GenomeNet

Database: RefSeq
Entry: NC_033176
LinkDB: NC_033176
Original site: NC_033176 
LOCUS       NC_033176             224064 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Cynomolgus cytomegalovirus isolate 31908, complete genome.
ACCESSION   NC_033176
VERSION     NC_033176.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Cynomolgus cytomegalovirus
  ORGANISM  Cynomolgus cytomegalovirus
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Cytomegalovirus; unclassified Cytomegalovirus.
REFERENCE   1  (bases 1 to 224064)
  AUTHORS   Burwitz,B.J., Malouli,D., Bimber,B.N., Reed,J.S., Ventura,A.B.,
            Hancock,M.H., Uebelhoer,L.S., Bhusari,A., Hammond,K.B., Espinosa
            Trethewy,R.G., Klug,A., Legasse,A.W., Axthelm,M.K., Nelson,J.A.,
            Park,B.S., Streblow,D.N., Hansen,S.G., Picker,L.J., Fruh,K. and
            Sacha,J.B.
  TITLE     Cross-Species Rhesus Cytomegalovirus Infection of Cynomolgus
            Macaques
  JOURNAL   PLoS Pathog. 12 (11), E1006014 (2016)
   PUBMED   27829026
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 224064)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JAN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 224064)
  AUTHORS   Burwitz,B.J., Malouli,D., Bimber,B.N., Reed,J.S., Ventura,A.B.,
            Hancock,M.H., Uebelhoer,L.S., Bhusari,A., Hammond,K.B., Espinosa
            Trethewy,R.G., Klug,A., Legasse,A.W., Axthelm,M.K., Nelson,J.A.,
            Streblow,D.N., Hansen,S.G., Picker,L.J., Frueh,K. and Sacha,J.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-AUG-2016) Vaccine and Gene Therapy Institute, Oregon
            Health and Science University, 505 N.W. 185th Avenue, Beaverton, OR
            97006, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to KX689265.
            
            ##Assembly-Data-START##
            Assembly Method       :: Geneious v. 8.1.4
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..224064
                     /organism="Cynomolgus cytomegalovirus"
                     /mol_type="genomic DNA"
                     /isolate="31908"
                     /host="Macaca fascicularis"
                     /db_xref="taxon:1919083"
                     /country="USA"
                     /collection_date="12-Feb-2013"
     repeat_region   1..880
                     /rpt_type=direct
                     /rpt_type=terminal
     gene            1309..2718
                     /locus_tag="BWV06_gp001"
                     /db_xref="GeneID:30855186"
     CDS             1309..2718
                     /locus_tag="BWV06_gp001"
                     /note="similar to HCMV RL1"
                     /codon_start=1
                     /product="Cy01"
                     /protein_id="YP_009337446.1"
                     /db_xref="GeneID:30855186"
                     /translation="MPRTPGACANTTSPFALSPLTRWRACTIFLPAQRCPTCGDWSTA
                     EHESGTCRAPDADLTDYSGGSTSDDEAVTAYARALRSMPTNPSYAKHLSSSSTRSRSS
                     RTRHRQCRRRPPSSTPHSPVHRLPTPSLSSSTSDTSPSPAHTCPLAHLRTPPHNPPPP
                     TTRKQYDPLGDQADEALRIYGYPISRYDMRTGTADRLSPDRGGPLEPNCWCLWGVHAH
                     KNHRPIISLLTARTRDGPTKSGGWDVLYGRGYGYRAFPGPEGESRPVWTQHIVFLLGG
                     HGPRLQLNRACAREAEARGLLPFWPVPSPKPSSSTDSDSSLDRIPRSHLPRILQKHTA
                     RLALSHTSTSRQAERAERGAWIVSDTFTAPGLRNTWNTRTHEEFWQRNYIKDYMEHSV
                     FLPTSPNRFYDPFQSRRPCRHSSTSSSDTDDSDDEENTTVPIAPDDTYIPPNESCKHS
                     QPETESHTFTTPETETTRL"
     gene            complement(2855..3553)
                     /locus_tag="BWV06_gp002"
                     /db_xref="GeneID:30855014"
     CDS             complement(2855..3553)
                     /locus_tag="BWV06_gp002"
                     /codon_start=1
                     /product="Cy04"
                     /protein_id="YP_009337447.1"
                     /db_xref="GeneID:30855014"
                     /translation="MRASGDSCRFNTPRFPIGARRGKCVRSPLPWRQRRPPLYSADSL
                     RTCCAAGRRANMALVPCSSATERDELLERVEELVDAFDTPWWRACGRAFVNTMEWEAT
                     RYIYTRERQKWSNILLSFAARWLVEYLCPTKYTYASECEEYAQQSDPRQNHNVAKQEQ
                     QARYEPEACVQQPVRRRDEAIGTILSGEVVRPTQQWSAQQQEEAERRHSALEAWNWHF
                     GDAKGENGQQRDEL"
     gene            3680..4501
                     /locus_tag="BWV06_gp003"
                     /db_xref="GeneID:30855015"
     CDS             3680..4501
                     /locus_tag="BWV06_gp003"
                     /note="RL11A"
                     /codon_start=1
                     /product="Cy05"
                     /protein_id="YP_009337448.1"
                     /db_xref="GeneID:30855015"
                     /translation="MCPGLFTYITLTGMVMHAVSGNPRQLLCNVTRFPGTNVSQVRLS
                     AGDNVTFLYNVSQGHSLTWLYSNLTANSSRHLRKYTLCSVTSSYRMTETRNNMCLHCN
                     RSSLTLCSARPQDSGLYVLRDETNNTDVMRCNVTVTGNGQLSVTHRPHSRPTVTRISS
                     AHLSGITLGHEKHPPNTWNTWMVHISFATMALACFGVAVVLSGCVCLRSVRAWTQKYR
                     PLNEDPAPQKLDFPDGTMKEHPHVTVIEPTKSADGTVVGLSAVSDDKPATLWLSR"
     gene            4864..5487
                     /locus_tag="BWV06_gp004"
                     /db_xref="GeneID:30855016"
     CDS             4864..5487
                     /locus_tag="BWV06_gp004"
                     /note="RL11B"
                     /codon_start=1
                     /product="elongated Cy06"
                     /protein_id="YP_009337449.1"
                     /db_xref="GeneID:30855016"
                     /translation="MVITIVILYFLVKPLNSSPDIHTYAVPIGGNVTLSDFTNDITHY
                     ILGTWYFTSSLGMCQIDISDNDRHRKLCNIFYAQKECETLTLWSACKLAIQHSCNMTT
                     LTIYNVKHYTPKDYTLKKRHRNSTETTQYYRIQLVLPTTQIPKTNTVIFPPPPENPGA
                     LTSANSSYTTTIIVTGVLSILLVILVLMYCYKNKSPSQHEHWYKTLF"
     gene            5459..6082
                     /locus_tag="BWV06_gp005"
                     /db_xref="GeneID:30855017"
     CDS             5459..6082
                     /locus_tag="BWV06_gp005"
                     /note="RL11C"
                     /codon_start=1
                     /product="elongated Cy07"
                     /protein_id="YP_009337450.1"
                     /db_xref="GeneID:30855017"
                     /translation="MNTGIKHYSSYVCYSIIFMFRDSSCSEDIFYNYSAVTGGSVTFF
                     DVTGLNGFAKGTWYFLPANDSCYRTLLTNDALAKLCSIYYHIELADLITTTSSCPTYF
                     NHTCNITSLSLYNISDKAPTSYKLVKNTDRGIKNVTYYNLHIVLLDNEFPSQQAHLTR
                     PRDSPYNTPIIVIVVLLIVIIAIVYMQYSHKEQNSGNKRHELIHFEI"
     gene            6245..6856
                     /locus_tag="BWV06_gp006"
                     /db_xref="GeneID:30855018"
     CDS             6245..6856
                     /locus_tag="BWV06_gp006"
                     /note="RL11D"
                     /codon_start=1
                     /product="truncated Cy08"
                     /protein_id="YP_009337451.1"
                     /db_xref="GeneID:30855018"
                     /translation="MTQLCFMFIYIILQHTCSSAQTISYTVIYGSNITLEKPKNNLQV
                     YTWFYRNTNKGECPSDPETDISTYEDIKLCENASNKLHRYNRKKQCMPEQYNCTSAGL
                     HLYNVHNQGTSTYLLIQQDSEKSPHATANTTYIVNIVSSTTPTLSPNPTTMHIVTLAG
                     SFAQVSSKNNHISTVVVSIILTLMLITGLSCFCYRRQLYRYLR"
     gene            complement(8125..10658)
                     /locus_tag="BWV06_gp007"
                     /db_xref="GeneID:30855019"
     CDS             complement(join(8125..8582,8697..8844,8949..9566,
                     9655..9836,9912..10055,10157..10300,10392..10508,
                     10598..10658))
                     /locus_tag="BWV06_gp007"
                     /note="viral COX-2-like protein"
                     /codon_start=1
                     /product="Cy10"
                     /protein_id="YP_009337452.1"
                     /db_xref="GeneID:30855019"
                     /translation="MRKIFFFFSFISYCTFLNHAANPCCSHPCQNRGICMTVGFHQYK
                     CDCTHTGFYDHDCTTPELLTRIKLLLKPDPDTVYYTLTHFSTIWWLINNIPFLRHAVM
                     RYILTSRSDLIDSPPIYNADYEYPSWEAFSNLSYYARILPPVPHDCPTPVGVKGKTKL
                     PDAAHVVEKTLLRRTFTPDPQGTNLMFAFFGQHFTHQFFRTDLARGPAFTKGLGHGVD
                     LNHIYGETPEKQTKLRLFKDGKMKYQMIDGEMYPPSVKDVQVHMIYPPEVPENMRLAV
                     GQEAFGLVPGLMMYATIWLREHNRVCDVLKQEHPEWSDEQLFQTTRLIIIGETINIIV
                     TQYVQQLSGYHFQLLFKPELLFGTSFQYQNRIFSEFNMLYHWHSLMPDAFEIDKTKYD
                     YVNFVYNNSILMTHGITQLVESFTKQIAGRISGGRNVPPALRRVSRAAIEHGREMRFQ
                     SLNQYRKRFRLKPYESFEELTGEKEIAAELRALYGDVEAVELYTGFLVEKPRPNAIFG
                     ESILELGAPFSLKGLMANVICSPGYWKPSTFGGDVGFGIVKSATIQSLVCSNVKGCPL
                     AAFRVPDEELLKARNGSSSSSSSSPPSPSSSSSSSSSPSVQQHVDPGVVIKREHAEL"
     misc_feature    complement(10396..10506)
                     /locus_tag="BWV06_gp007"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    complement(join(8302..8582,8697..8844,8949..9566,
                     9655..9836,9912..10055,10157..10244))
                     /locus_tag="BWV06_gp007"
                     /note="Animal prostaglandin endoperoxide synthase and
                     related bacterial proteins; Region:
                     prostaglandin_endoperoxide_synthase; cd09816"
                     /db_xref="CDD:188648"
     misc_feature    complement(order(8428..8430,8437..8442,8449..8454,
                     8464..8466,8476..8478,9087..9089,9093..9095,9105..9107,
                     9183..9185,9189..9191,9201..9206,9213..9215,9721..9723,
                     10161..10163))
                     /locus_tag="BWV06_gp007"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:188648"
     misc_feature    complement(order(8374..8379,8383..8391,8395..8409,
                     8416..8421,9126..9149,9237..9239,9246..9251,9258..9260,
