccgg cttgccggga agcgccttcc atgactaggc tgtacactct ttgtaaatga
   178861 tggacttctg tgtcaaattg tccgttttcc atattgaatc gcgtatatgt catgtgggga
   178921 tatccaaccc accggtctct tgaaatatgc tgactagggc gatccggtat acagaaaaga
   178981 tctggattcc caaaaggatt cctggaaaaa taaaagttct gggaaggggt agctgtgggg
   179041 tcggcttcca gatcaatgcg gtcgccttct tgaaagcgtc tcaatagagt gccttgatcg
   179101 ctcgtggctt cttggttttc agagtccgaa tctgatgggt gaccctctga cacttgcgac
   179161 actctacgta gtaacagaaa gatggaagag tgtaaatacc cagggcagat gtagacatta
   179221 gcgttgtgaa acgttctcat gagattgcac aacccgttca gcgtgggaga gaacacgggg
   179281 tgctggactg tacgcaaaat ctgcaaacct tctaccagac gcacaaactc ttcgcgacat
   179341 tccgggacct gtgtgtacgc aaagtacaag tcgttacaaa gattattgca ttggcttagg
   179401 atccaagctt gtgtcagctg tatctctagt cggtgtcgga actgtaagtg ttgggccgac
   179461 agaatgaaca gtacatcgtt aacgacgtgg tctggtcgtt tcgatcggtg cgtttcagtg
   179521 agtagataga acggtctgtt tctgcgtttt gtgagatcgc taatgttttt actgtacagc
   179581 tgaacggctt cggcgctcgt gaagggtgga ggtaagtaga ggaggttgta cgtggtgagg
   179641 ctttcgtaga gaggctgcac actgggatcg ggacgcacat gacaagcttc cattaacgcg
   179701 cgtatctggg acagacattg tttatagctg ccgaaggtca cgtccctcgc gtctagcagt
   179761 tgagtaatat tgcggtaata gtccatcatg ttgttttggc gacaaattct gtgcaatccc
   179821 cgatacagtc tccgtctgtc ttcgtcaacg ttcacttcgt ctagattcgt ctgaaaatca
   179881 gtcaacagat cttgactgtt actgagatga ttggcacaaa tgcaaatatg aacgattttt
   179941 ttggcaatgt ttttgatttt catgtaaggc gtttttagct gaaaatcgat aagcgtatca
   180001 agtacataag agggcatggg aagtccgtag ttacataatc ccacgtaacc gctgcagctc
   180061 tgggtgagca tgtccactaa catacgtctg ttttcatccg aaaacaggtc tggacgaaag
   180121 ttgaggctgt ggtctacggg cagggccggg atgtgcgggg gcacgctcat ggttgctctt
   180181 tcaaaaacga aaccaaaacc atcttattcg taacgaaaca ttttattatt tcattaaata
   180241 cacggcggga caggtgtgtc ttcagtttcg ttttcactga caggtaaaac ggtgctcgaa
   180301 cagggcagag aaccggccgt ctggttcgtt ttgtcgatct gaaacagcag gcggtaggcc
   180361 tcgctgtggt agcagctctc aaaaatacta tcgacctgaa gtccgctctc caccaggacg
   180421 tgaaggaacc tctgctgtaa gaagttcctt agccggccga tgagacggat cgagcgggcc
   180481 cacatgtgcg gcgtctggtg cagcaggccg acgagcacac tgcagagcgc atggtgctgg
   180541 ttatgatcca agagcgagat gagccggtgg atgttcgttc cgagtgccga gcgttctccg
   180601 cagcgtctgg tcagctcgtc tcgtgtgtac agcaccacta attcgtgatg ctcgcagtag
   180661 tggcggagct gcgccgtgaa aaccagctgg ttaaacaggg tgcagatgtg cgaaatggtg
   180721 gtctggagct gtccgccggt gagcggcggg tcctgcgtgt gaggctgtaa tcgacacttg
   180781 atgttcttgg tcacgttgac gatctccgag gggtccactt gcgttcgagt tcgcttgagc
   180841 tgtactatgc cctgatgaag cttgcgatag tcccggtcgt tgcaaaaaat aaataaatta
   180901 ctgttgcggc gagtgcagcc gaaggttgcc ggcaggttgc gaataagcag cttcttcttg
   180961 ccttccgcgc gaatcgtacc tcggtaagct ttcgacagat tgctggcgac gttgctgttg
   181021 tgcaggtccg cggtctcctc cgtggattcg tcattagaga agtcgcgggt agtaataatg
   181081 atgttcatat ccatggctgt tgcgaatttc gtaccgttga gaaaaagtga ctaacggcgg
   181141 cgttctcaag tggcgtgcgg cagcggccgg cgtttcgtta taatgccgtc tcgccgcccc
   181201 tagcccaagc gattggccgt cgcgtccgct gtaaagtgat cgagtgagtg acaagtacca
   181261 gggtgtgtaa acttatgtac cggagatgcc gcaccgcgtg gttagcggca aatgttcaca
   181321 gttcggggaa atttacgcta gacgtagatt ctggtgagac tgggacagac gcttgctact
   181381 tttcttggct gacaggagat cgggggaggg cctggcaccg aaggacacgc cgcgcctcac
   181441 gttgggtttg ccaggttccg tagcggtggc gtgagtcacc gccgtttgga cttcgtctga
   181501 gctctgggct tgttgccgag ctctgagaaa gctccggcgg ctcatcagct ctccccggaa
   181561 acattggcga actttgcctg caaagtcatt tcccaggaga gcgtatagga tggggttgac
   181621 gaagcagtgc aggttgggaa ctatgcgaga gaatgtgttg atcactcggc gtttagttag
   181681 gtcagggcat tcgagtcccc aaccaatggt tgcgtaagcg ttaaagatca tgattgacac
   181741 atatggggtt tgaatcacaa tgaatgacag aagcagcact ctgacaaatg tcagcgtacg
   181801 ttgctgcttc tgagccgttc tctgaacggt gctgtagaag aacgcgtaga accagatcat
   181861 catgacaact ggcactacgc cccaagccag gacgataaga attttccaaa gcgtaagcac
   181921 gtaaatttca tcgtatgcaa agtgcataat gcaagtattg tgttctgttt cgcctttgcc
   181981 atcggtatga gctacgatgg ttgtatacac gccacctgga gtagcgcaaa tgatgccaat
   182041 accccaagtt agcagtacaa tgaggtaggt attgcggtac gattggcgta gttgggtttt
   182101 gcggtggatg actctgtacc tgtccgccgc gataagtgct accgtggcaa agcccacgct
   182161 gcagctcgaa taatacaata gggagataat tttgcaaaat acggcgttag ccggaagcag
   182221 gtgctgattg ctcaaaataa cgaagggaag aacgattaag gtgaggaaat ttgctgaata
   182281 cagattggtc atataaatta tcggagtaga gtatccatga acgcggttgg ccagcaactg
   182341 ggtgacgagc acgacggcgt tgaggggggt accgaataaa accagtgcgc tgttgatcag
   182401 agcttcgcca gtcttggcgg cgtgcagcga attggttaca ttgcaggtgt tgttgatgtg
   182461 caaaatgctg tggtttccat cctgtgcaaa aacgaaactt atcagtttgt gacacgttac
   182521 tcacctcggc tattaaacta ccccaggtgt tacttaccgt gcggttatga aggatggttt
   182581 ccatgccccg ttctgacgaa taacagaacg ttgaaacagc gtcacgttgc gcgatttcct
   182641 gtatatgtgg tgaagaacca tgggtttaaa gtttattggg ctgtcgccaa agcatgtggc
   182701 gtctatcaac aagtttttag agacattgtc gaaaaggcca aacgtcgatt tagaatgcaa
   182761 cgcaaaaatc ttacgacgat gtggcgagaa aaccttgcat cggcgcagcg tcatcttcaa
   182821 caagcttgtc ctttggttgg cttactatcg tgaattgcgg tatcacgcac ctgacctgtc
   182881 ctcccttttg agtgaatttg aagtgcaagt gagtgaagtg tcacgtcgag cgcacacgta
   182941 tccgtttcga aagccagggg atgcccgttc tcacctgaga actatagaag tcaccagttt
   183001 cggagatgat gcccgtacgg acctccaggt gatacaaagt gcaatggaga gttccaccgc
   183061 cttggcgagg ttgtcagagt gccagtctat gaccgttggt gaggtggctt ttatccaact
   183121 acgtgagaag gacgtcatga tgttggaaga gtctttgcgg gacatatgta acaatatgtt
   183181 tgaaatacga ccggcgcagc tgaacctcga gcggccctgt aacagttcgt tggtgaatgc
   183241 taccaacaag ttggtgtatt tgggtcgggt tattagcatg gtgagaatct gttgggattc
   183301 cttgacggat aagtgcctta ttaacattaa ggatttatgt aaatcactca tgaaagagct
   183361 gaaaacatgc aagtctttcg agtccaatta ttgttctaat atcattaagc acggggttca
   183421 taacggagag actgcggaca tgttgctgga aatgctcatg gaagattttc acatctatga
   183481 agatattttt ccgcggtcct ctacttctgg ggattccata ggtgccctgg agtatgatga
   183541 ccaggaactg cgtatggagt gggaaaagtg gctgaaagga gctcgacgag atgattctcc
   183601 tacgtacgag aaatgggaca ttaagaaacc cacacctaca aaggctgata ggcaaatggc
   183661 gtttagcatg ttatcaccta ccgacgatag caaggctgac ttttgggaaa aacctacaag
   183721 gaccaccgcc gcaccctggg aaaaaccttc gagtggtacc gtcgcacctt gggagaaacc
   183781 tgtatcgact accataccct ggagcaaacc tgcaactagc aatgcaccca gtactagtaa
   183841 acgtgtgact ttctggcctg acgatgagga taaagattgg aaaaatgtcg aatcggacaa
   183901 tgtgaaggtg gatagtttag tggatatcgg cagtggatta gagggcttga agctggattc
   183961 ttctacagaa cacacacctg cgtacaagtt tgagcctccc aagttaacgc agtctactga
   184021 gtacaatcca tttatacaac ccatacgtcc tctggattct acagtgcctc tgtttaagcc
   184081 tgtaacaatg gatacatcgc aactcattga ttggaataat aaagcactcg gctcacaatt
   184141 ggataccaca cctactattg tccctgtcat tcctccggac agtgatctag aaactggtaa
   184201 gagcgctgca tctgacttga gcgacgttga ttttacggat ccgaatagca atttttcgcc
   184261 tgccaaaagg cgtgacccga gtgaaacaga agctagtgat gacgacgacg cgaaaagcga
   184321 agcagccgac ttgttctctg atgacggctc cgatgccgag tctgtagcta gtgttgtttc
   184381 tgtgcaagaa gcacctccat ccaaagctaa acgtaaatta ataacggacg cagtatcgaa
   184441 gattaaacct cagccaaaac ctagacccag tttaggaccg ttccctcctg ttgatccatt
   184501 agccagtata gatgcgagac gcatcctgaa gcctgtggtc aagcctgtgg tgaagcctgc
   184561 ggccgttaaa cctcccatac ccgctaaacc cgtcgtacta aaacctgcca ctcttcaagt
   184621 gccggctacg actattacat cgtccgtgaa gcctcctgtc acggcaccac ccgcatccac
   184681 taaaatccct aaggagagtg gtgtgaaggc gaccgcttcg gcacctattc aattgccggc