                     9267..9272,9279..9293,9561..9563,9985..9987,9991..10005,
                     10024..10032,10036..10038))
                     /locus_tag="BWV06_gp007"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:188648"
     misc_feature    complement(order(8794..8796,8803..8808,8812..8814,
                     9024..9026,9075..9077,9084..9095,9102..9104,9363..9365,
                     9700..9708,9715..9717,9727..9729,9739..9741,9967..9969))
                     /locus_tag="BWV06_gp007"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:188648"
     gene            10860..11555
                     /locus_tag="BWV06_gp008"
                     /db_xref="GeneID:30855020"
     CDS             10860..11555
                     /locus_tag="BWV06_gp008"
                     /note="RL11F"
                     /codon_start=1
                     /product="Cy12"
                     /protein_id="YP_009337453.1"
                     /db_xref="GeneID:30855020"
                     /translation="MYLYITFIILMFSTRVESVSLLIKNYTVTWNSSVILKDVDNNTM
                     NNLGEWAAYLVNTTVCPNTNVTLCMINPHLLPNKTDNRTNNTRISQCLNMTTFICNTT
                     LQITNITNETHTDYMLTRYRNCTNGDNSNENTEPEYTQFHLEFTMTTLPPTTVLPTTA
                     IETTTSGYTTTSASSDLELSKSFSMASISIPIIVFAGGGLLLGLGYYACTQGWYPCRT
                     ETTSSTQTERLLS"
     gene            11750..12316
                     /locus_tag="BWV06_gp009"
                     /db_xref="GeneID:30855021"
     CDS             11750..12316
                     /locus_tag="BWV06_gp009"
                     /note="RL11G, similar to HCMV RL13"
                     /codon_start=1
                     /product="truncated Cy13.1"
                     /protein_id="YP_009337454.1"
                     /db_xref="GeneID:30855021"
                     /translation="MTKYTCFKSLSTCGIFMLLVNLTLACDSQCACNSSCGFAYNVTH
                     VSGYEHSNVTLHTSISHINISNMHIGHWIRYNYPVNSYALCTVSGENVASTKHDGWSF
                     ECNGTSLTLHNLSADQTGSYIFKKYPRTDGALYRHRATYSTAAGSSGDYRNQLLTYLF
                     QRTLLAKRNHEDHNHDNDDAKDLNNYHY"
     gene            13172..14269
                     /locus_tag="BWV06_gp010"
                     /db_xref="GeneID:30855022"
     CDS             13172..14269
                     /locus_tag="BWV06_gp010"
                     /note="RL11H"
                     /codon_start=1
                     /product="Cy17"
                     /protein_id="YP_009337455.1"
                     /db_xref="GeneID:30855022"
                     /translation="MKTHLFRLMCAYSMIFWPILAAENSTNSSSNVNATTELTTVSTT
                     PRSTNSSCLNNTTWTTTYGSASTSQENTTPPISTTDTSTSHTSPNASFTSNVTVTPYT
                     TALPNESTNMSINISYTTTTSLTSTPKINVTTPPPWPFEMHGHYFTLWVNNCYCGYLK
                     VLPGSNVTFNGTRTNESDSIWFLARYFNYWLCIFTDDANYTMDYINLTHTCTSETMTL
                     WNVMEGNSGIYFQRRTDRHKYDSTYICYILNVTTDAANTTYPEITSTKCHRPPWKNRP
                     DFASIEAHPITPDYEELSIQELLESLSVKGGLRGSLLKFVLRFGWLCGIVVGATVTLI
                     IILKLPQKLCFLSSFVPQHRGYKRLSSNQIL"
     gene            14351..15298
                     /locus_tag="BWV06_gp011"
                     /db_xref="GeneID:30855023"
     CDS             14351..15298
                     /locus_tag="BWV06_gp011"
                     /note="RL11I"
                     /codon_start=1
                     /product="Cy19"
                     /protein_id="YP_009337456.1"
                     /db_xref="GeneID:30855023"
                     /translation="MQISRLVYASLAVFWAAAVIHGQTSDSSSKTTTTLWANKNSTSQ
                     PTTIQLTTEPTASGYRNGSHRNGTAAPPWTTIADDNTTTLPPWPIEIQSTYFSLWVNG
                     CYCGSLSVLPGVNVTLNSTKKQNNTETLWFRLGFWTDLLCIFYFDNDNDSVKYDHLKF
                     TCTQNNITLWNVSEKYSGIYCERQMSLTTYNSTYICYNLTVTADATNATEPSIVTTKC
                     YRSREYYYADDTSVGTSTTSDSALNIDEILNSRRHFRDNIQSNLLGSVLQFGWLGVIV
                     IGSTITLALVFRVPQKFCYLFYRWKHSYRGYEKIPGQIL"
     misc_feature    14672..14956
                     /locus_tag="BWV06_gp011"
                     /note="Adenovirus E3 region protein CR1; Region:
                     Adeno_E3_CR1; pfam02440"
                     /db_xref="CDD:308189"
     gene            15356..15946
                     /locus_tag="BWV06_gp012"
                     /db_xref="GeneID:30855024"
     CDS             15356..15946
                     /locus_tag="BWV06_gp012"
                     /note="RL11J"
                     /codon_start=1
                     /product="Cy20"
                     /protein_id="YP_009337457.1"
                     /db_xref="GeneID:30855024"
                     /translation="MKILMMLIFVICDSQTIYLPTCSLKTCCIGDDVSLNSNIPIGCN
                     ITTWYRHKNNSGVMLCSFSGGGMTSSSKERINRTCSRQSFIFLNIQLPSTGTYYVVGN
                     NCTTSPLMSTCYNVTVEPRSTTAMTVMTQNVNITAILPQHLASKSNATTFENETVTVH
                     GAWGLVIVALLFLWVAIEFRLHQKVCAYFRNYVTTL"
     misc_feature    15461..15715
                     /locus_tag="BWV06_gp012"
                     /note="Adenovirus E3 region protein CR1; Region:
                     Adeno_E3_CR1; pfam02440"
                     /db_xref="CDD:308189"
     gene            15978..16661
                     /locus_tag="BWV06_gp013"
                     /db_xref="GeneID:30855025"
     CDS             15978..16661
                     /locus_tag="BWV06_gp013"
                     /note="RL11K"
                     /codon_start=1
                     /product="Cy21"
                     /protein_id="YP_009337458.1"
                     /db_xref="GeneID:30855025"
                     /translation="MYTLNLVMIIVYVMVTKTLLIDVSTYLRCKSDFGSSRTCTQQNK
                     SAYTGQNVTLGINMTKDRSASWHRKTIQGTMLLCQYSDSTNCNSYNDICYRCLSNYSL
                     LLLDVTSHYNGLYYLSYLNDNNQYADLCYNLTINIQLNISQTLINRTTIECIPKSNIN
                     INTVKNKNVNNKRITNIESYTNHSPNIQYTWMLLPFIITIAIVLIWNFMPKKYSRLKS
                     HREYTRIQY"
     gene            16862..17539
                     /locus_tag="BWV06_gp014"
                     /db_xref="GeneID:30855026"
     CDS             16862..17539
                     /locus_tag="BWV06_gp014"
                     /note="RL11M"
                     /codon_start=1
                     /product="Cy23"
                     /protein_id="YP_009337459.1"
                     /db_xref="GeneID:30855026"
                     /translation="MLVQYTSTIQISTIYLGILFLRSMYSDTSSSKKLTCIPISSTAG
                     RNVTLNPPPFNHHTTYVYWYRQIGKGTNELCRYVPNKQERNARIKFQCLNNYSLLLIN
                     VTASYNSNYTVKLDLGLGTMSITCYTLTVKTTTQMVKTTTRKPTTATSTTSTTTATTI
                     QTTFTTKSPNTNVHSDSDPEAMVSLNETNEMQIREHTNLHAIWLLLPVLIVIICFFTA
                     NSKTTEL"
     misc_feature    16964..17509
                     /locus_tag="BWV06_gp014"
                     /note="envelope glycoprotein M; Provisional; Region:
                     PHA03240"
                     /db_xref="CDD:165499"
     gene            17590..17952
                     /locus_tag="BWV06_gp015"
                     /db_xref="GeneID:30855027"
     CDS             17590..17952
                     /locus_tag="BWV06_gp015"
                     /note="RL11N"
                     /codon_start=1
                     /product="Cy24"
                     /protein_id="YP_009337460.1"
                     /db_xref="GeneID:30855027"
                     /translation="MNKKGSFVWIMWHIPQLYICYVTNTKYEIDNNGTNTSLGTPTFE
                     AITASKVYIAVPNVHTAHDDSNPVGSHGKGQNDDDYANTTTVIILVILFIVIILLFFR
                     IPQRCWEGYQKTMVNSPY"
     gene            18031..18705
                     /locus_tag="BWV06_gp016"
                     /db_xref="GeneID:30855028"
     CDS             18031..18705
                     /locus_tag="BWV06_gp016"
                     /note="RL11O"
                     /codon_start=1
                     /product="Cy25"
                     /protein_id="YP_009337461.1"
                     /db_xref="GeneID:30855028"
                     /translation="MLPTLGEYGWFGYIGVTCLLVVTQLIDTSGHKCSKTETRTGTVG
                     TNITLVTSPPPNNKGLLYWYKPNCTSNDRLCDYSGFTGNNAVSNKTKLKFSCMNNSTK
                     LTLINVTAHYSGQYCSRTITSNGSVDICFNVTIHLHTTPAPSPLPVPFQTIPGWNHHT
                     TILQVQIPSSGQPGSYESQQQDAAHIASILILLLLFIAIIILFFLKIPQKLWEKYHKG
                     KRAPSA"
     misc_feature    18148..18435
                     /locus_tag="BWV06_gp016"
                     /note="Adenovirus E3 region protein CR1; Region:
                     Adeno_E3_CR1; pfam02440"
                     /db_xref="CDD:308189"
     gene            18902..19528
                     /locus_tag="BWV06_gp017"
                     /db_xref="GeneID:30855029"
     CDS             18902..19528
                     /locus_tag="BWV06_gp017"
                     /note="RL11P"
                     /codon_start=1
                     /product="Cy26"
                     /protein_id="YP_009337462.1"
                     /db_xref="GeneID:30855029"
                     /translation="MLCYKTPSGEVELKAQNRDIPYICLENSTELLWCNAWQNHSGIY
                     CHSVFTPSNDGINRVDTCFNLTITPKTTTTKKTTTKKTTTTTTLASKLKTRSTPVIKK
                     PHIDGTPPPSHNKPSLQKPPLKTQVHTTLTTLLQSYPSLTTTPGYEVVQHTPEKQVQN
                     VTHLATIVVLIVVFVGIVTLFIFKIPQKLWRKHKAKTHAPFLERDYDY"
     misc_feature    <19316..19525
                     /locus_tag="BWV06_gp017"
                     /note="Domain of unknown function (DUF4366); Region:
                     DUF4366; pfam14283"
                     /db_xref="CDD:316775"
     gene            19673..20281
                     /locus_tag="BWV06_gp018"
                     /db_xref="GeneID:30855030"
     CDS             19673..20281
                     /locus_tag="BWV06_gp018"
                     /note="RL11Q"
                     /codon_start=1
                     /product="Cy27"
                     /protein_id="YP_009337463.1"
                     /db_xref="GeneID:30855030"
                     /translation="MNLTWTRLILLSNQLQMIWTLDCTITKIVTTQSGANVRLGDSSR
                     QGNIVWHQPPCNNEQDVLCNKTSRSEEMLFINKSISFMCEQKSNMLNLRGLTPGNSGQ
                     YCKTISTTRNGKKESYRECYNLTVISNIKSTTPTIMTTQQETSSHRTSNVTTPSRFLG
                     RTVNNKRERYDDLAPALELVGFLFFITIVVLFCLRTELFEGV"
     gene            20283..20906
                     /locus_tag="BWV06_gp019"
                     /db_xref="GeneID:30855031"
     CDS             20283..20906
                     /locus_tag="BWV06_gp019"
                     /note="RL11R"
                     /codon_start=1
                     /product="Cy28"
                     /protein_id="YP_009337464.1"
                     /db_xref="GeneID:30855031"
                     /translation="MNIYMHKYILQWNIAISLVHTCIQSAYPCKITSLINVTAYETVV
                     LNATLALDKCFIMWYKSPTEGMCQYNASHAMKASSYNGKLNYTCTYYTLTIFHANSSA
                     TGMYYTLGAPNDECVREKICYKVQVQFTVQHESLIVTQISPLLQINHSMSESTIIWYI
                     FVASGLFIIIFYLAKNAHSYWKHGHYRVPQIWWIQVNEPEAYRAMIS"
     gene            20981..22240
                     /locus_tag="BWV06_gp020"
                     /db_xref="GeneID:30855032"
     CDS             20981..22240
                     /locus_tag="BWV06_gp020"
                     /note="RL11S"
                     /codon_start=1
                     /product="Cy29"
                     /protein_id="YP_009337465.1"
                     /db_xref="GeneID:30855032"
                     /translation="MLEQRYRVTYKCQIILVSILAFIINLHCSFYVSKAINVRTGDNV
                     TLNATLKLENGIGFWYYNNKTLCKCTSKNPESVSRPPLQFSCNRNCTLLLFNMTSHNA
                     GDYCLMTEPISENEKNVSCYNVTVLPTNFNSTITTQSPLSIMVTTTPVLTTTTRTTPL
                     ITNGTKKNRNKLGSTKAPTTALHSSKPLLTTVTTTAATTVPLTSSTTVTTTAHTALTT
                     GIAPLTTVTTTRNALSTGIVQLTTVTTTAKTASPDSKTHSNIQNAATTSVHTTEGNTT
                     ALTTNSKPATTLPTTTYSTVPPTTVATASTLSTTLPTTRWYTTSTSTSTKQRNTQTSS
                     YQTTTPLLNSPTPTTSSQNETKSPHVKHHNAHHHHAVTHAFWVILLIVVIVIIILWWN
                     KIPQRLFQHYQEQKYGGVALSDDWQFY"
     gene            22356..23666
                     /locus_tag="BWV06_gp021"
                     /db_xref="GeneID:30855033"
     CDS             22356..23666
                     /locus_tag="BWV06_gp021"
                     /note="similar to HCMV UL13"
                     /codon_start=1
                     /product="Cy31"
                     /protein_id="YP_009337466.1"
                     /db_xref="GeneID:30855033"
                     /translation="MARHRCHKCWLLWLTVILGSWIHLLNALEIVEEYVEEQEIIMQT
                     TRQMALRLAAAPVRGRRQEIDGRPPSIPSWLDVRSPRPPRRHDENTMQRNIRWQHEQM
                     QVLMSLHHSRMQARGWNPDQRTPDRLPAHFGRSASGSRPVPIQRIGTSTRPTPMAEEA
                     EEPRVTIVRNRRPDNSSPGPRLPHKRRNAVTFTGSTDSLDLTRLRLSYERRHRKGYYR
                     WKHHGKRSPTVKAHIPPPRPTISDPMEFRPAPSPVPQRRTLNERFNDLLRRHSAHENI
                     RHKWHVRPKDDPVWIYNDGESEVTSIGERASLLTRTRSWIQSHMHRTYTWRLGSSGGG
                     NEPLVRSLSTEQPRNNNANQSRLHSPSESVQVNLETGEVVVTCHNTGANEQQHVLTSN
                     QLCSRNSMEVTDACDRETPRRALLGSSIALWLSGMWMRHYRKSS"
     gene            23941..24852
                     /locus_tag="BWV06_gp022"
                     /db_xref="GeneID:30855034"
     CDS             23941..24852
                     /locus_tag="BWV06_gp022"
                     /note="similar to HCMV UL14"
                     /codon_start=1
                     /product="Cy33"
                     /protein_id="YP_009337467.1"
                     /db_xref="GeneID:30855034"
                     /translation="MYFIIVLLITILTIDCVPPAYWDQFLHPSMDNGEVSAPLMPPYG
                     DRFNLTCDFPTGDWSEAALQIRFCYHPSCRSFLMVTPKDINGEFKNKSDNHLPELQWK
                     LETVGPVQRLTVSFLVVSSVSGIYRCTILTGINIEVLKTVIIIADVELRRRPDTYCDI
                     RFSHLSQLQYLWTPNPDKVRLLNCGEVRERNSLWQKHVHYAVGMSGLEPSCTVNRDMV
                     LCHRYVAESLRDNNCTRAAEEKRAMILRGKPLEEDWFWMCMAGMFTVCIVGILTLCLR
                     LRYKRHLDWSHDLESEETRRRRLKKRN"
     misc_feature    23941..24849
                     /locus_tag="BWV06_gp022"
                     /note="Herpes-like virus membrane glycoprotein UL141;
                     Region: UL141; cl27780"
                     /db_xref="CDD:332601"
     gene            25764..26090
                     /locus_tag="BWV06_gp023"
                     /db_xref="GeneID:30855035"
     CDS             25764..26090
                     /locus_tag="BWV06_gp023"
                     /note="similar to HCMV UL17"
                     /codon_start=1
                     /product="Cy35"
                     /protein_id="YP_009337468.1"
                     /db_xref="GeneID:30855035"
                     /translation="MEHALFDHFFGRPRVSVSRHSLLRAENECDDDEEYPPIPRVPQV
                     PPRVSQTTRAAWNIVDVCRLLPLHMRLMVAEEEEKMTLTTSPRTHKKKPRKFVEISPR
                     IRRLFT"
     gene            26416..26703
                     /locus_tag="BWV06_gp024"
                     /db_xref="GeneID:30855036"
     CDS             26416..26703
                     /locus_tag="BWV06_gp024"
                     /note="similar to HCMV UL19"
                     /codon_start=1
                     /product="Cy35.1"
                     /protein_id="YP_009337469.1"
                     /db_xref="GeneID:30855036"
                     /translation="MSQLLYECFKRQLPRKPTNSVLFLNRRALTGKTEKMTSMATSTH
                     RTLLVVDHGKLRLERPSTSETTQTALALSLQRFALQSSGDDPEQDDMDNND"
     gene            26812..28182
                     /locus_tag="BWV06_gp025"
                     /db_xref="GeneID:30855037"
     CDS             26812..28182
                     /locus_tag="BWV06_gp025"
                     /note="similar to HCMV UL20"
                     /codon_start=1
                     /product="Cy36"
                     /protein_id="YP_009337470.1"
                     /db_xref="GeneID:30855037"
                     /translation="MHCINMPLRTLASCLVFLTLFVYLHSDYVYVSVLTRSHGLTWTS
                     VGAVNETDANNLSNYSFTQTNVSDSSNNSSNGNGSVTEMPANCLLRSNAYVSTIWIFN
                     CTNDTTPTMTEFWYLGHGYNHSNESCKSSLVNYLNSMCTIWTNYSDGANSSRKDHLST
                     TEVRCLLPESYSVNTTIHQYNDTNTESENQGSKYHEMFPIQHTCSLVEALAFDIVERY
                     VYISRLCWNLAQIFALLCIVTVSLVVWIRFQYCGKIPCMCLLPPNVSAVPTCQDVIVE
                     SSVNQPEEDNTSLNSPVEPESSEITPILSASEKTCVQKPSVPPKPPTVSSQFKVMHAL
                     NKPCMLPKPPPKPTSLQSPKPDVFTFDEQDIQKHKEEISQQQVKPKRIPVLPHPTSTL
                     TRTTHAPRLPPPPRQATFSPRAPTMIPWDRKSQMSPVEYSSWRQQSESLPAELDPWNV
                     NPHRWL"
     misc_feature    27745..>28071
                     /locus_tag="BWV06_gp025"
                     /note="Sporulation related domain; Region: SPOR; cl27087"
                     /db_xref="CDD:331908"
     gene            complement(28287..28649)
                     /locus_tag="BWV06_gp026"
                     /db_xref="GeneID:30855038"
     CDS             complement(28287..28649)
                     /locus_tag="BWV06_gp026"
                     /note="similar to HCMV UL21A"
                     /codon_start=1
                     /product="Cy37"
                     /protein_id="YP_009337471.1"
                     /db_xref="GeneID:30855038"
                     /translation="MGGSTDPLLTEAIRGLMPSIRVSFMRVNQPAHRPLGMYAPRARR
                     RLFQNYLQRQQIQIQPLQIPEVAEVVEIPMDLDDDLPLMGEPMILVMEEIRAQVENRN
                     PRPRFVFRLPDANNEAHA"
     gene            28852..29257
                     /locus_tag="BWV06_gp027"
                     /db_xref="GeneID:30855039"
     CDS             join(28852..28919,29011..29257)
                     /locus_tag="BWV06_gp027"
                     /note="similar to HCMV UL22A"
                     /codon_start=1
                     /product="Cy38.1"
                     /protein_id="YP_009337472.1"
                     /db_xref="GeneID:30855039"
                     /translation="MQDMKLIAILLAIGLVAVHALPRYTTQDKDGITGTDVGNPDVTQ
                     GDDSGVSKIPITLEGDDLPSGDDSTEEGSGDEIPAYDVFIEGEMNDGDNSEESDEGST
                     ED"
     gene            29406..29644
                     /locus_tag="BWV06_gp028"
                     /db_xref="GeneID:30855040"
     CDS             join(29406..29488,29566..29644)
                     /locus_tag="BWV06_gp028"
                     /note="old world monkey specific ORF number 10 (O10)"
                     /codon_start=1
                     /product="Cy38.2"
                     /protein_id="YP_009337473.1"
                     /db_xref="GeneID:30855040"
                     /translation="MPGSELSRARSVLAIIAIIMLAICNFYSYGFPATHPDPPHERNP
                     EDIDEPQME"
     gene            complement(29744..30682)
                     /locus_tag="BWV06_gp029"
                     /db_xref="GeneID:30855041"
     CDS             complement(29744..30682)
                     /locus_tag="BWV06_gp029"
                     /note="similar to HCMV UL23"
                     /codon_start=1
                     /product="Cy40"
                     /protein_id="YP_009337474.1"
                     /db_xref="GeneID:30855041"
                     /translation="MPAGSFPSVGLVTMFCWYTWGTCCRGSGANRSKWKSGQRIHLPW
                     PKDRVLVVLRRWRSVRNAEKEEERLSQYLCCPEKLHFVGSVCTKAFLKHREGTPPSEL
                     YVGQSGNVYLYVDVVYSDALTWIADDIEDFLVHGLRRCSFMVVPNANVLKKKETRRLV
                     ICENLNDLCEWRNMHASSLMRLGDGNMLCVSLPTSFSRLDLYYWRRMVGTTKVEPVGR
                     IAIADRLISIFADSYLRIYATTENSVCVVADTVMEFAMRGLVRYRWSTVFYGDKKMRK
                     LSGNLVCPYGKTHIYDRKSICRRSQRISCSSVHIST"
     misc_feature    complement(30263..30586)
                     /locus_tag="BWV06_gp029"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            complement(30739..31668)
                     /locus_tag="BWV06_gp030"