   184741 cacgagcgtc aaggaaaagg tggcaaaacc acaaactgtc tcgtccacgc aggtgttaat
   184801 accagctgcg gaaaaatcgc aagctaagat gttagtttca cccgctacta gtccatttaa
   184861 atccgctgat agtagcacaa aaccgatacc gctaccaacc ccatcgccgt caaaagattc
   184921 agacatcagt acccgtgatt ctcaaagcgc tatcagtgcc attatacaaa aaattaaggg
   184981 agatgcacgc gagaatgaag aatgatcatt ctgctcatca gggggaggtt aggaaattgt
   185041 tcgtggggag cttcagatcg ttcaggtaga aggtcgttgt gtcggcgtaa tggactcgcc
   185101 ggaagaccgt gttatggttg tacgcgtaca gattgccgtc ggtctcgttg atctgataca
   185161 acgcggcgat gggggtgccc tgggggatga tcgtggtgtg cagtctggac cacagggtga
   185221 ttttcagcgc ctcggatcgc cacaagcaca tcccagtata gaatgagtct tcgtgcggca
   185281 cgttggcgac cagaaagcaa cggctgccgc tttgcacgta gcgaatgtcc acctcgatcg
   185341 tctgtcgggg gtgttgactg aaactgatgt cgtaaggagc gtggacagtc aagtagaatg
   185401 ggttgggttc gttgaggagc gggctgttga gaccgtcccc gctgaaaaac aagtaggggt
   185461 tgcggttgaa ttgcaggtta cactgctgtt gattttccaa caacaaataa aaggcaaatg
   185521 atcgtggcat gtttctggct gtgagtttat tatccgccac acggtggcag tgggaggtcg
   185581 agatggaacc gatgcactgc ttgtgatgca ggtccaggca cagggtgtcg atgttcaccg
   185641 tgaacagcag tcccatgaac tcatactgca cgttcttgga cgacttccag acttgacttc
   185701 catttaggaa gtcatccggc agggtgccct tgaactgcgc ggtgtaacgc gccatctttt
   185761 tgtggccgtg gtttgtgatc cttttgctcg tccacgtaag ctgttccgcg tggatgatca
   185821 agtggtcacc ttgacgggtc agggtggctc ggccgaacgg gatttcctcg atccaacagt
   185881 aactcacgtg ggtgggcaag gtcagaaagg gcaccccgta cgacggaaac gcgtgcggca
   185941 caaagggtat catggccagt tggctgtaca cgaagccgat gtgctgggga ttggtgaagt
   186001 ttttcgccgt ctcgtcgggg tacaccacca tggaggaaca cagtcctcct ttggtgatga
   186061 tcggctgaaa gatggctgga ctttcgccag tagaacacag gaggaagaac agttcgcgga
   186121 ccatggttcg cgggacgacg atgttgctcc agtcgtgttt gtacacgcct ccctgggtgt
   186181 tgttgtaaac cacggggaat gacatgaaca ggcatccgtg caggtacgag gctttctccg
   186241 ttacacacgg ggccgcgttg tactgctcgg tgagggcgac gaggtacggt tcgtaagctg
   186301 tcaggtggta ggacgagcgg tgcgctttgg cgtgtcgcac gcatcgtccg aagttgtccc
   186361 tgtcggcgtt cttgagggtt tccagccaca gctgcaccac tcgaatgtcg ggcaggcggt
   186421 aatctggctc tgggccaggc gctggcacca ccacaaaggc ttcgggtcgg ggtgccggtg
   186481 gcaacagttg gctcagcaga tcgattttct gcgtggtttg gggaggcgag gcgggtaccg
   186541 ccacggtggt gctgctggcg tcgggacagg cgacggtgga cgttgacgga gccgtggagg
   186601 aagtcgcgga ttggctgttt tcgtctgggc cgacggggct cgacatgtcg ttctctatat
   186661 aagactccgg tttataatac cgaataccct tttaaccccg aaccgctgtc acgcgccgga
   186721 gccacaacgg cggctcggag cgaacagtgg acgcggttct gggaacttcg agtacaatgg
   186781 tgtcttaggc cccagatgaa cgcttctgat gtggaagctt tttgcgagtt ttatagcacc
   186841 ctttccatcc gcgatcgaga agactttgct cgagaggtgg accaggaagt gcagcgtgag
   186901 cgattaggcc agttgcgaca agccagacag aaactcaaat gcgaccgcat ctgtttcgga
   186961 ggctgaagaa gtatggagtc cggaggccac gcatcagaac ggcgacgaca tctggaaagt
   187021 ttgaagcgta tgatgcgagg gcacgccgcc gtgatcgatc tccagcgaat gctcgagtat
   187081 taccacactc tatcctcgga agaccagcct gtgttctgga aaacggctca agaagaagtc
   187141 gaagcggagt taaataaaga cgacatggca gatgatcaaa aagtgtgttg tcgtttgttt
   187201 cgtctctgta ggatgggcta taaatgatag gctacgggct gactcaacgc tcagtcgcgt
   187261 tctgagtttt tcgcggtgcg agtgaaactt ttttcaccgg gggtgtatca tgggcgacgc
   187321 gagtcaaacg cgctcggtgc ggcgaaagag ggcgtccatc cccgagacct tttgctctcg
   187381 cagtctctcg gaactgtgca tgagacgcga tgcggagggg ctcaagcgct acctgttgcg
   187441 cttcgagggt tcttgcgtgt cgttgggatg gcccgcgcag tgcgtgttta tcgtgggcgg
   187501 cctgtactcg ccgtactccg tcacggagat agatctggag cactgtgaga acaatttctt
   187561 tggggagttc aggccgctac agccgctggg gagcgtgtcg cactttgcca acaagtatcc
   187621 cgtgtttttg gatccctctg gggcggtcat cgtgtacgac gccagagagg actgtctgta
   187681 cgaggtcgcc tcggacttga acgacttttt catcataggc atgatacggt gcgataccgt
   187741 gcacgagagc atctgtcggc gcgtgcagcc ggacgtcacc cccttgccgc ccgaagagcg
   187801 ggccgagatg taccagcggt cgcgcaccac cacccgcatg cggtacctgc gctcgtggag
   187861 ctgttttcgc gagctgttgg cctgcgccga caatgaggcc aggagccgtt atgtggaggg
   187921 acaccgcaac gccaaactgg ctctcatctg gccggataat cactatctgc tcatggccaa
   187981 cgctcaggat ctggacgtgt cgcccatcac tctgcgccgt ttgcagaggt acagcactgg
   188041 gcgcgaacct gtgctgctcc tgggaatgat tgacggagaa ggggagaaaa cattctttca
   188101 gcaggtgaaa gtgttttgcg gcgactccgg tgtggtgtac gtgctgttgc tgggtcagga
   188161 gcgcctcacg cgcctggccc gggacctcaa gactttcgtg cgcaccggcc tgtctacgtt
   188221 gatcgatgac tttcgctacg aaaacatcgg gcccgtggat tgccgtacgc tgaacgcggt
   188281 ttatcccgag accaagctgc cgttcaagaa acgcaggtag gggcatgaaa cgatacatgg
   188341 gattctgagt gtgtcacgcc gttgggccac attcattgta ttgctttcac gttccttcca
   188401 gggtcgtcgt ggggaacttt gagccgctca cgtcccttta cctgcgcggt cagcccagat
   188461 tcagcgccct ctggagaggc ctgcgagatg catggatcaa cacgcgcgga cggcctcgac
   188521 agcgccccgg aggcctgcat ctgcagcggt ttgtgcgtgc caacgccggt cgttggctgc
   188581 ctctcaattg gccccccctg cacggcctcc tcttgggcga tgccaactac ttcgggttga
   188641 cgcgcgatcg caggacgtat cagcgtttct cctgctttcg agaagcttcg agactgtact
   188701 ttctgggcat ggtcaccgtc tacgagtgcc tgccacacgc gtcgcagtcg tcggagatct
   188761 gggtgtctaa ccagggccac gtgttttgct acgtgccttc ggaagatcgg gtgtacgtgt
   188821 tggccatctc gttcaacgag ttctttgaga ccggtctgtt cgccgtctgt agctatttcg
   188881 aacgggagta cgtggacaag gtcgtggaga atgcttggta ccagcacact tttactgaca
   188941 tgtacgatct gtctcaagtg ttgcatgacc gcaaggccgt ggttcgtttc tgccagctgc
   189001 acgctggcac caagattcgc ctggggggac ggccggcatg cattttcact ttcggttcgt
   189061 ggaacgtggc cgaggcggac gaggccaacc gctttgtcat cagcattctg gaaaaggcca
   189121 aatatgccgt gattggctgg ctggagcctg ttaacagggc cgtgtttctg gacagcatgg
   189181 gttgtgtgca tgttctgctc tacgggactg tgatgctgaa actggcagag accttacggg
   189241 ggtttatcag acacggctcc ttctggtttc gctgttcgcg ccgtttctgc ttctcccctc
   189301 tgggttccgt cgcgaaaccc gttagcagcc aaagagaaca accctgcgac gtgagcgaat
   189361 acgtgtattc gggtcaaaat ttgctgcagg acaattcagc cgcgtcctaa ggcaaacgtg
   189421 ctcgttcttt tttttccatc tcttggcttt gccccgtgcg cttgggatat atagtcaaac
   189481 tggctctacg catctgcaca gtgcaatcat ggcaacgggt ggcgtgatcg cagaggatct
   189541 ttactccaat ccccgtaccg cgttcgagtt tgtcgaggac tgtcccgacg atgatttctg
   189601 tcacaacttt atgcgcacgt acctcgcgcc cgtgcgcgac cggcgccagg ccgtcctgat
   189661 gggcttgtgc aaagcgccgg gtcctaagaa gaagtccaag gaggagaagc ccaaggagaa
   189721 gcggacgggg gcatctcagc gtcccaaaaa caccagcaat aacaacaaaa gtcccatcgt
   189781 ctacgtccgt cgcagttttc tagccaactc cgctttcgct accgcgcacg gaaagtacaa
   189841 catcaggggc ctctgtctcc aggcagattt ggccgtctgg ggactgctgc gcggcgtctc
   189901 ttcaaggcct gagcccggca acttctgctg gatgaacgtt tctcagtttc ggcgcgtggt
   189961 ggccgctggg ccgtttttgc ccgaaatcag cagaagcgcc aagcgaatcg ctgtcgcggt
   190021 agctacggga cagtatgcag tctgcacgct gctgaattat aaagtctttg gcaccaaaac
   190081 tcattacgtg cgtcagttat gtgtcctcac cgatgaattg tttcgccggc tttccggcac
   190141 catgtgtttg tttcttaacc ccgatgagcg agaattgatt gacaggtgtt cacccgtgtc
   190201 tctctgtaaa aagctttctc tgaactatcg tgcgcaaaaa aatgcggtgt tctttcaccc
   190261 gagatttcat gtcaaagccg aagaagcttt gaaggctctg tatgcgaaat tctgtacttg
   190321 cggcgactgt cacgagtcgc cgttgccaaa tggctcagac gccacggccg cgaccgcaac
   190381 cgagtcgccg cggccgcgac tggaggacgc cgagttgcgc ttactaaact atacgcagtt
   190441 gggaaaattc catcttccgg ccattcgtca tctgacagcg tccgaacaat tgcgtgtgca
   190501 acagagtgtg gctcgagact tgggtttcgc ggactggtca aacaccctag tggatgactt
   190561 ctttctgtta cccgtgggca tgtcctgcgg taccccctgt caaggttatg ccatgtatct