                     /db_xref="GeneID:30855042"
     CDS             complement(30739..31668)
                     /locus_tag="BWV06_gp030"
                     /note="similar to HCMV UL24"
                     /codon_start=1
                     /product="Cy42"
                     /protein_id="YP_009337475.1"
                     /db_xref="GeneID:30855042"
                     /translation="MACQPMSDIESLAMSVEFGLGCVEAYVRLNSGQKIALPWPRGWY
                     LVLQELEADDDYTAEDIKRLGYYLCCQTRLAFLGRVVGEPVLVHGQRKTTLIILVSEE
                     GQVFCYVEEDFSLYYVAKNLSELQRVGLRAVDVLYCPRHVRSSALKRSFRRIRNAWKS
                     GPEAVSRYVTRNHGNYLQLPYPEGACLRLCNLKCFEVTSTSGFMLRSLRSHFGDQVIC
                     LGTVDLKGEVPSSPCYVRWPVTRVPIVLVDGGRVFCLDLVNLRYIRLADDLTAFMCLG
                     LRQLLNNRRFTGDRELHDTVPECPRGRQHDDDD"
     misc_feature    complement(30754..31653)
                     /locus_tag="BWV06_gp030"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219; cl28638"
                     /db_xref="CDD:333458"
     gene            31735..33501
                     /locus_tag="BWV06_gp031"
                     /db_xref="GeneID:30855043"
     CDS             31735..33501
                     /locus_tag="BWV06_gp031"
                     /note="similar to HCMV UL25"
                     /codon_start=1
                     /product="Cy43"
                     /protein_id="YP_009337476.1"
                     /db_xref="GeneID:30855043"
                     /translation="MYTKRGQQRRSHEGAGRLYTFDDLEDEVFLDPIPRAPANELDEM
                     DLMEAGLLSSSSQSDNKSSFEVVSETDSGSEAEAERGRRAGMASRNKPTKPPRRNKTT
                     QFPTGRVASEPVISAVSSEDEEAITQSQEEEEDDEEEDDLDEGQETTLGQRTVTIFRQ
                     IYFERSLARNLGFEPTLISPPNTEFLKFLLYDFSVQHVTRVNQCIPMPAFLLTSLINP
                     IAKTTSAGERDLTRGIVTHAVLVNYFYQAKTKVRSMQCSLNATIHGQTMNNIATYVTN
                     LTPGGRAAALALHFLMPQKAVMTKQYQACLRRLTEELRKRRVTESPSTLEILETIRDY
                     NLIFPIAPYTNRGALYLYRNNLQKLSNGYRNVLKLLSSEKLNEEHFVNDLAFMIGAQL
                     MLIQFEQTLHVLRAYIVHHLHNLATLIYIIYVQFPSLRGDYIQVTEAIYRAVTSHSDE
                     PLFQVNTWLFDYLRAVRNLEAVVCPDYMMCALRQWTTVHEDNPITDYMFHDPAIQDSR
                     IRCGDTQTKLLVRNLCFTRMQGRPTSRQTPVEHVLVPTASLNRPYLRCNSTEEREVNS
                     HRNLTLRSFLETNGNHPMSQLQ"
     misc_feature    31735..33498
                     /locus_tag="BWV06_gp031"
                     /note="Herpesvirus phosphoprotein 85 (HHV6-7 U14/HCMV
                     UL25); Region: Herpes_pp85; cl27999"
                     /db_xref="CDD:332820"
     gene            complement(33562..34317)
                     /locus_tag="BWV06_gp032"
                     /db_xref="GeneID:30855044"
     CDS             complement(33562..34317)
                     /locus_tag="BWV06_gp032"
                     /note="similar to HCMV UL26"
                     /codon_start=1
                     /product="Cy44"
                     /protein_id="YP_009337477.1"
                     /db_xref="GeneID:30855044"
                     /translation="MFVVFDHTRWAVVQYEINQKQNDVIGTRTIRMATSREAGCVFNV
                     EDYVRRNRGRHFDLPYPRGYTLFVCDEDDTILTPRDFSYWRLLPLMKGQLRVIGTIGT
                     DEMFTWDRPVAAIGGCGGIFCYEIGEHNYVVKAANSLSELLKEGVREGYFDDVRRARA
                     GALQHSQRRGLRRGSRSESDVSASLVTRPCLRRQNAMVEGEDPEELTQEMFASGIMSS
                     SLFTPALDYSPPQSESGARKSSGRAGTSSSSST"
     misc_feature    complement(33871..34191)
                     /locus_tag="BWV06_gp032"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            complement(34271..36004)
                     /locus_tag="BWV06_gp033"
                     /db_xref="GeneID:30855045"
     CDS             complement(34271..36004)
                     /locus_tag="BWV06_gp033"
                     /note="similar to HCMV UL27"
                     /codon_start=1
                     /product="Cy46"
                     /protein_id="YP_009337478.1"
                     /db_xref="GeneID:30855045"
                     /translation="MTANPPLDDIYSDQHAAFEFVADCPDDDFCHNFVRTYLTPVRSL
                     REAALAGLFPVDSSSLTKRPRNTLVAQNAESSKKSPIIYIRRSFLVNSKFATAHGKYN
                     IRGLSLQTDLAVWGLLRGVPLRPDPGHFHWMNLMQFRRLVAAGPFLPEISKSGKRIAL
                     AVATGQYAVSTLLNYKVFGNKTHYLRQLCVITEELFRRLAGTVCLFLDASDRDLIQKC
                     LPSHLCKKLPVNYRVQKNAVFFNSRFGLRAEAALHTLYARFCTCGDCHDLFAASSDTQ
                     ATPSEDEPSPPQPRLEDAELTLLHNAHLGKFHLPAIRHLTAAEQLRVQQSVARDLGFT
                     DWSHTLVDDYFLLPVGLSCGTPCEGYAMYLMSNAVLALKVIRLLYITIRHEHSACVRA
                     LCKDVAFLIRMFRYEASIIRKGLAQNAAQRMELSRFRRHIHDLKHIHFTVSNFLETFC
                     DFIKIVNKIPDYQCISLTIKRELVLLHLLRLRRVYECPSAETRKGEKLAWYYFRHGDV
                     TLDPGILMTFDSLLADCELSNNANRCRRKAPFEIPTSATVTVRYQGHIEKLHRLYVRR
                     FRPHEVGGCAI"
     misc_feature    complement(34274..35836)
                     /locus_tag="BWV06_gp033"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03166"
                     /db_xref="CDD:177548"
     gene            complement(36089..38242)
                     /locus_tag="BWV06_gp034"
                     /db_xref="GeneID:30855046"
     CDS             complement(join(36089..37103,37236..38242))
                     /locus_tag="BWV06_gp034"
                     /note="similar to HCMV UL29/UL28"
                     /codon_start=1
                     /product="Cy50/Cy47"
                     /protein_id="YP_009337479.1"
                     /db_xref="GeneID:30855046"
                     /translation="MGDESRPRLVRRKRAAAPETFCSRSLSELCMRRDSEGLKRYLMR
                     FEGSCVSLGWPAQCAFVVGGMYSPYAITDIDLEHCQNDFFGESRVLQPLGTVSHYTNK
                     YPVFLDPCGAVIVYDAKEDCLYEVASDLNDFFVRGMIRCDPVHETICRRMQPDVSPLP
                     SAQKVEMCERSRISTRERYLHSLLCFRQLLDCPDNEHRSRYVEEHRNAKLSLIWPENH
                     YVLVANAQDLEMSPIAIRRLQRFSYGREPILLLGVIEGEGNKTFFQRVKVFCGDSGIV
                     YVALVGQERLTRLARDLKTFVRIGLCPLIDDYRYENIGPVGRHTLYELYPGTTLPFKK
                     RRMVLGHFEPLTALYLRGQPRFTAYWRGLRDAWINTRGRSRERPGGLHLQRFVRANAG
                     RWLPLAWPPLHGILLGDLKYFGVTRDRKTYQRFCCFREASRLYFLGVITVYECSPQAA
                     QSPEVWVSNHGHVFCYMPLEDKVYVLAVSFHELFETGLFAVCSYFEREYVDEIVEGAW
                     YEHNFTSMYDLSQVLHDRKAVVRFCQLHAGTKVRLGGRPACTFTFGSWNVAEADEANR
                     FVIGILERAKYAVIGWIEPVNKAVFLDTNGCVHVLLYGTVMLKLAETLRGFIRQGSFW
                     FRCSRRFCFSPLGSVSMPVSSQKAQFCDVSEYVYSNRSLLHDESVAAAP"
     misc_feature    complement(join(37103,37236..38242))
                     /locus_tag="BWV06_gp034"
                     /note="single-stranded binding protein UL29; Provisional;
                     Region: PHA03222"
                     /db_xref="CDD:165485"
     misc_feature    complement(36626..36976)
                     /locus_tag="BWV06_gp034"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     misc_feature    complement(36224..36541)
                     /locus_tag="BWV06_gp034"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            complement(38316..38570)
                     /locus_tag="BWV06_gp035"
                     /db_xref="GeneID:30855047"
     CDS             complement(38316..38570)
                     /locus_tag="BWV06_gp035"
                     /note="similar to HCMV UL30"
                     /codon_start=1
                     /product="Cy50.1"
                     /protein_id="YP_009337480.1"
                     /db_xref="GeneID:30855047"
                     /translation="MMSERQRHMESLKRFMRGSVAVADASRMLEYYDTLSSEDQSVFW
                     DTARHEVDAELNKDEMLDEKVQVCCCLFRLCGMMMGYKGC"
     gene            38889..40514
                     /locus_tag="BWV06_gp036"
                     /db_xref="GeneID:30855048"
     CDS             38889..40514
                     /locus_tag="BWV06_gp036"
                     /note="similar to HCMV UL31"
                     /codon_start=1
                     /product="Cy54"
                     /protein_id="YP_009337481.1"
                     /db_xref="GeneID:30855048"
                     /translation="MSVPVNVDPATQSSAVEELPKPSSPSTVVVSSSSSSSSSSPSPT
                     KIIQPPPQQLLPQAPQPGNIVVVPAPGPDPDYRLPDLRVVRLWLETLKTADRDNFGRC
                     VRHAKTHRTAYHLTAYEPYLIALTDQYNGTPSVTEKASYLHGCLFLSFPVIYNNTQGS
                     MYKHDWSNVAVPRTMLRELFFLLCSTSESPAIFQPIITKGGTCASMVVYPDETASNFT
                     NPQHIGFVYSKLVMIPFVPHAFPSYGVPFLTLPTHMRYCWIEEAPFGHATLTRYNDHM
                     LFHVEHLTWTSKRITNHGQKKMSRYTAQFKGMLPDTYLNGTHVWTSSKNIQYEFMGLL
                     FTINIDTLCLDLHHGQCIGSISSSYCHRVADKLTARNMPRSFVFYLLIENQQQCTVQF
                     NRNPYLFFSGDGFNSPLLNEPSPFYLTVHAPYDINFGQNARQTVEIDIRYAHTGGRCF
                     LVANLPYEDSFYTGMCVWQADALKITLWSRLRTTIIPQGTPIAVLYQINETDGNLYAY
                     NHNTVFRQVNHAESTAFYLSDLKLPTNNFLTSP"
     misc_feature    39150..40382
                     /locus_tag="BWV06_gp036"
                     /note="Protein of unknown function (DUF570); Region:
                     DUF570; pfam04489"
                     /db_xref="CDD:282358"
     gene            complement(40525..42657)
                     /locus_tag="BWV06_gp037"
                     /db_xref="GeneID:30855049"
     CDS             complement(40525..42657)
                     /locus_tag="BWV06_gp037"
                     /note="similar to HCMV UL32"
                     /codon_start=1
                     /product="Cy55"
                     /protein_id="YP_009337482.1"
                     /db_xref="GeneID:30855049"
                     /translation="MSLKFIGLPPRKVTAITNFLKTLPTKENVDLEQHPKILRKCGER
                     FLHRRSCLFNQLVLWLAYYRELRYHIPDLSSLLDEFEVHANAVTRRAHMYPFRDPVKA
                     RPHLRTLEATGFGDDSRTDVDVIQNAMIGATALAKLSECQPLGTGEIEFIQLRQKDVM
                     ALEDSLLAISNNMFEIRPVKLHLERHSNSSLVNATNKLIYLGKVIVHVRTSWDMLAEK
                     CLIKIKEICKTLMKELRSCRSFESNYCSNIIKHKVSDGESADMLLEMLMEDFAIYEDI
                     FPQSVSQTFGDPFSLEYDDEELHREWEKWLRGGWEGRQTKDDDDDNQLFTTKKQERKV
                     PDKSERQYAFSLLSPTQKLTSSQLWDTKPKTPHPVSKRVTFWSDDENQGRTKEETDDV
                     KVDTLVDFDGGLGSLKLDDDDKPSTSTYKFELPKFIQTPLLNSPFATQFSNPLFTTGS
                     SEAIPGLETPLKEVSDIDNMSDRERKTPPGSDYSDRESSFSPNKRREVKSEAEISESE
                     YEDIASGDGDEEGVSDAESVVSVASIPPATPVPPVSDPKAKRRLILKPKTKKNVPKPK
                     PSLGPFTSVTSPSTSVLKPRKVIKATPITLDGSVIKPANFSAPGSGKDVTIVKVPTTT
                     PTQTFTPGLTTTTSTKTQTASSTEVPGGRAQKMKAEPLTSPRNTPKPTEESKLKDLLD
                     DSSGTIPVPDSVQAIIEKIKEDSRINEE"
     misc_feature    complement(<41770..42657)
                     /locus_tag="BWV06_gp037"
                     /note="Herpesvirus large structural phosphoprotein UL32;
                     Region: Herpes_UL32; pfam06070"
                     /db_xref="CDD:283680"
     gene            42733..44014
                     /locus_tag="BWV06_gp038"
                     /db_xref="GeneID:30855050"
     CDS             join(42733..42759,42836..44014)
                     /locus_tag="BWV06_gp038"
                     /note="similar to HCMV UL33"
                     /codon_start=1
                     /product="Cy56"
                     /protein_id="YP_009337483.1"
                     /db_xref="GeneID:30855050"
                     /translation="METILHNRTTNNEGILNINTTCNVTDSLHAAKLGEALVNSALSL
                     FGTPLNAIVLVTQLLANRVHGYSTPIIYMTNLYSANFLTLIVLPFIVLNNQHLLTASA
                     ITCKFLSLLYYSSCSVGFATVALIAADRYRVIHRRTQARQSYRNTYLIVGLTWLIGFI
                     CATPGGVYTTIVSHRDGENDVQAHTTCIMHFAYDDVYVLMVWKLLIVLVWGVVPVIMM
                     SWFYAFFYNTVQRTAKKQQRTLKFVKVLLLSFIIIQTPYVSMMIFNTYATVGWSLECE
                     DLTKRRVINTFSRLVPNLHCVVNPILYALMGNDFVTKVGQCFRGELTNRRTFLRSKQQ
                     ARNSDDVPTIVSQQPATPTIVNKAEKDPHVKRGVSFSVSASSELAAAKKAKAKAKRLS
                     MSHQNLRLT"
     misc_feature    join(42733..42759,42836..43924)
                     /locus_tag="BWV06_gp038"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; cl27963"
                     /db_xref="CDD:332784"
     gene            44219..45076
                     /locus_tag="BWV06_gp039"
                     /db_xref="GeneID:30855051"
     CDS             44219..45076
                     /locus_tag="BWV06_gp039"
                     /note="similar to HCMV UL34"
                     /codon_start=1
                     /product="Cy57"
                     /protein_id="YP_009337484.1"
                     /db_xref="GeneID:30855051"
                     /translation="MTMNIIITTRDFSNDESVVETAELHNSVANSISKAYRGTIRAEG
                     KKKLLIRNLPAAPGCTRRNSNLFIFCHDRDYRKFHQGIVQLKRTRSQVDPSDIVNVTK
                     NIKCRLQPHNQDPPLFAGQLQNTIAHVCTLFNQLVFTAQLRHYCENHERVVLYARDEL
                     TRRCGDKSTLGIHIYQLISLLDQDRHSELCHVLVGLLHQTPHMWARSIRLMGRLRNYL
                     QQRFLHILVESGLQVDSIFESCYHSEAYRLLFQIDKTNQTPRSLTYSANVLPVIENET
                     EATPVPPCI"
     misc_feature    44225..>44986
                     /locus_tag="BWV06_gp039"
                     /note="nuclear-egress-membrane-like protein; Provisional;
                     Region: PHA03325"
                     /db_xref="CDD:223044"
     gene            45139..46911
                     /locus_tag="BWV06_gp040"
                     /db_xref="GeneID:30855052"
     CDS             45139..46911
                     /locus_tag="BWV06_gp040"
                     /note="similar to HCMV UL35"
                     /codon_start=1
                     /product="Cy59"
                     /protein_id="YP_009337485.1"
                     /db_xref="GeneID:30855052"
                     /translation="MSLPPSIPALPVDASLNLRPDLFSDEHRRLLVDILTQGCGGYVG
                     LLCYGLPMPSYVLETLIDFQIKTIYTKIKQIANSVIRICILANYLKNSQDLLVDLQAN
                     LDEINSGANKQRLYRGLHRICRQTNMMDVYRNVSQLLDAGDVTMGVYRQGLAQMRALT
                     EALDLHREPNLQPLYETLTSYNLLYLPPPYLSAAAVEIYSENLGDLTKRINRSFNLQT
                     QINRSKRADYVVNDVLFLLSARHLQFRHRLELQILETWIVNKCNYLCNDLYFAYVQVP
                     ECRSTFCNFVSGLQVVRKERHPTFRPLLHNLCSLLNTFHEANVYLCPQYLHSAIFLLL
                     RRVSRVREGDSSDSDSENQEAAEDRDTLLRRFREGDLDLEVDPTSTPLQNFYFAKNPF
                     GNSELFRIPEQASRYLRRNAWIDRSNLTYISYKLHNGTLSEEPFPMRNLYSLIMEGAS
                     RQAGTNARQFMAALQQAPLGHDEPEAADHSDLFADVDIRPAQPSSGSSASLSTPSTSS
                     APSGQPSPSRLGPEQPPRQRRYLSLSNFSPYSVARHHHRRRRPRPPRGPAHTSRQGPD
                     IAASASASGGEDPRDSLAEELEQL"
     misc_feature    45139..46899
                     /locus_tag="BWV06_gp040"
                     /note="UL35; Provisional; Region: PHA03250"
                     /db_xref="CDD:165509"
     gene            complement(47035..48530)
                     /locus_tag="BWV06_gp041"
                     /db_xref="GeneID:30855053"
     CDS             complement(join(47035..48224,48305..48530))
                     /locus_tag="BWV06_gp041"
                     /note="similar to HCMV UL36"
                     /codon_start=1
                     /product="Cy61/Cy60"
                     /protein_id="YP_009337486.1"
                     /db_xref="GeneID:30855053"
                     /translation="MSYRLMSGMDDLRDTLMAYGCIAVRAQDPASLYTFVDQECGTKL
                     HLAWPDNGYVQLRPRTLMGPFSSKYYDVCCQGKYVCCNELMEPFGVVELSKLSFYQLV
                     MLIGRSGAIYCYEETEKCVYCLAPDMKSFIQLGLRRCDYLQKMELYQEPVIECDEIMK
                     ELMIFNWDVDRISDVVAKNGYRVYDIRDPLGEQVDSHFALWSSDTAVANFQDTSFSLM
                     SPSGLRSFEIMVRCVARIVCVNQLLGVLGCFRKEKNEFLVRLYVLVDKFGTIYGFDPA
                     LNSIYRLAEDMRMFTCMMGRKGYRNHRHDRKRAAIVRLEKVPYCMHGEEPSDPMIMFN
                     DDSEDEKPPKTEADIVVGIYEAIKADIRFGVDMMMRDSSVTQKFWPQHLEALSDSPLL
                     PSLIYDMEDVRSKMLGNIADMRAFDMSFVGLAEDNDSDREETVRGYLFDDTVCTRCVS
                     SRRLRLFRSGRGMGRARVSYV"
     misc_feature    complement(join(47068..48224,48305..48506))
                     /locus_tag="BWV06_gp041"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219; cl28638"
                     /db_xref="CDD:333458"
     gene            complement(48628..50960)
                     /locus_tag="BWV06_gp042"
                     /db_xref="GeneID:30855054"
     CDS             complement(join(48628..49496,50687..50960))
                     /locus_tag="BWV06_gp042"
                     /note="similar to HCMV UL37"
                     /codon_start=1
                     /product="Cy66/Cy62"
                     /protein_id="YP_009337487.1"
                     /db_xref="GeneID:30855054"
                     /translation="MPAIPIQYVNCAGALGMVAFGILSYQWIERKRNQGPPLPPWFKE
                     YLREVKRQRGELEEEEQETALSPADGIAGLVREAFCVLKRSLGRLKRIKGLSLECQYG
                     GDVNDTMKCELNCTYNGTLIYQGPCHLAVDKLRLNMTFPKRRRVWHSMILNIGLQYYL
                     GGRIMYRLYMLSNLSTSFTGMLQCICNDSSRNVTQGKIVLQSQAWGQHVLSATSADRR
                     NTNCKWQQGNSTEAENSTVKGYVSTWLEKHLDTDRYFLSDVCIRLIYRLKKFEASPVN
                     ITDQDYADNATYGVLEWPTWTQVMQLWSSKVVSSKLTLCAWGLFSISSVALGAFILVA
                     LFAGFLGRSQRHIRADIQEMHAARREIRAAQKSKLFYINESADFCD"
     misc_feature    complement(join(48763..49496,50687..50939))
                     /locus_tag="BWV06_gp042"
                     /note="Betaherpesvirus immediate-early glycoprotein UL37;
                     Region: Herpes_UL37_2; cl27896"
                     /db_xref="CDD:332717"
     gene            complement(49750..50634)
                     /locus_tag="BWV06_gp043"
                     /db_xref="GeneID:30855055"
     CDS             complement(49750..50634)
                     /locus_tag="BWV06_gp043"
                     /note="similar to HCMV UL38"
                     /codon_start=1
                     /product="Cy64"
                     /protein_id="YP_009337488.1"
                     /db_xref="GeneID:30855055"
                     /translation="MATSAEYDQEQKMQQNQMNIGSLIQASVLGKTALRAQVKKLMAC
                     DAHIKHEFGVTVCICDHTYTFLGINLCKIGWLERNCPPLSHALTMFGVIEAWDEAAPR
                     PSRQVVLFMSDNYDIYAYDTGILFFMAPTMSEFWTAPIVFEYWNGIFPLEVRHRVRQY
                     AKSVDDLIVIFNQVYHQRDVLEARRQKNQNSPRTFARFLCGYVRALLDAERRVREGKI
                     PVPFVDRDSLMANVIPVTPPTPSVQEPERGVDSKKALTRQCSLPTPDPKKVNAHPDDD
                     SDSDESIVDLTMEGAASL"
     misc_feature    complement(50224..50547)
                     /locus_tag="BWV06_gp043"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:308157"
     gene            complement(51311..51841)
                     /locus_tag="BWV06_gp044"
                     /db_xref="GeneID:30855056"
     CDS             complement(51311..51841)
                     /locus_tag="BWV06_gp044"
                     /note="similar to HCMV UL40"
                     /codon_start=1
                     /product="Cy67"
                     /protein_id="YP_009337489.1"
                     /db_xref="GeneID:30855056"
                     /translation="MLLTVVMVMAPRTLLLVVGCLSLLFTVALGVSQPINKYGYTDCM
                     PAYFGSLYIPGVNEPRVLNVPLTGLYCLSGITLESSVTNYTARNEDRCQNGSLSSAIV
                     SSVRHANGHVPRTTCKGGINLLSCEANSRLVDFIRYLGLYPAASLGFDSLCVYILASL
                     YLGVLKAMTSEMITIP"
     gene            complement(51919..52158)
                     /locus_tag="BWV06_gp045"
                     /db_xref="GeneID:30855057"
     CDS             complement(51919..52158)
                     /locus_tag="BWV06_gp045"
                     /note="similar to HCMV UL41A"
                     /codon_start=1
                     /product="Cy67.1"
                     /protein_id="YP_009337490.1"
                     /db_xref="GeneID:30855057"
                     /translation="MMLLWCNASFTELRQNYFLPCPWLVGVGCFVLGLFLLIFACLMK
                     TVWSRKKYQHLLTTDEEEEDIVWEKKPLSTKDIEF"