   190621 catgtctaac actgtgttgg ccctaagagt tatcaggttg ttgtacatta ctgttcgcca
   190681 cgagcaaaac gcgtgtgtgc gagccttgtg tagagatgta gactgtctta tcaaaatgtt
   190741 tcgctacgaa tctttcagca tccgcaaggg attagtgcag aacgcggcgc agcgcatgga
   190801 ggtgtcccga tttcggagac acgttcagga tttgaaacag attaaattca ctgtcagtga
   190861 cttggtggag acgttttgcg agttcatgaa gatagtcaac agaattcccg actatcagtg
   190921 cgtgtccatg aacataaaac gcgagctagt cctgctccat cttttaaaat tgcgccgcgt
   190981 ctatgacttt tcctcgccag agacgaggaa atcggaaagg ttggcctggt actaccttcg
   191041 tcacggtgac gtacccctag atgcagggct tttaatgacc ttcagctcgc ttttggcgga
   191101 ctgcgagctg agtaacaacg ccaaccgttg tcgccgcaag gtgccctttg agattccagc
   191161 ctccgccgcg gtcaccgtgc gttatcaggg ccatctggaa aaactgagcc gcctccatgt
   191221 tcgtcgtttt cgaccacacg aagtgggcgg ttgtgcaata tgaaattgat caaagacagg
   191281 atgaggtcat tgacaccacg acaatcagga tggccaccag tcgagaaact ggctgcgttt
   191341 ttaatgtcga agaatatgtg cgacgtaacc gcggacggca ttttgacgtt atgtggcccc
   191401 ggggatacac cttgtttgtg tgtgacgcag atgacaccat cctgactccc cgtgactatg
   191461 attattggag gcttttgcca atcatgaagg ggcagttacg tgtgattggc acacttggaa
   191521 ctgaggagat gttttcttgg gaccggcccg tggccgctat cggcggaggc ggtgaagtat
   191581 tttgttacga ggtagggaac actaactatg tggtgaaggc ggcagattcc ctctctgcgc
   191641 tatttaagga aggtgtgcgt ccaggctatt ttgatgatgt tcgtcgggcc agggctggag
   191701 acctgcaaca agcccagcgc agaggactta gaagaagcag tcagccaccc gtggatgtgt
   191761 ccgcttccct agttccccga ccccggttat cgagacagaa cgcggtggta gagggtgaag
   191821 aactcagtca cgacatgttt atggaaggac ttttgccctc atctttattt acaccaggaa
   191881 ccggccagcc ggatttcaga ccgagcgaca gtgatgaaac atcaccccaa tagaaaaaca
   191941 aaaccaaatg tgtacataga cgcctcaata aaagcttcta ttttctaagt aaaacggctc
   192001 gcggggtgat ttccgttcag ttctaagaac gttcgcagtg cagcttgacg gcggctgtca
   192061 cactcgcgtt cgtccgccga aatattgtct tgatacagtt tctggatagt cgggaagggc
   192121 accatgatgt gctccacgtg ggtgtggcga gaggtcgggc gggaatgcaa acgcattaaa
   192181 catacatcac gagttagaca cttggaatgc acgtttccgt gtttggtgag cgggtcttgc
   192241 aaggctgcat cacgcagcat agtgtctgca gttcgggatt cgtcgtcccg gcccatcgtc
   192301 cactgtcgca gagcgcacat cacgtagtcc gggctcacga aggcgtccag atgtctgact
   192361 gcccgtaaaa agtcaaatag ccaggtgttg acttgaaata agagttcgtc atccgggctg
   192421 ttggtagtgc ggtagatggc ctcggtggcc tggagatagt cactgcgcaa ggaggggaac
   192481 tggatgtaaa tcaaataaat taagttggac agattttgta aatgatgaat taaatacaga
   192541 cggagaatgt cgagattgcg ctggaactgg atgagcatga tctgggccgc gattaaaaac
   192601 gtcaagtcat ttaagaaatg ttcttcgttg agtttctcac tacacagtag tttcagatcg
   192661 ctcttgtaac cattagtgag cttttggagg ttgttacgat acgtgtagag cgcccctcgg
   192721 gttgtgtagg gtgcactcag aaatatcaag ttatagtccc ggatacactc gtaaatctct
   192781 cctgtgctgg gtgattctga gcttcggcgc tttcgcagct catcgtgcaa gcgccgcaag
   192841 cacacttgat actgcggttc gtaaacaact ttttcgtgcg tgagaaaatg cagagccagg
   192901 gcggccgcac gtcccgccgg ggtcagattg gtgacataag ctgtgatatt tcgtacggta
   192961 ggtgctttga cggtagctgc cagcgaatgt tgcatactgc ggatttttac tttcgaatta
   193021 taataataat tgaccagcac cgcgtgcgtc acgatactga tcgtcaggtc gcgctcgccg
   193081 gcagaggcga ttttcaccac ggggtcaatc aggctgatca gtgcaaaggt cggcatgggg
   193141 atgcagtgat tgactctgga aatgtgctgg atagaaaact cgtacagcag cagtttcata
   193201 aactcggtgt ttgggggaga gatcacgttg ggttcgaaac ccaggtttcg ggtcaccgac
   193261 ttctcaaagc agagcttgtc aaacaggggg atgctgcggc gtctaaagtc atccgtctcc
   193321 tgacaataat cctgttcgtc ggaactgtgg ctaacgagct catgttcttc gctgctgggg
   193381 aggctagccg cgctgcctct gctgacgcgg cggtgtgcgg acacgtactg ctgatgtcgc
   193441 gagtactgag aagatggtgc tctgcccctg tgggtggcca gaccgccgcg gcgaccgcgc
   193501 tccacttctg cttctgagtc gctgttcgtg tcggagacca gttcgaagga tgatttagtg
   193561 tggtcagaga catcgctggg tgtcagtaaa ccggcttcca tgcggttaat cgcgtccatt
   193621 tcattggtcg gtctgcgtga atctgattgt gaaaacacat cattgtcgcc atcgccgtag
   193681 gtataaagcc taccagagag ttcggacggc ctatactggt gttcacgcct gcggtgcatt
   193741 ggggcgtcga ggctgttgtg agtgacgcgc ctagagagtt atatagtgtg agctctttga
   193801 accgcaaggt gtgaactacc gcagcgggat gtcgtacacg gtgcttagcg acctggggag
   193861 tctctccatg actgccgatt tcggacccgg gtgcctcaac gcctacgtgc gtctcaattc
   193921 gggccagagg atctctgtgc cttggccgcg cggctggtat gtggtgctgc aggagctgga
   193981 agccgatgag gactacaacg aggaagacat caaacgtctc ggccagtacc cgtgttgtga
   194041 agtgaaactc accttcgtgg gccgtgtcgt cggggatccc gttttggtgt acggtcagca
   194101 aaagaaaacc ctcattgttc tcgcggccga ggacggacag gtgttcgcct acgtcgagga
   194161 ggatgctgct ctctacttcg tggccagaac cttctgtgaa ctggagcggg tgggctttcg
   194221 tgccgtggac gtcctctact gccctcgcta cctacgctct tccgctgtca agcgcgcttt
   194281 tcgaggcctg tgccgctccg ggaacgtcgg cccagaagcc gtggcacgtt acgttacccg
   194341 tcatcagggc gaatgtcttc acatggccta ccccgagggg gcttttctga gattgtgcaa
   194401 cctcaagtgt tttgagaaca gctccaatgg cggacacatg ctgcgctcgc tgcggcaact
   194461 gtttggagat gaagtcgttt gcctgggaac cgtggacctt cggggcgaga tgccctcttc
   194521 tccacccgcc ctcagatggt ctgctactag agtgcccatc gtcatggccg atggcggtcg
   194581 cgtcttctgc atggacctca tgaatctcag atacgtccgc ctggccgaca acctcagtac
   194641 gttcatgtgc ctgggcttgc ggcagctgct ggaaaatcgc agattcaccg gagaacacga
   194701 gatccacgac accatacccg attgtcccag agggcgtcag catgacgact gagcgtgcgg
   194761 cttggcacat gaaacgtctg acgtggcaat agacataaat aactgtcacg acttggctct
   194821 gttccttttg gcaccatggc ttgcagcagc ggcaccaccg cctgttccgt ggtgatgtgc
   194881 gccggctcca acgagtggaa atggggtcag catattcccc tgccttggcc caaagaccgt
   194941 gtacttgtcg ttggacgtcg ctggcgctcc attcgcgaag gccagaatga agaggaacgc
   195001 gtcgccagtt acctctgctg tcccgaaacg ttgcagttcg tgggcagcgt gtgcaccaaa
   195061 acttttctga aacagaaagg gggcagcaat ctgccttccg aactgtatgt aggggcgacg
   195121 ggcaacgtgt acctctatgt ggactgggtg tacgccgacg ctctcacctg gatcgctgat
   195181 gatatagagg actttatgaa acacgggctc cggagatgca ccttcatggc ggtccccaat
   195241 gccaacgtgc ttcggaaaaa ggagctgcga agtctggtca cttgcgaaaa tctcaatgac
   195301 ctgtgcaagt ggagggacca gaatgccgcc tgtttgttca agctggggga tcagaacatg
   195361 attatcgtgt ctacggctgg tatctacagc gccatggaaa agtattattg gaaacgtacg
   195421 gtgggcacca gccgagtgga aggtttctgt cgcgtcgtga tcggagagaa atgtgtcacc
   195481 gtgttcgccg accagtattt acgcttctac ggcacctcgg gagatgttat caatgtggtg
   195541 gctgacaccg tgatggagtt tgtggcatat ggtatgtttc gcttccgctg gagcaatgtg
   195601 ttctacggag ataagaaact gcggaagctg gccgacaacc tggtgtgccc atttggaaaa
   195661 actcatattc gcaacaagat tgaagtgctc cggagatccc tgcggcggtc cagctccaaa
   195721 cgctgtcaga acgactgaag tttgactttc gcatcgcttt tgcccttccc gtccatacca
   195781 gaataataat cattttttat acggtacatg atgttaagca ataaaggttt tatatttgtt
   195841 atctttcgtg ttgtggtttt tagtatgtac agtgattcgg aagtcgcaga aattatttca
   195901 cagaacacat agtaggaatc ccaatatgtt tttattcatt acagcacaag gtgtcatgtg
   195961 gattccttag ttgggttcgc aactgcacgt gcaaacttac agtctgagta caagatggag
   196021 tgtagactct gttgtcaggt tttgtttggc ctcattattc tgcggagctg tcatcgtctt
   196081 cgctgttgtc ttcggaatta tcactctgca agtctccttc aatcagaacg tcgtattcgt
   196141 cttctccact gccttctccg ctggagtctc cactggagtc tccgctcgta tctccgctgc
   196201 cgtcttctgt ggttatatga tgagtactgt gtgactcaga gtcatcggtc tgagtgccaa
   196261 cctctgtgtg tagtgtgctt ttatcgccat cggtggtggt tttcctgtac gggtgggagg
   196321 aaagcacagt tagcatatca tgcgaatatg ttcaccatct aggtaggaaa tacagcgtta
   196381 cacaatccca cctggggatg gcgtggactg ccaccaaacc gatgatcagc agagctgcgg
   196441 ttagctttaa gttccgcatg atgtcggtat tggacgcgat tcaagtgagg cggctgtcaa
   196501 tctcttgtca ttaaatatct tagaaggctt ccttactaac gggggtgctg tcgtaactcc