     gene            complement(52290..52676)
                     /locus_tag="BWV06_gp046"
                     /db_xref="GeneID:30855058"
     CDS             complement(52290..52676)
                     /locus_tag="BWV06_gp046"
                     /note="similar to HCMV UL42"
                     /codon_start=1
                     /product="Cy68"
                     /protein_id="YP_009337491.1"
                     /db_xref="GeneID:30855058"
                     /translation="MSATNESSPRNDSEDVRPPAYDEIVGSPPRPRDLPTQPRRDRIG
                     LTTTAAPPDSPPPPYHAVVGEVPPRPDNFRMDMTEFPANMHPPVEAYYDDGWKCTIVV
                     FVVSLLGIILLTVLVSVILVLNKNKG"
     gene            complement(52660..53661)
                     /locus_tag="BWV06_gp047"
                     /db_xref="GeneID:30855059"
     CDS             complement(52660..53661)
                     /locus_tag="BWV06_gp047"
                     /note="similar to HCMV UL43"
                     /codon_start=1
                     /product="Cy69"
                     /protein_id="YP_009337492.1"
                     /db_xref="GeneID:30855059"
                     /translation="MILSEMERADVLVRHTFICSVSSQKPAKRLIEHVRQMSGTTFPI
                     RWPRGWIFTYRNFLRQGTFGRLNIKDLEKKYLCCDKFLIPVGTVSNGEEALTSGNVFI
                     LLLSEGGRVYVHDKNCDSVQLISRTGFHSLLTEGLMKYPPLREKLGPVRYSFGDSLAL
                     EFEIPTDLMGVWRLCQRNAGKEFSWTCTENIYLAEVVEGERTYENPAHQEWIKDTGSV
                     NVLHIFVLSMLWRQKLIDIPIVVNEQLRVFAVNPDTKRVEYLASSLPAFFRVGVLRLG
                     NQQYFCRQCVRHKKHCNIPPAYLCNTCPREPFCRKQTRSQKQKGRFFCPGSKHVSDE"
     misc_feature    complement(52696..>53628)
                     /locus_tag="BWV06_gp047"
                     /note="UL43 envelope protein; Provisional; Region:
                     PHA03175; cl28637"
                     /db_xref="CDD:333457"
     gene            complement(53780..54952)
                     /locus_tag="BWV06_gp048"
                     /db_xref="GeneID:30855060"
     CDS             complement(53780..54952)
                     /locus_tag="BWV06_gp048"
                     /note="similar to HCMV UL44"
                     /codon_start=1
                     /product="Cy70"
                     /protein_id="YP_009337493.1"
                     /db_xref="GeneID:30855060"
                     /translation="MERKARLPEPPTLALRLKPYKSAIQQLRSVIRTLKENTTVTFLP
                     TPALVLQTVRNQFVSKITFNSSCLYITDKSFQAKTINNSTPMLGNFMYLTSSKDLTKF
                     YVQDISDLSAKIHMCAPDFNMEFSSPCVHGQDLMRESDSSAVHVDLDHTVVSELIKWI
                     SPHTRVKRNLKKAPCPTGTVQILVHSAPPAIKFILNSGSELEFTANTRVSFHGVKNMR
                     VHVQLKNLYQTLMNCAVTKLPCTVRIVTEHDTVVHVSSHNGLFTVENFLTEEPFQRSD
                     LSFDKNFKQQRAVAVTNSSAMHDDGCGSGLDSEMMSEPVSRKHERMPPRKSNEHDHNS
                     KEKYEQHKITSYLTTKGAANSGERNSNYFNDAKEESDSEDSVSFEFVPSSKKQKCT"
     misc_feature    complement(53786..54607)
                     /locus_tag="BWV06_gp048"
                     /note="Herpesvirus polymerase accessory protein; Region:
                     Herpes_PAP; pfam03325"
                     /db_xref="CDD:281337"
     gene            complement(55193..57745)
                     /locus_tag="BWV06_gp049"
                     /db_xref="GeneID:30855061"
     CDS             complement(55193..57745)
                     /locus_tag="BWV06_gp049"
                     /note="similar to HCMV UL45"
                     /codon_start=1
                     /product="Cy72"
                     /protein_id="YP_009337494.1"
                     /db_xref="GeneID:30855061"
                     /translation="MAQASLRNTGAGGLEAVMQEGSEGGDGGTEENGVEAMEVATSSP
                     DAEQQQPQQQPQQQPQVGVHACWSLADQGTAASCRPDASSSLVQHMPAMNTVQLLMGK
                     KCHCHGRWGKFRFCGVPDPVKHVEDRATLWRDIDSASRQSGIRGAYRLFQMLMRYGPA
                     LIRQIPRSDLLIGRFYLKVNWLRESRNALNYTSSMCEGPLRDFVMRHSEDLPKILADI
                     TRYLDLAGCWGFYGAIVLTDKVSRQIYGQDESLGGIFLRISMAITLAIVSSPCARVYR
                     FHMDCRHECEVLESVVKRCRDGQLSLTPFSMSNIGFVELPQYDYLISCDLYSREVDWL
                     ALHKWLYENLTRGVSLSINVTRFNVEAISVIRCIGGFCDMIREKEVHRPMVRIFVDLW
                     DVAAIRVLNFVLKETDIIGIHYAFNIPSVLMKRYRSQDSHYSLFGRTVSRKLSECGNE
                     FAFEKEYVRYETTVPKVTVKASEFMRNMLFCALKGKCALVFVHHIVKYSVLTGNIPLP
                     PCLSPDMASCHFGESDLPLQRLSINLTRCLFTRTDEDALCRDNVVLGNTRRYFDMRVL
                     RTLVAEAVVWANARLDALIRSGDWPLESAICKMRSLNIGVTGLHTVLMRLGFTYFASW
                     DLIERIFENMYYAALRTSVDLCKSGLPPCEWFDRTIYKEGKFIFELYRKPHLSLPVAQ
                     WETLRTEMQEYGVRNAQLLSIAADEETAFLWNVTPSIWAARDRIFDEETLLPVSPPSD
                     ECYFPTVMQKHLKVPIINYAWIEHHDEVKAKSITQGTVQRADVPSCVFQRAAELQADV
                     EMASVNVSMFVDQCVPLPFYYESSMTPDLLMKRMLKWYHLRCKVGVYKYCAS"
     misc_feature    complement(55205..>56512)
                     /locus_tag="BWV06_gp049"
                     /note="Ribonucleotide reductase, barrel domain; Region:
                     Ribonuc_red_lgC; cl27341"
                     /db_xref="CDD:332162"
     gene            complement(57764..58636)
                     /locus_tag="BWV06_gp050"
                     /db_xref="GeneID:30855062"
     CDS             complement(57764..58636)
                     /locus_tag="BWV06_gp050"
                     /note="similar to HCMV UL46"
                     /codon_start=1
                     /product="Cy75"
                     /protein_id="YP_009337495.1"
                     /db_xref="GeneID:30855062"
                     /translation="MDAREIAKRPRDPNDEDNELVLAVKLKREVNTLAVRYMYEADHQ
                     AITSRFFVPEGLVEFEVHPGSLMFRMETGAESPRYLYISLYLMAIKATNVSMAAKCQL
                     EGIYTSGPAKAALAWLDMGSKVLHRRLRTIGCVKSVSLGITSLLTCVLSGYLYNTLKT
                     EIFSLWIPKDMYMTLEETQGRLQNVYLIMVYDYEVLETKVAIYVATSSISNRHTLTDL
                     VRHKFIAERCSFVNKRITRPRQISLCTGVIQKLGWCLADDIHTSVLTHQEVKLSTVRL
                     EHFNVELGEFIEFV"
     misc_feature    complement(57767..58549)
                     /locus_tag="BWV06_gp050"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03262"
                     /db_xref="CDD:223027"
     gene            58635..61511
                     /locus_tag="BWV06_gp051"
                     /db_xref="GeneID:30855063"
     CDS             58635..61511
                     /locus_tag="BWV06_gp051"
                     /note="similar to HCMV UL47"
                     /codon_start=1
                     /product="Cy76"
                     /protein_id="YP_009337496.1"
                     /db_xref="GeneID:30855063"
                     /translation="MMRKRTVDFQVILNELKQKSTEIQGVLNTLSQIEIGALDVETVN
                     ATKIQQFLQLIPQEGYHFTFIQQNVVYYILSHSTLQTSRDSLSSAQELLKELQKHHQR
                     HAITSPCEYLNNQTTLTHLQTFMDKMQDLQKLFDTNQFLAATVPDRKNQKPRDISDNG
                     TQYLIRSVFTQIEEATEHIRPFSNCRLVAELIDLLYHNTLRWAMGLMQYHAFIEKHDQ
                     ELDIILKMHFFYKYYKGVNSELNTEFQTFITSDKRNLGPFMVSDADGDQQAGAEHIRD
                     LSFKVFNANLNDRDTTGLAFPILLTTLSVLNHMAVLNLFYHPGLVFRLLSEESTPSAS
                     EMQRLDLIAQMCNQVSNEFFRTITKKPVKLRDLMIRIRKFTSLGLNRQTSRTYAQMAL
                     LQPSRTTPKKGSEMWFEIRQQLIVAIYNTYVFFMCLWVYSPTFLFIHRRKIILEQQRS
                     TLVGSRRELQFIWDNVTNNIQHDFYVMFTEDEFNVTTKGATELEKDYLYRDLLNKWGD
                     ILFVMKPKLTPDAQSPSLDNVTTADVIKRCAMINLSEVNVPYETLLPLTHHPSFLDTF
                     VNLVIVPEFSQILTVPHNQFLTMGSPRLLRLAQACRLLAPDQIALYNKLVSLYNLTTF
                     VSEIDAGVFRTIYNLTLETAALLENLCGEPVSPELDLLVELMAQSLSHNLQTTVNPLI
                     EEVIQNNSTSVARYLEHTNLCYSFAHTIGQLSTDMSTVELTLQSKTLAKLSITQFLKM
                     VQALIQKDQQLSDNFHRIHDRLQQIKQRMKQITEDVIQLNEYSKNHPLAVDVVKCLRK
                     AARQLKSLEERLILIMEQTQKSNKLIINSLKRIEKTCMVLSSKNIEEHGIRYCIAESR
                     GLLRTHRSVSAIPPSAVDYLPDNAESQLRAFLKGFREAGVEHSPLQMSGNTDIQQQIP
                     IPEVFTNRYEPSNQTNDLLNWYITSKDQAENDILTSIYPEARHE"
     misc_feature    58713..61262
                     /locus_tag="BWV06_gp051"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            61532..68071
                     /locus_tag="BWV06_gp052"
                     /db_xref="GeneID:30855064"
     CDS             61532..68071
                     /locus_tag="BWV06_gp052"
                     /note="similar to HCMV UL48"
                     /codon_start=1
                     /product="Cy78"
                     /protein_id="YP_009337497.1"
                     /db_xref="GeneID:30855064"
                     /translation="MKIYPARFDQTHSRFGPRAGSQCVSNCFMYLHALHLHGAHTTLS
                     KDTLDLILTEGAQLDSLVETILQQKRPGEKLPAFRLGEEIPNIITSSFGKTAHALSRP
                     FNGTAETRDLDGYTCLGIFDFLMYAYQKTRPVYILVTVNALARAVILLDHDIFVFDPH
                     ASERSRYAAVYQCDSLYDVVMLLTYFGARLGDFYYDALFVYMLDLSIHPVPEADINGV
                     IISSFRDPDIALPASSAPPGSPVQTIPSLPPPESTPKKTPEKRKSSSSASHGGKKKAA
                     EFKDPGSSSSRVSTTAPYNCLEALPALTRYERLIKQAEKEIQNITIKAPPTAGWILFS
                     SSGMPFDEAFLTDRMEQLVMSSIEHASCLHTRWRPTTPMYQQVRQLRGFSETIDRFLT
                     LWLQNDLHLLDMYEALKNVNTSSLTVLQRAMLDKLRAVFAQYSSSQGPKVVQWVKDIL
                     KATEKVNYTHLPIRLMEYVEEHPLDIDETFVCLKQQDFSTIVNAVNSRRQITTQQQEQ
                     VQQALQKLSAAIYGIDSRYLDRVSFDDKETKDTLSKLDNQSRTTLLQRGNTKMNELKD
                     DLKRQISDLLERKHNQIISGTLPVQDMQALQRRLEQAVNLAQEMSELRLCDVNFTIPF
                     RELSNQLDYLITGQASSSHAMSFSDELMQLRSQFTYATQTKEDTESKIHDLMVHIEDT
                     VQNLTSRSSNITMAMIQEQLSELQQLGGGNMPDIAKRLEKVQKTLHGLYQEEQATRIF
                     VHGLKYENLPNDQTMKRYTRLSELLRDDDNLHEVFIEKILDIFNTILERLFDKTFPKA
                     QAFDMINALINQIPHASTIIKDLHTANAAISQLSKQLEALSKVPPDKRLNALTELVQY
                     FVSNGKVFSHLMSMQVGKNTLPTLYENLKMELEDKHKQQAENKWLQDAKKLTVTSAEM
                     VHQFMQTAPSATAAELARPELSAKLQAFLEQEAKKQEEERKNVFKERQGMVTSELARI