   196561 tggtaccgtg ccatgtccaa tgtgccgtgg tggacgctgt tgacgtcaga cacagactag
   196621 tatttaggaa atgtggagcg ctcaccacgt atcatcattc cctctggtac ttgctatggg
   196681 aggcagcacc gagcccacct tgtcggaggc cgtgcggggt ctcatgcctt ccgtgagggc
   196741 atcgttcttt cgtttcaatg aacccgctca tggacacttg ggcatgtacg ctccccgagc
   196801 ccggcggcga ctgttccgaa actacatgca acggcagcag attcaattac aggtgccgca
   196861 agtgcccgaa gtgatagatg tcctggagat tcctatggaa atagagatca ttgaagacca
   196921 agagaaccag ccgccggcca tgggcgatca tatcatcttg gtgatggaag agatccaacc
   196981 ccatcccgcg atacgtcctc ccggaccccg attagcgctg cagctattga acgccgaggg
   197041 tgaagaagca gaggcttaga ctttatatca gaaaaatata catttattcg ttacatctcc
   197101 attccgtccc atacatctta tatacaaaac aaaaaataaa attaagttag ctatatacag
   197161 tctgtagtgt gtgcatgtgg gatgattgac agttttctga gtcctcacaa ccaccggttg
   197221 gccttcaact cccagggatc cagttctgac ggcagcggtc ggtttctctg tgtccatggg
   197281 ttgatgggca tgggggacgc gggttgcgta atgtcccagg gaatcatgac tggcactcgc
   197341 ggcgatccgg atacccgtcg aatagaaggc ccgggtggtg gcggcggcgg caggagcgga
   197401 gtcagcacgc tgtccacagg tgtcgttggc tggtgtgaag gatacaagac tctgctttta
   197461 gtgatttctt ctctgtgctg ttggatgtct tggtcgttaa atgtgaagac tttggggctt
   197521 ttagtagcct tggccgattt gctcgctgat ctgggtgagg gatactggaa caccaacgcc
   197581 ttcggcttgg gcttcggtgg cagtggcggt ttttgcgtta acttggccgc gtcgatagta
   197641 aaggtggtcg gtttaggtgg cacggcggga ggcttatccc ggtggggttt gatggaagcg
   197701 gacagtatgg gcgtggtttc tgtgttctca ggttctgcag ggctgttggg ggctgtatct
   197761 tccccgcttt cagtctgttc cgctttggac tcaataacaa tctcttcaca gtcggcgcgg
   197821 cgtgggctgc gaggtaccat ccaagcacat ggaggtttgt tccaatagta atagcgtaat
   197881 aagacgatgg tggcgaaaat tgcaacggcg acaaatgaca ggccttcgat agttagcatt
   197941 accagcttgg acgtggtaat aaagcttttc agttcatcca ctatcaaagc ttcagtcaag
   198001 ctgcaggtgt tgttctgcgg aaacctatct cgatacttct tttgatcttc ccgcgacagt
   198061 ccagtttcat tgtaatgtct gatggtgtcg ttgatcgagt aggtttcggg aacaatgcag
   198121 cgtagcgttg atagagccat tgaattgtga tcaaaagctt tgctggcatt ggtgtggttt
   198181 ctccagaggt cacacattgc ttgtaggtaa ctgactagag gcgaagtgca gttttcttgg
   198241 ctgtgattgt acccgtgtcc tcggtaccag aactcgtcaa tgttcatttt actttggttg
   198301 cagtaaaaga tccaaatggt tcccaggtag ttgctctcac gcttcaagca ttcagcaggt
   198361 agctgggaca cactgtcgtt gccagtaccg acggacgaaa catttgtact tgttttgtta
   198421 ctaggagtaa agttgtatgt accagccagc tcgctggtat tagtcacgtt cactcccccg
   198481 acggccgtcc aggtcagctc ctgggaacga gtcaacacag agacgtacac atagctgctc
   198541 caggttggca ccggcagggc acaaagcgac aggatcacaa gccaagtctg aaggggcatc
   198601 gtgctgcagt gccttccctt gacggtgttt tcttttaagg gttggcacgg gcaccgtttc
   198661 gacatacttt tgacgcatca gtgacggtgc cgtgatttcg aggtttcatt atcgctattc
   198721 atcactgtca ttctgactca ctgcctatga atcgtgatca ctgtcatcgc ttgatggaca
   198781 ttcgtccaat tcacccggtg gtgggttgtt cagggaggct cgctgcaatg acagcgtcag
   198841 cgccatctgg atggtttccg tgttactggg cctctccaac cgcaacttcc cgtgtcccag
   198901 tactatgatg gtcctgtagg tgttggtggc catggaggtc atgggcgcta agccccccgt
   198961 cagtgtcctg cggttgagca acaccacgct gttcacctgc tttctgggca gctttcgctt
   199021 aaagtattcg taaaggacgt gagacatatt cgctgtcgcc accagatggc gtgccgactc
   199081 tgcccgatcc ccggggtcgt ggcaccgtct gaccgcaacg cgggtggtct gagaaatgac
   199141 gacctccacg ctacttttat atctaacgac gtaggagtgg ctgatacgcc acatcgtgtc
   199201 tcattagcgt acggaacgac aggacgtggc acacaacgct cggcagacca ccgaaataaa
   199261 gcccaagcca ataaccacac ttcgcagatg tgccttttgg agcgatttta ttagcataag
   199321 aaaaccatcg catggcgcct cgttgaacct gtcaatcaat cagtcgtcat ctcggcacgt
   199381 cattctcttt taattgttac tgagcattct tcgcagcttc gggccgatgg tgctcagctt
   199441 gttcccgtgt ttcttctgtt cgtcgggtag ttttgtcagc gacactcggt catcctctcc
   199501 tccgctgatc catctgaagc acgcctcgcg ggtgtacatt ctcagggtgt gccagccgct
   199561 gctgatggag gagcgctgcg gggccgtctg cgggacctgc gggatgggtg ggtagtcttc
   199621 ttccacgtct tcgtccccct cggcccgcaa cggcacgtgt ctcatcatgg attcattctg
   199681 cgggcgccca aaaaagtgga cgtacagagc ctgatccatg tttcggtgga cgggctacag
   199741 atgcgtgagt ccggtttgaa ttgcagccag tttcttatac tggcgcttca tggtgtgcct
   199801 cggaaatcag atagtatcgc gcagccatct aggacccccc gggagggttg ccggtccgct
   199861 aatccccctg tgaattccgc aatgtccgga aaaagtggtg cggaatacgc atactccaca
   199921 agacaaaaat caacatcact ccaatcacca ccacaatagt cgccatgcgg tccggggacg
   199981 gcatttctcg gaaatcagct gggagccgcg cctggctgtc attctgaaac ataatcccct
   200041 gcgcaggctc cgttcccatg gttgcactaa cgattcccgg agtgacggaa agtccccgac
   200101 cgaaaaaaga acacgatctt ctgaggaact cgaaaacaaa aaatagcaac acggcgatgc
   200161 acaggatcag aacgctaatg agttcctgga cattgtcctc cgtctgccaa tgcggcgctt
   200221 gggccgcgtt cattctgtac agagtggaca gattctccat ggccgcgttt ttcggcggtg
   200281 cgtgtgggga gcgtgttgtc catttccaga gccacggcga gcctcccggt ggcctctgca
   200341 gaaccatgac ttggtatgat tatttcccga gttatacccc cctgcctctg cgttagcgaa
   200401 taaaaaacac tcctccgcac tcgttcttta acagtataaa cttttatttg tgaatcatgt
   200461 agacatagaa tcccctccac gtacccgatt agtcacgttc agactttttc ctacaaaaca
   200521 tgagcagccc gtcacctgga cgcgtaaccc tgattccatt ggaaactagt tagtagacta
   200581 agtgatagct tataccattg acaactgtcc atccatctct ctcatcacat acccaccaca
   200641 gtgtacccac tcaattcgtt ttcttcgact ttcgggattc ttcatcttct ctcttgcggc
   200701 gccagcgtcg gtttctcctc tgccggagcc tcacgcacga cgtcaggatg cccaacagac
   200761 acagggtggg cagacctgac acacagatcc atgaccactc gtccttctcg agcggctcgc
   200821 cgcgcaggat aagtgcgcgt tcctgctcgg cggccctcgt acaattattg tccctcatac
   200881 tcgcaaacac ataacggtga cacaacgaca tatctctttc caaatcacat ggcggctgca
   200941 tgccggagtt ccccaccgcg tagtgcaagt gtttgtgcca cgtgtttttg accagtccac
   201001 cgacttctcc gcagttcacc agccgcacct tctccgggtc gggggtccac aggtattgcg
   201061 tctgcgactg ctcgccaaac tggaggtcgc agtacacgtg cggtcgtctc cgcagctcca
   201121 cttccgagat caccaccgtg gtcttcaaga cgtccacgtc catgttgttc acgatggcgc
   201181 actggtagat tccggagacg ttgctggtca ccaaaaagga gaccgtcaac ctctgtacgg
   201241 gaccctcggt ctccagcttc caccgcagtc cttggagctg ctcgtggctc ttgttctgaa
   201301 actccccggt aatctgtttg gaattgacta acagaaggct gcggcagttt ggggtgttgc
   201361 aaaagcgaat ctgaaccgcg gcctccgtcc agccgccggt ggggaattca caggtcaggt
   201421 tgaatcggtc cccgtacggc ggcatggtgg gggctgaaac catgtccgtg tcgctcggcg
   201481 aaactcgcat taatcggtcc cagtacgaag gggggataca gtggacggtc gttagtacgg
   201541 ttagcagaaa ggcgtttgtg gattgtagtg gcatctttgc ggttactttt gtcagtcaac
   201601 agttcaagtg cagttagtcc gtgaaagtgt gtcgaaggtg agatatatat tgtagccgaa
   201661 aaggtagggg aggtgctagg gcgggacccg gtgagctaat atgtggagtc aggtaaccgc
   201721 gatcctgctg tccagagcct agggcggtgc ggatcatcag gagaagagtg gcaaaacgtc
   201781 tcccgccttc accgattcac ctctccctgt cagtgttttt taaaaagttg tcagtttacg
   201841 agttgcggct atggctcatc aggtggctgg agagccacag tgcgacactg gcaccgagca
   201901 gcttgcgtcg cgaattcctc tcgccgttgc gcgggtttag tgtcgtgatg gattccgcgc
   201961 tgcacagctg cctggaggcc gtggtggctg cttcttcgtt gcgcagcaag cgttcggcat
   202021 cggcgttggg attgttgttc ccatccagtg gtgtcacgat cacttctccg gccgcaaggt
   202081 cgatcgtcac gctttcggtt ggcgaaggcg gtctggatcg gttggaagtg aaacgtggag
   202141 ccgcaggagt cgctggggtg tttgcagaca atggtgtgct cagatcgttg ccgcgtgtgc
   202201 tggatccacg caaacgccac acatgattcc ctggcatgtg ggttcgaagc cacgaatggg
   202261 ttcttgtgag aaaattggtt cgcctggcgt cgatggtgaa gtcgtagagt gagacagagt
   202321 ccttggaatc acgttgtcgt acgtgccacc gatgtcgatt tgggtctttt ggtttgagat
   202381 tcaaggctcg tctacacttg tcttggaggc ggctcttcag gttgggtctt tttggtggtt
   202441 ctggtgattc ttgctgtcga aattccatgg gttccgaaat ctggggcctt tgtggcggaa
   202501 ttggcgacgg tggcggtggc gagacacaca tggacacggc ccgcagaggt gttctcgtgg
   202561 aatgatgttt ccaacgatag ctggaattgc gatggtgcct ttcatgatgc aggcgcaagc
   202621 gtgtcagatc cagggaatcc gtggatcccg tgaaagtgag ggcgttgcgg cggtggtgtg
   202681 gaagccgcgg cccgggaccc gcattgtcgg gccgtttgtt gcgcacgatt gtaaccctct
   202741 gggtttcttg cgaaacgttc aacgccgctg ctgccatcgg tggtgccgct gcgtgcaatg
   202801 aggctgatgg aaaacttgga accgggccgt aacccaacgt aggtctggcg aattgaggtg
   202861 gcagcctggc cggcggcaga tcgagattcg gtgtccaggg tcgcgattgc gtgcgagaac
   202921 gttgtatctg cagaagaagt tgcattcgct cgtgttgcca gcgaatattg gccgacacag
   202981 gatcttcgtc atggtggtgg tgtcgcgggg gtcgcggaga tcggacgtcg agatattgtg
   203041 gaatggatgg cgttctgggt ctctccgcca ccgatctcct agcggtcacc ggcaccgctg
   203101 ccattctcaa cgcgacttgc ctcatcgcca cttgcatgat gctctgttct tccgagcact
   203161 cttccacaat ttctagagca ttcagtagcg cgatccagct tcccagaatt acagggagcc
   203221 acagacgcca gtttttatgg cgtttgtgca gggccatggc ccccaacggc ggccccgtga
   203281 cagggtggag gcgccgatcc aaagacggtt ttgtgtacgc agttcaaata agtgtgtgac
   203341 gactaagacg gagaagcttt tgtttatttt ggtaacgttt cggccgtcat gtcaaactgg
   203401 tgtcaggcga actgccactc ttcgcttact gccacgccgc catacttttg atccctataa
   203461 tgttgtagaa gtcgttgggg aatcctgtac caccacagaa taatgatgat gaccgcgatc
   203521 actagtacca aaacccaaaa cgcatgtgtg gctgcgtgat ggtgatgatg gtgtttcagg
   203581 tggtggtggt tcgtttcgtt atacttatgg ggcgtgtgag cgggagagtt cgtagaaggt
   203641 gtgtttgcgc gggaagtcgg tgtactcgtg gcgagggtgg tggatgtggt ggatgtactg
   203701 gttaatgtcg tgtgccgcct agtggtggtg gttgtagtca acgttgttgt ggttgatttc
   203761 atcgtggtgg ggatagtcgt agttactgtc gtcgtaagga cagtggtagg caacgtggtt
   203821 ggcgaagtcg tagtcgttgg atgggtagta gttgtcaaag gggtggtagt tgttggatga
   203881 gtagtggttg ttggatgggt agtagtcgtt aaaggggtag tagttgttgg atgggtagta
   203941 gttgttaaag gggtagttat cgtttcagtg gtagttaacc tggttgtcgg gaattcagta
   204001 gtatgtgcac aagtagttac agtactagtt aacatcgatg gcgcttttgt agtagcagca
   204061 gtggttaatg tcgtttgtaa gggggtggtg gtatatggcg cagtagttgt gtatggcgaa
   204121 gtcgttggag tattggtagt gctcgtttgc ttcgttttct tgttcttcct ctttttcgta
   204181 gcgcgtgtag ttgtggtagt tgtcatttca gtggtggttg gatatgttgg cgtattggta
   204241 gtcacagttt gcgtggttgt tggagttgta tgtgtattcg cagtaattat gggcgttgtt
   204301 ggcggatggg tagataagtt ggtagttaaa ggttgcgtag ttgtatgtgc tgtagtttcg
   204361 aggtccgttg tgggtgcctg tgaggttgta ctggtagttg tcgatgtgct actttgtccc
   204421 gtgctgctgg aaggcagctg tagtaaaagt acatgtccgt caaaaccagc cggtataacc
   204481 gttacgttgt aacacaattg atcttttggt ttttcgtttt gaggttgagc cattaaacag
   204541 taatttccag cgctgtggct ggttacgtta agtaaagtga gcgaacaatt cttatggcat
   204601 tgaaattgca ggttgggacg tcttgtggat tctgcgttgt tacgagtgca gccacaaaga
   204661 atagtcttat ttacatacca atatccaatt ccattggtaa gttgtaaact agcatttaag
   204721 gttacattat ctcctgtctt aacagtaact aatatattag tggttgtgca atagagatga
   204781 ataacaaagg ctaaacagat aattaataac agcctccaga acccaactct tgtgcacggt
   204841 tgttgtgtgg tcatagtatt gacagttata tgtctccatg atgctcgccg gttagtaaaa
   204901 cgatgtatgc tctaacagtc aactactttc ggtaacggtg tttctgtagg tttgctgttc
   204961 gtttggcgtt cgtcgccata tttgtggtac gtagtaatgg ccatgtgtcc aataatgata
   205021 gacagttttt actaagtatg caagtgttgc tagtactgct aaacttgaca acgtaaacca
   205081 tgttgtggtg gatggtgatg tgtgtgtttg aaaagtatct aatccagtag ttaatggtag
   205141 cgatgtagat gttgtacttg gatctgttga tattacgttc aatttgtagc atattttctc
   205201 ttgaatacat atatattcct tataaagtaa accgtacgta taatacattc ccgatgcaga
   205261 ttgatctaca tcgaatataa ttagtgagca tgtactacaa ttataatgta tattcgtgta
   205321 tgattttgag gttttgaagg catgggttgc gttgtattga caaagtggtt gggttccacc
   205381 atggctttgg taccatgccg ttaaacaatc gtataatgtc gcggtaccat gaatagttac
   205441 gttttcgtgg gcagtaacgt taatggtgga tgtgttttta cattgtaatg tttgttgagt
   205501 gtatccgtta atgaaataca aaaataaatg cccattaaac atgcgaatcc acattgaatt
   205561 gatatgttaa tatatgtata gccaaaacct gtcagacagt tttaaacaaa acaggatggc
   205621 aatggcgata acgaataaaa atagcgctaa ttctatcatg gatgctatgt agttatatct
   205681 cgcttgaaga tggttatcat tgtttcctgt atatcgtaaa actgtgttag gtattgtcgc
   205741 attcgtttct ttgggaagcg tagtggttag ttgagatgtt gaaatgaacg atgtgggtgt
   205801 tactttattg gcaaccgtca cattgtagca gatgtaagtg atgttgatct tgccattgac
   205861 tgtgcgtgta acgtttttac agtacgttcc agaaccattg ggtgtcatat gtctaagatt
   205921 taacatgtta gatttatctt gacatagaaa tgataccgat ttatttgcga ggaacatttc
   205981 ttcttggcta gacgttacac gacataggac atcttcttcg cctttgcatg gtggtttaaa
   206041 ccaggacatg tgatgcccgc gatggtgcga ctttcctaat gttacatctt ctcccgtact
   206101 aactgttatt gactcagtct cagtgcattc cagagcaaca tacatgtggg ttagggtggt
   206161 tataatcagt gcagaggtcc atttatactt catatttaaa aatattctcg tcgatagttc
   206221 tttttagatt ttttaagcca gtatcgaaaa gcccagattg aaagtgcaag gagggcaaga
   206281 acggcacctc cccaggtcaa gtgctcagcc tgaaactcct ctgatattaa atggcctagt
   206341 acggttttat tttcagctac atctacaggt tttggagcac tggatgatgt agtaattgtg
   206401 gtagttgttt tcacattttg tttattggta gttggagttt taacgttgtg ttgtcttctt
   206461 gcaggaggtt tgtgagtagg tttacatttt tgaggatatc gttttctctc acattgataa
   206521 tttgcacatt cgtcaaggag tggtgcttga ctcatgttaa catgcctggg tataacggtg
   206581 acgttatatt tgtggtttcg gtgcgctcct cctcgtagtg tatgatattc ggctagatat
   206641 aagctatgag taatgttttc tataattaag ctgctattaa tacatctgtg aatcaattcg
   206701 gaaaaattac gagtcattgt accaagcttc atgttgcaca tatcactgtc cccgaggtac
   206761 catcgagcga ctccgttgct cggactgtag tatgaagagt ttagagttac tgtttcacct
   206821 tcatgagtta taacatgtgt gcattgtgaa cacattggca tgcaaaatgg gggtttgttg
   206881 acaaccataa aggatatact gaaccatggt acatacacaa atacaaataa cgcacaggtg
   206941 aacaggtaac aagttgttgg aggcatagtc gcaggtgtac accataatta gttacctgcg
   207001 ttttaatgga tgggaaatcc ccaagtgtca cattatgaat aaaagacttt tccggcggta
   207061 atgtctccat attcttgcta gtttgttagc agacaccacc tttcgtttca accagtgctg
   207121 tcacggtggt cagttttaca acgcatcggt ggtttttgtg actttgtatt tgttccaaaa
   207181 cttttgagga acttttaaaa agaacaaaat tatgataagt atgattacta caagaacaat
   207241 cacaacacca gcgatgtgtg tagcatcttg ttgttgtgct tctggattgc gtgtcccatt
   207301 attacctgta tacggtgcat tggagggtat ttgtaactgt actcccgatg tggtacttgt
   207361 gtaactattt gctgtacttc tttgaggttt tcgcaaagga ggcggagttg gtggagatga
   207421 cagcgtcaca gttacattat gacagttata aggagtattg ccagatgtca acagtgcact
   207481 acaatattgt cccgaataac tagcatttac attgagcaag actaattgtg aaccgttcct
   207541 tatacaagca aattttagtt tggtgttatt taccatatcg gttctaccat tgtaacctga
   207601 ataatcgcat agtcttttgt tactaccgca agggtactga taccagtaca aaaaaccttt
   207661 accatttaga ggtgatgttg taagggtaat attgctccca acctgtcctg tgtacgtttt
   207721 tgtgttgttg catgttacac gtgatgcacc tgcgttgcaa acagtccata agagtacaaa
   207781 tgtgaagcaa gcgtacgaaa tgtggttcca tgttcttgtt gtgaggatca taatgcgggg
   207841 ttgtgtgaag ctccattttc aacgttcaaa cagtgttttc accgttattg gcttgcacgg
   207901 tgaatttgct cagtatggcg acgtgagcct gattctctga tagctgtcga aaatccgctg
   207961 aggtatccta aagaacagca gtataacgat gataataaaa acagttacga atacaacaac
   208021 tccaactatg tgtgcaccgt cctcttcttt ttgttcaaaa actagagtcc gtgtgtttgt
   208081 atgcgataat cggtggggtg atggttgtac accgcctgtt actatataat tggcttcagt
   208141 gcgaactctc atgtcaccgg agacaggttc tgtactgttg ctttcagact gatttctacc
   208201 tatcgtgttg tggatacaca tgatgattgt gcaaacaacc cagatgatac atgttgaatt
   208261 ttctaaattc attcttttaa aaatatcggt cgggaggttc aggtgactgt accataggtg
   208321 ttaaaacagt gctgcatggt ttatgcttat ttttcagcct catgcagaaa aaacacaaaa