                     TDAIKAQTLSIIPNLKLESLQDVIASLGSGARDILEKFDRSLLATLSNLVKLMDERVS
                     LCIQDVLTGQDTHYQQYQEDARAMRQGLTYVGTMMRSQLSQETLRTLSNLVLQSMFVE
                     KCQLRDAMTVFSNSDYLEDYQRYRAGQRQLELQVQEARMELHRQATTAERAIHQPNAR
                     VDAKNLTVGKDLAEKLDLESAGPFQRSVFATVLTQQLETHKKTLKDETELMNTKLKSE
                     NELRQAKMTSLSEQWSDLVTRQKMDAMEVATPDAKHLILNPVAALTELLAKASTQMSY
                     LDAEKTFAWALLFLHEAKNQIENHPGHPCYAQLQNFPVLIQQAQGRLDTVRVHVNNNA
                     SCENFVAQHESGGAITDRETIITVETVWATLEPKRIAGGEARYHKVQELLLRMKQSLS
                     DVELQDTLATEYYQLLSSIQTFGYSLDFNVQLQKIRDLKARFNELIKQQHLNTSEEVP
                     FPMPPIPGNDITVASPLSFAKGLAALERYVLAGYQYLTECINRQPLICQRIDDIPAVL
                     PPTDIDHKKAALDRLKRLNFSKKNDTYYEVIDAFGLHQLMSRTGTPLHYLLSYGNVLF
                     KYLALHHDEKHLAKKFAQAKNVVTGRYKVVTVNVAVAQTIKSFWTQISQYDLKPLLSG
                     QPLLGLGETNSLVNLKIFIYIVVSAWNLQLDVSQDISGPVVRIPIQDLCITITTFYPE
                     YIYGIVKHPIQNTLSSLVRALKKDIVQEAINNVIQMPPTYNADEIKGFCVNPKIWSSV
                     NLSRVLWDHNLVRQICAVGPRKNGNGKLWQYAVAILIFPQDLLQCLWLELRPKFAEEF
                     ATMFDFFQTLFMLFTHEYDIARESNTNTHLNTGEPIMQTISIRHKEYTEKSLLDIFIE
                     TETALDYALGSWVFGVPVCCAIHVADILGGNRLLLARHLEYTSRDPDFLHVQRAKDLN
                     LNYLVSQTWTNTPLEQCWFQAQIQRIREHLRTPLQLDFIPLIIYNAHDRTIHSILRPP
                     TTAERDVSRIIVENPFPTVPLIDVPESDLISFTRVPINTDFLREDPPPVSRPRSHRST
                     ASGVSRGSKSKPSKVTQGGAAASKLPSSSSSSSSERARVHTVGSSVDVPEVVSEGETT
                     SGDETEGEDFTHLPSEEEQQSLPSTRTFVEPVFRQRPLQTIVRREDVTTVSPSAASSS
                     FNNPPITTLTQNVISAIQILSSVRVDLRSMARSVNETINRLRFLYLL"
     misc_feature    61559..62080
                     /locus_tag="BWV06_gp052"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:309812"
     misc_feature    <63137..63907
                     /locus_tag="BWV06_gp052"
                     /note="RecF/RecN/SMC N terminal domain; Region: SMC_N;
                     cl25732"
                     /db_xref="CDD:330553"
     gene            complement(68144..68365)
                     /locus_tag="BWV06_gp053"
                     /db_xref="GeneID:30855065"
     CDS             complement(68144..68365)
                     /locus_tag="BWV06_gp053"
                     /note="similar to HCMV UL48A"
                     /codon_start=1
                     /product="Cy79.1"
                     /protein_id="YP_009337498.1"
                     /db_xref="GeneID:30855065"
                     /translation="MSSSSGTGPTVKRDEDKRRHVCTNVLDLPQESMEHPVTNTMLAK
                     YVRMSSYFTDKYAFKLDLLRMLAVARTRR"
     misc_feature    complement(68147..68359)
                     /locus_tag="BWV06_gp053"
                     /note="Small capsid protein of Herpesviridae; Region:
                     HV_small_capsid; pfam17086"
                     /db_xref="CDD:293691"
     gene            complement(68358..69827)
                     /locus_tag="BWV06_gp054"
                     /db_xref="GeneID:30855066"
     CDS             complement(68358..69827)
                     /locus_tag="BWV06_gp054"
                     /note="similar to HCMV UL49"
                     /codon_start=1
                     /product="Cy80"
                     /protein_id="YP_009337499.1"
                     /db_xref="GeneID:30855066"
                     /translation="MSRDFHRALWRLFAPLCAHDDHFHVQMVIGRGAWQTEEQICALQ
                     LFVTDKRFLNRELGDRFYQRFMHEWLACAPAEREAVTMFFQRMVMTKPYFMFLAYVYS
                     MNCFHGVSRTVAFLRFERYDADYVYIRLQQYPAEKLSALLDGMTSSTLGDFHRFLFGV
                     DLRLPVLNQTSSPCLSLLRAKRFDGRADLAVYHRNEWARHRKSRSAQLEALVAALRRH
                     SGPVPCGNPLYVMARQAIQSFCDTCPRYLVPLRALGLNDEVRAHKQSRPLEPTKIVMH
                     GLAVALRGGLIGSVIELPLWCLCRLKCERHLDSRSLIAVVCRQCGHCLNLGKEKLQCE
                     QNFPLNSMFYYRDRQEKSVIFNTNAELVHCSLCGSQRVIKERVYEVVSETIYGHRCLR
                     VGWKAVLGLNAACAVYDHVVTFDIILPCSARTCDSTVVVRSVNIPRLLRLTWHGHGLL
                     CSRCQSGEYRDSCLELENCATLCRGCTLVKQTACHGSHV"
     misc_feature    complement(68463..69209)
                     /locus_tag="BWV06_gp054"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     gene            complement(69817..70698)
                     /locus_tag="BWV06_gp055"
                     /db_xref="GeneID:30855067"
     CDS             complement(69817..70698)
                     /locus_tag="BWV06_gp055"
                     /note="similar to HCMV UL50"
                     /codon_start=1
                     /product="Cy81"
                     /protein_id="YP_009337500.1"
                     /db_xref="GeneID:30855067"
                     /translation="MEISKGLHHDLVSATRRILKLGPTELRVTDAGLICKNPNYSVCD
                     AMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPLKLVSSRHVGEF
                     NVLKVNDSLIVTLKDIEEIKPSAYGVLTKCVVRKSNSPSVFNIELIAFGPENEAEYEN
                     LLKELCAKKAAANGAVIRSRLAALRHHHSNSNSRKRLHSPRMTIAPPPFPPPTPPPPP
                     PGGFYGICRCRTAGPSCCSGGRGSGQEEEPRISAAQGVRSLAHMRWASSFRVDLRYLT
                     IGVVMGVLLFLIYRYVS"
     misc_feature    complement(<70141..70698)
                     /locus_tag="BWV06_gp055"
                     /note="Herpesvirus virion protein U34; Region: Herpes_U34;
                     cl27144"
                     /db_xref="CDD:331965"
     gene            complement(70724..71059)
                     /locus_tag="BWV06_gp056"
                     /db_xref="GeneID:30855068"
     CDS             complement(70724..71059)
                     /locus_tag="BWV06_gp056"
                     /note="similar to HCMV UL51"
                     /codon_start=1
                     /product="Cy82"
                     /protein_id="YP_009337501.1"
                     /db_xref="GeneID:30855068"
                     /translation="MASFRSARVVHGEDPDDDEDGTLDPEDELEVSFEPMLPRVYELM
                     LPSLDARLNFINAGQKYAAFLKYVHGECSSCNHAQILNEKTKLLTAIVNKLMDINGIL
                     EGKEESAGK"
     misc_feature    complement(70751..70969)
                     /locus_tag="BWV06_gp056"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            71097..72755
                     /locus_tag="BWV06_gp057"
                     /db_xref="GeneID:30855069"
     CDS             71097..72755
                     /locus_tag="BWV06_gp057"
                     /note="similar to HCMV UL52"
                     /codon_start=1
                     /product="Cy83"
                     /protein_id="YP_009337502.1"
                     /db_xref="GeneID:30855069"
                     /translation="MNHHPASRNYAYTGWELDLTQPLNEITNELLWHAHPRQVPEAAA
                     VAAAAAAATANVAAGTSQTGSITAGSGGGDRASNNPFLFTQSQCTDQLFGGLGSGQFC
                     DLDSELATFEFSDTERLKKLCTPLNIDTRCNLCAIITICLKQDPDQAWLLDYSLLCFK
                     CSSAPRTALSLLIVMSELTHLLRQHFPDLHIDQLFRQHVLTVFDFHLHFFINRCFEKQ
                     LGDAVENENITLSHVAVVKALVMGDEMVPYAKHRCFSHHKQKIVVKIPEAPKQLLQTF
                     TEHSTPTPERFTYLLFYMWAGTGVMATTGLSELTQSKHHLLDSVADADDPEINKDVGP
                     IYLSPVPVFQTKNQTNTVCLLCELMACSHYDNLVLRNLYDRITLYCENNVKMVDRIQL
                     ALADMMRECAVPMHSQFEDISRYARLPPPANYLSEYPVRPDPIVCIILRQAGVTGIYK
                     HFFCDPQCAGNIRITREEVLFGRLHLEHLTEVKLAICHDNYYISQLPRRVWLYITIFK
                     AFQITKRSYKSKTQLSDFMREFTQLLEACEIKLVDPAFVVDKYV"
     misc_feature    71118..72752
                     /locus_tag="BWV06_gp057"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03233"
                     /db_xref="CDD:223016"
     gene            72748..73614
                     /locus_tag="BWV06_gp058"
                     /db_xref="GeneID:30855070"
     CDS             72748..73614
                     /locus_tag="BWV06_gp058"
                     /note="similar to HCMV UL53"
                     /codon_start=1
                     /product="Cy85"
                     /protein_id="YP_009337503.1"
                     /db_xref="GeneID:30855070"
                     /translation="MFNGVRSTERRSALRSLTRKRRPRRGSLLSPPNQKTTASSPSGI
                     ATPRPRLTLHELHDIFQEHPDLEIKYLNMMKMAITGKESICLPFNFHSHRQHTCLDIS
                     PYGNEQISKIACTSCSENQVFPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLRMS
                     TNQPAIFQIYYIIHASNHDIVPFMSTDRDRLHMHIIFENPDVHIPCECVSQMLLAARD
                     DYHITLDIVKGHVVISVLCQTLTLSSVKIDVTVLQRKIDEMDIPNDVSESFERYKDLL
                     NELCHVNNTRSP"
     misc_feature    72880..73578
                     /locus_tag="BWV06_gp058"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     cl27388"
                     /db_xref="CDD:332209"
     gene            complement(73592..76699)
                     /locus_tag="BWV06_gp059"
                     /db_xref="GeneID:30855071"
     CDS             complement(73592..76699)
                     /locus_tag="BWV06_gp059"
                     /note="similar to HCMV UL54"
                     /codon_start=1
                     /product="Cy87"
                     /protein_id="YP_009337504.1"
                     /db_xref="GeneID:30855071"
                     /translation="MFFNPYLSGARKPPNLVAKRSVAKTFLEIVPRGAMYDGQSGLIK
                     HKTGRGAIMFYRDIKHVLENDMAWPCPLPAPPPSIEAFARRLMGPLKFHTYDQVDGVL
                     THDTQECLSPRYRHHITPSGNVLRFFGATEQGYSICVNVFGQRSYFYCEYADGDLLRD
                     LLASVSDLVSEPRMAYALTITPVQKMSIYGYGTSPIPNLFRVSLSNWSMAKKIGEYLL
                     ENGIPVYEIRVDPLTRLVIDKKMTTFGWCCVHRYEWRTHKSSTCDFEIDCDVADIMAV
                     SDDTSWPVYRCLSFDIECMSASGGFPAAEQTDDIIIQISCVCYNTGGTGCEENTVFGT
                     SGLHLFTIGSCAPLAGVDVYEFPSEYEMLLGFLIFFQRYSPCFVTGYNINSFDFKYIL
                     TRLEFVYKLSPGPYSKLPAQGRFSMYSPLKKFVTTTTTKVFISGSVVIDMYPVCMAKT
                     SSPNYKLNTMAELYLKQQKEDMSYKDIPVKFISGCEGRAQVGKYCVQDAVLVKDLFNT
                     INFHYEAGAIARLARIPMRRVIFDGQQIRIYTSLLDECACRDFVMPNHKGADNSSEPT