   208381 ggacaataat gataacgagc agaaggatcc acatggcatg catagcggag tgattttgag
   208441 tctgcgcata gcttgtctgg ttttcgaata atgcaataag gagtgcagtt tctgacggta
   208501 gagtgatagt aggatattga gttgtgtatg ttgtttgctc agttgtcgtg gcggttgtaa
   208561 ctgtggtggt ggtttttcgg gtagttgtgg gtactttcgt gactccgctt ctcacagtta
   208621 atttgtaaca cgtttctgat aactgtcctg atcccaaatc tagtttaacg gtataatttc
   208681 cattgtacat atgtgctgtc acattgatta ataataaact atagttgctc aagcatgaaa
   208741 attttattct ggcgttagct tgtgtttgtt gaggaacgta tcgacataat tcttttcgag
   208801 ccttgcctga tcctcgatac cagtaaacgt aggtgatgtg gtaattgaat gatggaggac
   208861 tcatgataac gttgcgtcct gcggtgccgt taacgggttg gcattctaaa ggttttgctg
   208921 tgaacacatt gcgatgtatg cttacaaata caaacatcat acagattaac gatacttgtg
   208981 ttgtcgaggt agacggcaac accatagcat aactatgagt agtattaaca gtaaaagaaa
   209041 taaccaaaac atgtggctgg ccgttgctcg ctgtgcttca aatgtatgat tcaatggtat
   209101 tccattaaaa ccaagtggat ccattgagat tcgtgtggtg gtgcttgtta gggttgatct
   209161 tgttgttgta gtggatgtta gcgacttact gggccgcctt gtagttgttc ttggtgcggg
   209221 aaacggtagt acagtgaggt tgtagcagag ttccacgtaa ttattgtgtt caatatatga
   209281 catgcagtat gggccattat tttctgtagt cacgttaatg agcagtaaag agtagttaca
   209341 taaacattta tattgaattt tatgccggaa tccgcataat gtaaagtcgt cgccaaactg
   209401 acaaagcatt atcgtttcgt tcttcactgt tcgttcccag aaaacatagc tgttagcgct
   209461 aattgttacg ccgagagtta cgttttgtcc tgttgtggct attgtacgat tgcagtgtag
   209521 caggcaagtg ggagtatagt ctttgtattc acatggttct ttaccattgc tgacatttac
   209581 acaaattgcg ttaattagcg gtaaagaaac aataaacacc aatgtcaaaa gtcgttgaca
   209641 catgtttaat aaaaatctta acatggaagg cacgttaaac tgtttgtgct gagcgggttg
   209701 atgctcgaaa gcgagtatcg aaatgtcgga gcattttctg aggcaaacga aactcaatcg
   209761 caacccacag catcaacaca gcaacaatca caagtcccca agcgccgtga acatccaaag
   209821 ttcgatcgat ttgggtattg ttgtcggtat attgctgact tatttgggta ttgttgccgg
   209881 tatatcgctg aatcatcggc gccatcaccg aagttaattt taaactctgt ggagttgttg
   209941 attttgagtg aaccgtcacg ttgtaacagg cggacattgt gggatgatcg ttacaggcgt
   210001 tgcctacggt gtaataagtt cccgtcgatg gtagttggat attatgaaat ataaatgatt
   210061 gccgcgaaca cgtactagaa attcgttctc cagaattaat ggtaacatat gctcccataa
   210121 accgacatag taatctatca ctatagtttt tataccgata ccacgcaatc gtgtcgcatg
   210181 ttactggaat atgggattcc aggacaacct catcgccaac gcagcacgtt tttagtgtgc
   210241 atgtgggcat gtagaaagag ctgtgagagt attgagtcga agcaattaaa aaagtgaatg
   210301 tgaacatgcc ttctcctggt ctctctcttc tttacgcgcc aaagataata aaaaacatac
   210361 gcagtataat gtatctaaag tacgtttatt caccacatac aaagggaaat ggtttttttc
   210421 ttaggacagt cgctagtaat cataaccgtt taactttttg taaccgcgaa tccagggttt
   210481 ggcatacaga cacagataac acagcttttg cggaacgcgt aaaaccatca aaatcgtcag
   210541 catggccccg aacagaatac cacaaaacca gctatattgt atcataactc ttgcagtctg
   210601 ctcgagaacg aagcctttac gtacatggct tcgtgatctg atcatgtcat cgaggcttat
   210661 gacagcatac gttggattgt ctgtaatggt ttctaggtca tactcgtact tcatgagttt
   210721 ccacggcgga ggcccgcatc ttgtggtggt aataaccggc ggatcggtgg cgttcgttgc
   210781 gttctcgctt accgttaaat tgtagcacat ataggtatag ttcataattt tgcgcgaagg
   210841 gcctctgcga ttgtagtaaa ccccgctgtt acccatcgac acgttcaaca gagtaatttg
   210901 ttctgctgta cagttataat gcaggtattc acgatacatg ctgtcaccgg taccatcttc
   210961 ccagtgtgca catagtaggt cgctccatct gtgtgcgaaa aaccacgccg tgtaagtctc
   211021 gttactcggt tccgttccat ttaatgtgac ggtggatccg accgacgtcg ttaatgctcc
   211081 gcagtaacaa tccgtatttt ctgaccacag tgagtattgg ctttgaacct ccacaggcca
   211141 cggaggcagt gtggtggttt gaacgctggc gttagtcgta ttcgtctgtg ttgcctcggt
   211201 tgtgttcacg ctcggatcgg ccgctgctcc gcttacgacg ggaccgctga gaggtatcca
   211261 aaataagtaa agggccagcc tgagtctcgg agctcggtgt gatttcatgt ttgtgtattc
   211321 catgcttggc tgcggcgctc catgggcttt ggggttttat ccaagcagct cttttgatgt
   211381 ggtttcagtt ttatcaagtc tgtctctcta ttgttgcaga ttaatgacgt cgtctggtgg
   211441 catggacgcc gtttccctcg tcatccccac agcgcctccg cctccgctgg gcactattac
   211501 tatttgggat gtcatcgttc tactgcgaat gctgataggc gtcggaatct ggatagggtt
   211561 ggtgtgcctc attatgtggc tgatcatgta acattcgcga tggcttctca gggtagctcg
   211621 tcgatccgcg ctcacgtcga aaccttgggc gggaccgagc agctactcta ggaaaacatt
   211681 gacttttcca cgacgcaaga agtggacgtc tgaatgttct ccgtgatcag gtggtagatg
   211741 ggttctcccg gtcgaccttt cttcttttta caactgtctt tcaccgaaga ctttttggga
   211801 ggaccagaag cctccgtttc gccttgcttt ttcagattaa agagcgcgaa aagaaacacc
   211861 aggaggaaca ccaccagggc gaaactgaat aatccggccg agacggatgc gaacgtggcc
   211921 agtttagagt atttggaaat atatttcggc atattcgttg accacgtggt ggcgctgctg
   211981 ccgggggtag tagtgtgtgt cgtttgtgtg atcgttctgc cagcggtcgt gcggtgggtg
   212041 gtgctcgttg gcttcgtagt ggtggtggtt gtcgttgtgg tcgtgggtgg aacggtcgta
   212101 acgtagctga gactcgcatt tttccacagg tattcgttga aaaatattac agaacagttt
   212161 gtgatggtgg taatcttagg ggccggcggc cgtgggacag gtacgacagt cacagtgtag
   212221 tgttgtgtca atccaacgag atttttaaaa atgtaacttc cagtctgatt tgtatccaag
   212281 tcgcagagag ttaaactggt ctcgttgcac tcaaaacacc atccgtcgtg atgctccttg
   212341 gcgactttgt aaccagatac gctgcataat gcgtacgact gtgctggaaa gttgtaacgt
   212401 atccacatac ccacatgcat gttagagtgg ttgctgtgac tgatgctcgt atgcaaagtc
   212461 acgttattct gatagtaccc gaccgcatta gtcacgttat agaggaatcc gcaggtgctg
   212521 ttacagttgc agtccaagtt acatgttggc tcgctgttcg ctaaaaccgc cagaaccgtt
   212581 tgcatgtacc caaagtacca taaactccgt aacatactgt ttatctacca gttctccgcc
   212641 acattcaccg tgttcacaat cgtccggtac gcgagcttat ggtggtggtc gtcggtaacg
   212701 cggttctgac ggtcactaat gtacagtgca ttctttttta tcctacccct cccatttccc
   212761 tgaatacggt gaattggtgt gtgcggtttc caaaccgcgt gcttaaaaag cattcaggaa
   212821 gggtattttt ggctttcggc catataggta accaatgccc ataagggccg cacctccaaa
   212881 gaaaaccata actggagtaa cgacgttgtt ggtggtttct gactgtcgcc tagcttctgc
   212941 gtgagccgtg ccagttgcat gagatatgcg tgtggacgta tgtaaacttg tttgtgtgga
   213001 aggtggggta gtgggatata ctatgtgtaa ggaaaaatta tgttgttttg cgatgtcgga
   213061 attaatacct ttattcagcg tatattgcaa tggggtttga gtggttacgt ttccgatgtg
   213121 caagtgtgtt ttcgtacaac ttgttatttg cagataaatg gttttacatt cattcaattc
   213181 atgcattaga acgtcttcgc ttgcaatgta acatatatac acactggttt gacaatttaa
   213241 tgaagtggca tttgcggtcc attcgtacca gtgaaacgtt tcatggttat ctggattagt
   213301 taatttagct gggtcgtata gtttaactga aatattctgt acagtgtttt gtatcatata
   213361 tgagtaaaat gttggaagtg ttaacgtatg ataaatgata cacatcgcat tgtaaaccat
   213421 tgtttattga attcgtgttg taacttccat ttgagttttt atgtgacatt ttttccgcct
   213481 aattgtcgcc caactttttt aataaaaaca ctttacaact ctaaacgtgc aattgccttt
   213541 attgttcgtc acgtcacaaa gcgttacact ggccctttgc cgctgaaagt caactcccaa
   213601 gatgattgac agcttctgcc gatctatcct attataccag aacaccgttt atagtccctc
   213661 gggattgctc gaatccttta ggggtgaaag gtgaataaac ttcccttgcg tgtcaatcat
   213721 gcgattgctg gcgacattag cgtggatact agcttttgcc gcttatcagg taaggcgcta
   213781 ttgcctgatt cgacacagat tgtggaaaaa tgttttttta ggaaccagca tgcgagagga
   213841 ccgcctttcg cgaaagcagt gagtcacgac ttctctttgt gtctttgttt cggttctccc
   213901 ccttcaccat caggtcgctc tcggccacat ctatggcgag acgctggaaa aacagcacca
   213961 gttgcgtctg ttcaaggacg gtaaaatgaa gtaccagatt attgacgggg aagtctaccc
   214021 tcctaccgtc aaggaggccc gagtgcatat ggtttacgaa cccagcgttc ccgaaaagtt
   214081 acgtttcgca ctgggtaacg agatgtttgg actcgtgccc ggtttcatgg tgtacgccat
   214141 tatctggctg agagagcaca acagggtttg cgacgtgctg aaacaagagc acccggaatg
   214201 gaacgacgaa cagctgttcc agatcactcg tttaatcatt aacgtacgta tgtgtacaac
   214261 ctttcacgtt cgtaagtgtt gtgtattatt ccgtatccat gtccccaatg tcagcgactt
   214321 ctgtttccct cgcccgcaga tctcctcgcg tggtaagcac ataccccccg ccctcaagga
   214381 cacctcccgg gaggcctcag aacaggctcc caaaaagcgt tatcacttac tcaacgagta
   214441 tagaaaacgc ctcgagctta agtcctacaa gctgtttcac gaactcacag gtaacacggg
   214501 tttgcaattt tcagacaatt ttactgattt ttttggttca gttgcgataa gcatgggtta
   214561 caaatgtgaa taacaaaaaa aatgtctcta tggcgctcgt agggaaggag atagctgtcg
   214621 agctggaggc cttctacggt gatatcgaag ccgtcgaact ctacgctgat ttcctcgctg
   214681 aaaaaccgtg tcccgatgcc atcctcggtg acggcgtcct cgagtcgggg gctccgttct
   214741 ccctgagggg actcgcggcg aacgtcatct gctccccggg ctactggaaa cgcaacacac
   214801 tcggtagctc cgcgagtttc aacatcgtga ggagcgcgac ccttcagtct ctcatctgta
   214861 gcaacgtcaa gggatgtccg ttagccgcat tccgagctcc caacaaggaa ctcatgaggg
   214921 ctttcaacgg ctcctcggtg cactcgaaac cgaaggccgc tcccgcggtt gaaataaaaa
   214981 agcataccga gttgtaatcc atcacgtcac gttgtccatc aatccacaca tccatccacc
   215041 catgcatccg tcaatcattc actacacatc gccatcgagg gacacggtgt ctatgtccgt
   215101 caacctctgg aacggacagc agcagtaata gttgcagaat ttctggtaga cacgtaggta
   215161 caggagatcc agcagtatgg ctaggacaat cacagtggcc gagaaggccg cagcgataat
   215221 aaacagaacc agctcactcg acatggctag gatcccgaga ctcgcgagtc tcgggtgaga
   215281 catacttgct gctatcttga tatttaacag cgtatctgtg cgttacgggc cgttaggggg
   215341 gttacatgca gaattaattt ttgagaacat caggaacgcg cgaacggtgc gatccctcgt
   215401 gtcgatagca gcaagtaaag tagcagcagt tacagagtat ctggcagtaa agaatgacat
   215461 acagagtttc caaaacaagt gctaccgctc caaccacaaa agcgatcacc acacagatca
   215521 gtaacacatg cagcgcgaaa gacatgtttt cacgggttta tgtgatcgag atgcccttcg
   215581 ttcggaattg ccactgacaa cgattaaaca ttctcctgca cactttcatc atacacaagc
   215641 attctaaaac tagcaacatg gtgcctagaa gtatcaggag tacaaagcat gaccagacgg
   215701 ggatgatggt gtccgcacca tcacctgtag tgctattact gttttccatt accctggacc
   215761 cggttcttta tagcaaagtg caaattcaac ggttgtttac gataacggaa atgatgcttc
   215821 accgtgcgat cgcggaacgc gcggacagca gcagcgatac agtctgccta ggcggcagaa
   215881 atgaacgata cattgcactt ctagtatgat tgacaagacg accagaatca atacaagtac
   215941 agacattgcc ccaccatcga taaggtcgtc actgtcccag cacgttccat tttggctcat
   216001 ggttagcttt ccagcatacg attagtatcc agcatgtacg attagttggt tataatgttt
   216061 cctggtataa taagtttatt ccaccgtcat gtattgcggt cccatgtgca gaataagttc
   216121 agtgcagtgt tgagtgacgg gagcaataaa gtacggtgaa acaactcaat agtgcaatgg
   216181 ttaaggcttg tagtacccga ggtagctatg agatgagaac atatgttaca atctgggacc
   216241 ctgtgctgat aataaataac gtcatgttca gtcaaccttg gcgtactgcg gttctttgta
   216301 ttcgtgatcg gaacgtatct ttattctcgc acggtagtag agatagcccg ccatcatgag
   216361 tgcgacaata acacagggta tgaccggcgc aataatggtt gcgtctttgg tattggtgta
   216421 tttttcggca attggtacta acgataaatg agttaaagcc acaatgatta ccttgtaagt
   216481 gatgtttctc atgtatatgt tgccactacc gttacattgt gacaatatat atgtgatggc
   216541 tgtcctgtta gatatgttat agagagataa tcctgtttcg ttgcatgtat agtctttata
   216601 tggagaatat gtatctttca ttatgtattc gacgctatcg tcactgtatg taatacataa
   216661 gtctgttatt gaacagtttt gatttcgtgg attttcagcg taccatgttt gtaattcaaa
   216721 tgaaatatta tcaggtgtta gtaaagtaac attacttcca aaagtagttg ttatattttt
   216781 tgtaatgtcg gtaaccgtta ggttagacgc caagcatgta tgtagcgtta ttagtgtgaa
   216841 acataaattt agagtcagtg gcgtgaatgg tttgtgtgta tgtcggtaat acaggcagcc
   216901 cgctattagt acaataataa agcaaatggt aactggaaca ataatggttg tatctttgtt
   216961 attgctgtat ttttcggcaa ctggtaccaa cgatgttgaa gatgttggtt gattttggtg
   217021 cggtgggtgg tggatgaaat tacatgtatg tggtaggttg tgtttctttg tatttcgttt
   217081 ggaccactct gttgcataag taaatatgta gttggtccat aattgggtat attgtatata
   217141 tgcaatccag cgccaataca tgcataattt tctaccatgc atcctgatgg caaattataa
   217201 attttccttg cgtttttatg tggctttgta ctactacata actgttttag tgtaacatca
   217261 catgcgccac cttgtagagg tttaacgtaa tatccttgtg atagaaaact taaattatca
   217321 ggtggttgta aggttacgtt acttccaact gtaaccgttt tattaattat cctgttgtag
   217381 ctattgattg aatgcatgtg aattaggtgg agcggaaaaa ctgacacaat gaaacaaatg
   217441 tacttagact gtagacttac attttgatta ttgtgagcga aatgcatatt gtatatgcgt
   217501 gtatacattt catggaagag cattcatgca ctattgtgca cgtacgcgtc ggtaatacca
   217561 gcaacccata cctgctaagg cacttccagt tgtcacagta actattatgg gtatagtatg
   217621 agtagaagca gacgatttca gagggctata agatgataca gtgtgcatgg ggggggggac
   217681 gttggaaaaa cgatttgtat gttgtaagtg gtatttcttc tttgtatcgt gtaatcagta
   217741 ctagattgtt gcgttaatat gtatgttgtg ggtttttgcg tagatatgtt ataaatattc
   217801 aatgctgttt tattgcatgt atattctata tctgcacatt tcggttttaa tatacgttgt
   217861 acgccgttgc cttgggtttc ctcacacagc cttgttgtta aacaatttgg gtattgcgtt
   217921 acagcaaacc atacttgtaa tagaaatgaa atattatcag gctttggcaa actaacattg
   217981 cttccgtata cagccgttat attttttgta atatagatag ccgtttgttg tgacgcaaga
   218041 catgttagta gtaatattgt taaatgtatt ttgcataagc tttgcagtaa catgtatgct
   218101 gattgcgtta ggggtgtcag taggatagaa ttggtagcac aatgtaattt gtatttacat
   218161 atattcgtgt cctttgaagt agttttgcgg gattgccctc ttatgagcat atcggtaata
   218221 cgtgtaacct aaacccaaga ttaaacatgc aagtagtaat agtccagaca tagttaacag
   218281 ggtggaattc actgaattac tggattgtaa aagatcaaac tgtccagtgg gggggggaga
   218341 gaatattctg gctgtgttgt gagtattgtg ggtgtttttg atgtaatgtt aaggtaataa
   218401 aatgttttgt tttttctcgt ccaccaaatt tttgcaacca gtatgttgtg ggtgcatgtg
   218461 cacttatatt atacaaatgc aagaatgttt tgttacaagt gtgactaaag tatggcttac
   218521 aagattcgtg caagtctagt gtctgaacgg aataattatg gttatgatag tatatttcgc
   218581 atagtttgct taacattgcg ttattagaaa ttgtagagta acagggggat ggttttgtaa
   218641 tattaaaaaa ccatatgcct aatgtaaatt ggtctgagtg ggttttatct acgaaagtta
   218701 tgttatcacc agcttcaata gaataggtgc gtgatgaggc ttctagtttg cttatacttt
   218761 gatataaata tatatacata agtatgtaag ttagtatgga tatcatgttt ttatagcgtt
   218821 cgtctcttgt gtaggtgaca atagtaaagg taacaaataa caaggatgat tcctagcata
   218881 caaattacag taagtgctac agtgtaactt gaactatcag cttgaagagg ctccaaatgt
   218941 gaatgcaatg atatgttgtt taagtattgg gtacctgata taggtgtagt tagtacactt
   219001 tcaccaaata ctataagata gtagtatatg gtagttgatt gttcttcctc atccgtttct
   219061 actagtttgt atgttatatt tctagcaatg ttggtaatat tgtaaatgtg taatgctgtc
   219121 tcgttacatg tatagttacc agtttttgct gtattgtcgt tgaaagtatg tttaattgta
   219181 catccgcctc cgtatgttat ggtacatagt tggtgagatt ggttgtaaga tccgttattg
   219241 atataccatg tttttgttac cgttgttcta ccgttcaaac ccacaaaagt agcgctaccg
   219301 ccaattgtag catacaatgt atgtgacgaa ccgttcatgt agttcataat ataaaataaa
   219361 gatattatga acaaccatac aacatgtgtt ttcatttcgc ctgtgtatga gggagtattt
   219421 tcacagcatt cttcggcgtt tgcggctata taatgaataa ccaatagctg tcaatataat
   219481 tcccagtgtt acggttacaa taattggcgt agtgacgctc aaatcagttg attggagatg
   219541 gctgaagtgt tcatgtgata atgaagtggt ggatgtttgc atatgcggta gaaatgttgt
   219601 atgcaatggt tttatatagt aatatgtttc atgtttggat ttgttacgcg ttgtcgttac
   219661 taatttgtat gtaagtgtca catcatacat ggtaagattg tatatatgca acgccgttct
   219721 gttgcatgtg tggttaaaaa tgtctttcac ggtttctttt aggtcatatg ttttgatgga
   219781 gtccggttta cttctatgat ttacgttaca aagcgcgcaa aaatttttgc tacatagacc
   219841 gttttgaaaa taccatgttg ttgtagctgt attatttgtt acatgtgtaa agagtgttac
   219901 acaatcacca ttacgaacat gctgtgaagc ttctgtaata tgaaatagat accatgtaac
   219961 cagaatagtg gtgtccagtg cttgttttcg gtgggggggg ggcattttta cggcgttatt
   220021 ttgtatctgt ccgtaaaaaa ggttatatac agctgacaac ggacaatatt acagcatcgt
   220081 ttggtgtttg tagtgataat acatgtaaaa actaaatgcc gctaacaatg ttacaataat
   220141 tacagttaca actataggcc tagtgtgagg agaagatcgt acagaactaa aacttgcatt
   220201 gaatgctgtt ggtgctaact cgttggaatg tggcgtagat aatgtaggtg tagttatata
   220261 tgtagtactt ttggtgtatt ctgtaaatgt cgtgggttgt atgtgttctt tgggtgttac
   220321 gttcagaaaa taatcgtatg ttgtctcttt atcgttgtaa tcttcatgta ttaatctata
   220381 taatgatggt gtgtatgtgg taacgtggta taaatgtaat cctgtcgtgt tgcatgtata
   220441 actcattggt tgcccctcgt tatcctgtag tcggtgggtg gtggtggtgt gtttcattgg
   220501 gtaaattgtt tggcacaatc tacaatatcc gtttttagag tgttttgtag gacaggtata
   220561 ctgaacataa taccattctc ctttaaaaca attgttatat tggcattgta catctggtaa
   220621 tgttacattg tcaccgacat gagcataaat gtttgtaaat gatgtgtcgc tgtaaccagt
   220681 tttacataat aataaaatta ttgtagatgt gaaatgcagt atatgcttct ttatcattat
   220741 ggttttgaat tgttggcgtg cttatttcta cagcacagtt tggcgtctgt agcgataata
   220801 caggtaacaa aaacatgtca taacagtcac aactgatacg gttacaatga ttggcgttgc
   220861 ggtggttgca ttggaagact gtaaacggag tgaatgttca ttaaaccctg ccatggagct
   220921 gtttaaatgt gatgttgtcg tatgatgtgt gggatgttga ttcacttgga tccattgggt
   220981 aggtgtggtg gtaggatgtg tgctgcgttg ggttacttga gtaggtttga aatgtgtggt
   221041 acccgttatg ttaaggcgaa agtagtgtgt aactcgtgtt cctgagacat acatttttgt
   221101 aaatatgtac gatcgtggtg ttttcagact aagattatac aaatgtaatt tattatgttc
   221161 acatgtataa gttacgagtt gtttgcatgc actgggtgat gtaactttgt tattggagta
   221221 cattattgtg cataattcgc tacctaacga aatataataa acaccgtttc tagaacattg
   221281 ggtctgtaca taccacgctt ccgagaaagg cttttgagtt ggtaacggcg catcttctag
   221341 cgttacgtta tcaccaatct tagcagagat tattttggga gacgaagatg tgtatgtaca
   221401 cacaagtaca aataaacgta ttatgtacag ataatacagg atctgacgct tatcatttat
   221461 catggcgcag acatttactg acatttggcg tttatacctt tacatcgatc atgttgagtg
   221521 atggcaggtc gatgttcctt atgactttct ggaaaacgca gatttcccgt taatattagt
   221581 cattgcaaca taaccatgat ttcatccact tgccgggaag tcttattgac tcagaaccac
   221641 aggtagtttc gtcgaaactg cacgcccagt gaccgacaaa acacacctca ccgccaaggt
   221701 tacatactgg ccctctttat tcaacgtata aatcacacaa cagacttatg ggcatgatta
   221761 atgattggga attgggggac cccgttactt ggtcagccac agcgtggcgg gttgcttgtt
   221821 atcggtgaca gctgtcaaca catcaatagg cactttcttt tcttcgggca gcttaatcac
   221881 gtcacacgag tcggcctgct ccttcagctg acggtaattg ttagaccagg cgcgtatgga
   221941 gcgagcacac acgcagccgg acagaatcac cgccagggca aagcaggtca tggccaccgt
   222001 ggcgaatgac aggtgcacca tccatgtgtc ccagccgttc ccgagcctgt gcttagaaac
   222061 cccgttctcg tgggtcgatg catgctgcac ccgagatacc gtatagataa ccattccagt
   222121 cacttgtggt gccaccatgg ttctcacagt cacgttacaa atcatcaaca cgttgttatt
   222181 tgtgtggtcg tgcagttcgt acagccccgc atcctgtgtt ctgacattgt acagatggag
   222241 tgattgattg tcgcaggtca tggtcatgga gttccgggtc tctttcatca tgtagctgcc
   222301 tgtcaagctg caaatgacgt atcttcgcag gtgtttagat gttttggtaa cattcgagta
   222361 aatccaggat acagagtgac cttgaggcct gctgtagctg caggtcgcat tcccgcccgg
   222421 gcacactgcc acttgcgtca cattcggctg tgtcctcggt gaccccgtcg cgaaaccgga
   222481 tgctgctgtc atcgctattc ccgtaatctc caaaaacaaa aaaagtcccg gacacatgat
   222541 gctccgggtt tttccaaacc acttgaaaaa ctgcagaatc aacaatgtgt gcacccttta
   222601 taataagcag tctcgccgct tctcccatat ttcacttctc ctcacgcact gctggcacaa
   222661 cccctgcttt ccggggatcc gtgttcgccc gctccccttt gaccaccaag gaagtcgttc
   222721 tctccccgat ccgcgcaccc atctctctgc agacacctgc tatggacgcc tccaaggaca
   222781 actcctcttc gtctgcggcc aacgcctccg tcacggcaag gcgtcttgcg cgagtctccg
   222841 cctcttcctc cgaggagcgt tctccgactt cgtggctcct ggagctgctc tccgcggccc
   222901 tctccacccc tcgctggcgg gccgtgctgc tggcggcctt cgagacgctc ctgtggcagg
   222961 gccagcggat catccacggc cgggtacgcg gggacgggtt cggggaggtg ctaatgacct
   223021 tcgtcgtaca gtacttcatg cagcggtggt ggtccgtgga agagcccgac gatccggagg
   223081 ccgatgaaca cgaacaccag cgtcagccac gccagcagca gcaggtagcc gccgaggaac
   223141 agcgcgcgcg ggaggaccca cacgaacgct tccagcagcc actcggcgac gggcttgatc
   223201 atgctgttaa cgagctcgat gaggcctatg aattccacga tgttgctgcg tgcctccatg
   223261 agccagccga cgaggggaat ggcgaccacg gcgagggaca gcgacaggca caggcacact
   223321 cgccagacgc catcttgcag aacggctccc cctgggactg gcatgatgta actccgggta
   223381 acgcggaagt atgacaaggt actgcaagtc gggccccccg gcctgcaaaa taatggaccc
   223441 gcagcgtagt tgtagcagac tcagtcgagg cactggacac acggggaaac aaacacaggg
   223501 cacgcgcaaa gtaggcacgg acacacgata cactggaagt agcgcctttt tattacaata
   223561 aaaggtttgt ttacagcaca agtcactcgc gtttcctatg tgttctcttt atgatgatcg
   223621 ctactgttgt cgggccgttc gtccgcggca cctgctgcac tcgtgttctc tccgctcgcc
   223681 agtgcctctg cgtcccgctc gtagctgtcc tgttggtagc tctcaatctg atacctgtcc
   223741 ccgtcctcat ctccttctcc gtcttctctg tcttctcctt cactgccctc ggactcgtcc
   223801 gccgactccg tgtcgctgga cggcaggctg tctgcgctac tgtagtagct gctgctactg
   223861 tctgtgtgaa tgattctcct gcgtctcaag cgaggcgccc cgggcgcact ggctgtgtcg
   223921 cgcaggtgtg ccagcgtctc ttccagccgc tccacgctca agtctcgctt ccaccactca
   223981 tcagcgggcc gtgtgttggc agtcactttc cgcccggggg cggtaaaggt gtcagtcacg
   224041 atccaggcgc cgcgctctcc gcgctccgcc aggcggctcg tgcccgtctg cggcacggct
   224101 ctcagaatct catgtttcaa aagcactctg gggacgtgtt gcagctcggt cgtgtggatg
   224161 gtgtaccgtg tgtactgcgc acctgtgtgc gtctggggac gcatgggcca gcgtggcagc
   224221 agccctcggg cctcggcctc cctggccgac ggccggttca ggtgcacgcg ggggccgtgg
   224281 ccgccgagga ggaacactac atgctgggtc cacacggggc gggactcgcc atcgggacct
   224341 gggatggcgc ggtagccgta gccgcggcct cgcagcacgt cccaggctcc ggacttcatg
   224401 gggccgtctc gtgtccgcga cactaacagg ggcacgatgg gtctctgcgc tttctccgcg
   224461 tactctcccc acaggcacca gcagtctggc tgctcgcgcg cgccgcggtc cgggctcatt
   224521 cgctccgtgt accccgagtt catgtgacga cgcgtcaccg ggtagccgcg cacgcggagc
   224581 gcgtcgtcgg cctgatctcc gacgggatcg cgggatgcgc gggcgtgggc cagtttgaca
   224641 cgttttcggc gactcaggtg aggtctgcgg caggtgcgag ccgcggacgc aggtgtgtgc
   224701 cgcgcatccg atgccgtacc atcacggggc ggaaggccgg tgcgtgcggc ctcgtcgtcc
   224761 ctggaggatt gggtgcgtgc ggcggctgcc gcaccgggca agtattgcag gtgagacggg
   224821 ctccgcaggt gttcttcact gcttgtacct ggctcctcac gtgtgaaggc ttggtcggag
   224881 gcggagtcgc tgagggattc gctggccgag tcgctgctgc tgctgtcggt gctgtcgctc
   224941 aggttccaca gccgccggcg atacttgttc acggcctcct cgtcggagtc ggagtctccg
   225001 gagtagtccg tcagcgggtt gttggtgtgg tccatgttgt cttcgcaggt gcccaggtac
   225061 gtgtcacctg cgtacctgga gtctccgcac acggcgcagc cgatacctgg gacgcggatg
   225121 gtgcaggtct gccagcgggt taacgtgcgg tgccatggta cctcgtgccg cggcttccgc
   225181 tggcgtctgt gcaggcggcg ggtgtggtcg tgacgggacg ggcggtagga tgacatgctg
   225241 gaggtagctg cggacacgac ctgagcgaca caacaaggca caggagtggc ggcagcgtta
   225301 cactcggcgg agatttagag cccccctggg attaggggcc caccccccgg ggtaggtctt
   225361 gcgtttgggg ctgcaacatg gctgtgctca cctcggtttc gctaccaagt gtggaatctg
   225421 agtgcgttgc cagcggtgtc gggcaagggg tagcgctcgt agctggcgaa gccgttgggc
   225481 cgaggttcag actgcggtct gagtggcgct gcaggtgttt gcgttggcga aacacgacgc
   225541 cggagcgcct ggaacagccg tacgacagga tcgtgggggc agaatgcgcc cagaggctgt
   225601 agcattgtgt gtgcgcctgc agggaatcag cgttgattat atgtcgtgac agcggtgatt
   225661 gaaggctcgc tcgcacgtca atcacacatg acgcgctttc atgcacagct caaacagacg
   225721 ccccgccccg aaagcccccc ggggccgcca ccccggggcc cctggggcgc actaacattt
   225781 gcggtcatcg gcgttgatga cacagcgatt cgttccgctg cagcgcggcg ccctgggcca
   225841 gagcactcac cgtggcgggc gggcgacgcc aatgtgcctg tcggggcttg ccggcggcgg
   225901 ccgcctgcag ggtttcggcg agcagaagcc tggatcgcgg tgtgcagcat gggttttcac
   225961 tgctgataat gctcgttcac cctcaccgtt gatagtaggc gccgcggttt gccggccggc
   226021 ggctgcgcgc ccagtgccgc cgcacacacg ctcgacgtcg gcgcagtggg acccggtggg
   226081 gcga
//
DBGET integrated database retrieval system