                     DVSYQGATVFEPEVGYYSDPVVVFDFASLYPSIIMAHNLCYSTFVAPGGESPPESDVL
                     TVELESGLSYRFVKNTVRNSVLSELLTKWVSQRRAVRETMKSCHDPVKRMLLDKEQLA
                     LKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLMRTSQFVEENFAEPCFLHNFFN
                     REDYSGDPVAVKVIYGDTDSVFVCYRGVTAAALIDRGPSLAHYITQCLFVDPIKLEFE
                     KVFGSLMMICKKRYIGKIVGETELSMKGVDLVRKTSCEFVKNVTRDIIQLLFDDPEVS
                     RAAVQLSRLTLDELKLQGVPPGFGRVIQRLSQARDELYTSRARVEELVLSSVLSKDVS
                     LYKQSNLPHIAVIKRLAARSEELPVVGDRVFYVLTAPADGRSSGVRNYEIAEDPTYVR
                     EHGVPIHADKYFDQVIKSVTNVLSPVFPPQTLRKDKFLLGILPHRIYLEPSFLPYCVK
                     ASEYC"
     misc_feature    complement(75320..76312)
                     /locus_tag="BWV06_gp059"
                     /note="DNA polymerase family B, exonuclease domain;
                     Region: DNA_pol_B_exo1; pfam03104"
                     /db_xref="CDD:308626"
     misc_feature    complement(73706..75148)
                     /locus_tag="BWV06_gp059"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:306614"
     misc_feature    complement(order(74423..74425,74636..74638,74648..74650,
                     74729..74731,74912..74920,74927..74929))
                     /locus_tag="BWV06_gp059"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(74420..74425,74429..74431))
                     /locus_tag="BWV06_gp059"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            complement(76718..79267)
                     /locus_tag="BWV06_gp060"
                     /db_xref="GeneID:30855072"
     CDS             complement(76718..79267)
                     /locus_tag="BWV06_gp060"
                     /note="similar to HCMV UL55"
                     /codon_start=1
                     /product="Cy89"
                     /protein_id="YP_009337505.1"
                     /db_xref="GeneID:30855072"
                     /translation="MSKNWFPLLCASVLVVYVAIASSSTGTASAVTPAPTENTTGEII
                     ANTTLRTHEVFRVNMSKFPYRVCSMAQGTDLLRFEQNIRCDSFKPTKEDFDEGIMVVY
                     KRDIKPYTFKVHIYQKILTFRQSYSFIRENHLLGFSQERLAVPMWEVSYINRLNRCYN
                     SVVRNVAGVTYVNYHKDSYVNETMHLIEDDYSNTHSARYVTVKELWHKAGSTWLYTTS
                     CNVNCMVTVTTARSKYPYDFFVTSGGEVVDISPFYNGSNNEHFGENRDKFFIRRNYSM
                     VESYGKDNAPLVAHELVAFFERPDMLMSWDIVDEANNTCEYTFWEQSERTIRSEADET
                     FHFTSHSMTATFLTLKKELNESDSDFDCIRDEANERLEKIFNTTYNETYVKSGNVSVY
                     ETSGGLIVFWLPVKEKAIWEMQKLATEHANNTNATRRRKRSTNSGNSTKEVLQSVVYA
                     QLQFTYDTLRNYINRALRQIAEAWCKDQKRTLEVLKELSKINPSAMLSAIYDKPIAAR
                     FVGDVISLAKCVEVDQNSVQVLRDMHTKEKGLCYSRPVVLYTFVNSSHVQYGQLGEDN
                     EILLGRYRTEACESPSLKIFIAGNSSYEYVDYLYKRMIPLDSISTVDTMISLDIDPLE
                     NTDFRALELYSRDELRSSNVFDLEDIMREFNTYKQRMVHVEGKVFDNVPAYLRGLDDM
                     MSGLGSAGKALGVAIGAVGGAVASFVEGVVGFIKNPFGSFTVILFLLAVLGVIYLIYM
                     RQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQML
                     LALQKLDQEKRRQAEADDEDFASNGQSAGFLDRLRYRRRGGYQKIQNEYEV"
     misc_feature    complement(76721..79174)
                     /locus_tag="BWV06_gp060"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     gene            complement(79233..81539)
                     /locus_tag="BWV06_gp061"
                     /db_xref="GeneID:30855073"
     CDS             complement(79233..81539)
                     /locus_tag="BWV06_gp061"
                     /note="similar to HCMV UL56"
                     /codon_start=1
                     /product="Cy91"
                     /protein_id="YP_009337506.1"
                     /db_xref="GeneID:30855073"
                     /translation="MNLLQKLCVVCSKCNEYAMELECLKYCDPSVLLAESSPFKKNAL
                     AIAYLYRRIYPELVRQNRTQTSLLSLYMEMILKALYEDTELLDRALKAYSRRQDRAEY
                     YRTVLRLDRCDRHHTVELTFTDNVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEV
                     CSQLLQLLRRLCGVSPVACQEAYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNHI
                     VVHRPSSQCDVNIQTVEQDLTELTQRIPSLSGVLTALKNLFSSSSVYHSYIQEAEEAL
                     REYNLFTDIPARIYSLSDFTYWSRTSEVIVKRVGISMQQLNVYHHLCRVLMNVLSRYL
                     YGEDVEDIFVLGEKLLSREQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKLHES
                     NEMYTKIKCLLDEIRRPVPDGGAAAEGVGAAIRGQDPQSTSSNGGPPDEDNEFLDYMD
                     ARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDF
                     ISRLMNGFIYRTRYRDNPDVVDVSQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQ
                     LCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEGTVYPSEWMVVKYQ
                     GFFDFSSCGDLNMLQKEMWKHVRELVLSVALYNETFGKQLTIACLRDDFATDHDLVLT
                     YNKEWPLILRHEGTLYKSKDLYLLLYRHLARPDEQNNVFREPDSVSVPVTVPRRARAS
                     RKRPRDASVLFDLVRDQDEQELVPASLC"
     misc_feature    complement(79614..81530)
                     /locus_tag="BWV06_gp061"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            complement(81686..85177)
                     /locus_tag="BWV06_gp062"
                     /db_xref="GeneID:30855074"
     CDS             complement(81686..85177)
                     /locus_tag="BWV06_gp062"
                     /note="similar to HCMV UL57"
                     /codon_start=1
                     /product="Cy92"
                     /protein_id="YP_009337507.1"
                     /db_xref="GeneID:30855074"
                     /translation="MTTMSNEELSAIAPVGPAAYLYFTKTNPETNEVLATLSLCDRST
                     PVVIAPLLMGLTVDQDFCTSVRTPVVCYDGGVLTKVTSFCPFVMYFHNTQEIIHFSEP
                     HGEVQRLCDETRQKYSLETYVPEEGRAPTDLAALCTAAGCDPQEVVVHVVVGNGLKEF
                     LYAGQLIPCFEEAVPTRLNDCDAVRVPLYPPTLFGSLQADADSDEVSLDKRNSFVESR
                     GLYVPAVSEALFYYVYTSWCQALRFSETKVLIEAALKQFVHDSQQSVKLAPHKKYFGY
                     TSQKLSSLEKDQLMLSDAVICELGFSFASVFLDSAYGASDSMVYSEWPVVMNAADHRE
                     LIKALTELKLHLSTHISALLFSCNSILYQNRLVYLTSNKNASGTGASQEALLKSIHFA
                     NGLTGLCEDTYNDARKLIKSSGTVVKDERYAPHHLALICGTCPQLFSALVWYLNRVSV
                     YNTGLTGSSTLSNHLIGCSSSLCGACGGTCCHTCYNTAFVRVQTRLPQIPRLPKKEPC
                     VVVMQSRFLNDVDTLGTFGRRYSAESKETNLDTKADEGSAPTSNRSASSSVDRTHRLN
                     RILDYCKKMRLIDSVTGEDTMTINGRADFINLVSSLNKFVDDEAMSFVSEVRMKSSRD
                     EVSGATQAFNLDLSPYAVAFNPILSYEYYRVILAIIQNVALITATSYIVDNPLTTSLV
                     SRWVTQHFQSIHGAFSTTSSRKGFLFIRNVKSSKNVDHDRLPDFKLYARGTYSVIPME
                     IKLSRLSVPALLMFRVKNRPISKASKGTTAHVFFRREHVPKKNPVKGCLGFLLYKYHD
                     KLFPDCGFSCLQFWQKVCANALPKNVSIGDMGEFNNFVKFVISVTADYNEHDLIDVAP
                     DCMLNYLEHRFHNKFLCFYGFKDYIGTLHGLTTRLTYQNHAQFPYLLGETPNFASPAD
                     FALRLKDLKAAGVIAPLAATVTRESLMRTIFEQRSLITVSFSVEKYAGVNSNKDIYQF
                     GQIGYFSGNGVERSLNTNSMGGQDYKFMRQRCILATKLSDVLIKRSRRENVLFDEDII
                     KNRVMAALDSDNLDVDPELMAMYEILSTREEIPERDDVLFFVDGCQVVADSLMEKFSR
                     LREMGVADFSLPNLQQVLDSRLEPGGGGEVHDLSALFTAPAVGEAAANSVGVNAGGGE
                     HAFDDDCGLLPAKRGRL"
     misc_feature    complement(81689..85168)
                     /locus_tag="BWV06_gp062"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     gene            complement(89218..91545)
                     /locus_tag="BWV06_gp063"
                     /db_xref="GeneID:30855075"
     CDS             complement(89218..91545)
                     /locus_tag="BWV06_gp063"
                     /note="similar to HCMV UL69"
                     /codon_start=1
                     /product="Cy97"
                     /protein_id="YP_009337508.1"
                     /db_xref="GeneID:30855075"
                     /translation="MSFEREERAHFRETQTAHERPVATHPEGTRHRAPAPSHIYTVAE
                     TPNRHHVASHPWQDMDLHKRYRGGPALSQLSDRERRAQRARRFCLDHESEHTPPFKRS
                     RYEAACTPHHHQPKQNSPPVRDSPESPPPGPDSGRRPQTTVVMRHHHHHHSHHRQHPA
                     SSNSRGAHIRQHHHQKHRHGGEEAVTVSPATSSNRHMMALINQELDSMDENQLRQLSR
                     MIEKKKEERQRLKGSEVRGDDSSQPSSTTSPVYDLQRYTAESLHLTPYPDDLKKPTAF
                     PQDKEQPGRLLMSHDELMNTDYLLNIRQQFDWLPASLLRRLVIEKSFSIFNAPSMHAL
                     LAMVDETLSYMKYHFVHGLPVNPYDPYMATVAGLRQLMFNKLNNLDLACILDNGQEWS
                     NNCQTLKNLVRKPNQMIDECTRDTALELQKRPPEVFENPIHRALAYVCSFSRAILALR
                     RRSRQIQNTPHFLDQYDDNGAICSYRCGMVAELILNALHQHQCQNELCELRIQKALQA
                     YQFMLAYCPFDTKCLVDLTVFQKDDDPQDTPIPSMMAVSTPQHSETAVVAFSPASYQE
                     PVVPNPVVVATTHIATPPRPASGVSPLNRDRTVFENNSESHGNIQAVVTAAPQAASPQ
                     AQQQAILGTSTDMAPAAPAVMCAGHEINFAPSQEMSQQQPPQQPVVWPTPFSTSSPVI
                     DTGGADSMMCAHIEPSGEPDWVAAISALSTLSDSSPCPSGAQQQQQQPQMAPAAATTA
                     IELFADSAALRCQTPEYEDMCYSDEDDDDDEEGYL"
     misc_feature    complement(89995..90681)
                     /locus_tag="BWV06_gp063"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; cl27025"
                     /db_xref="CDD:331846"
     gene            complement(91479..94217)
                     /locus_tag="BWV06_gp064"
                     /db_xref="GeneID:30855076"
     CDS             complement(91479..94217)
                     /locus_tag="BWV06_gp064"
                     /note="similar to HCMV UL70"
                     /codon_start=1
                     /product="Cy100"
                     /protein_id="YP_009337509.1"
                     /db_xref="GeneID:30855076"
                     /translation="MTLVLFATEYDSAHIVANVLSKSVSEHCVFPLLVKHHASNLVYF
                     CLQTQKCTDSQRVAPVFVVNNDVLNLAHYLHTHQPIPLSALVDSLNEEETKPIYNHLF
                     RTVISPEHGGEVREFKHLVYFHHSAIVRYLNLIFLCPTSPSWFISVFGHTEGQVLLTM
                     SYYLLERQYSTIPTVEEYVRSFSRDLGAIIPTHATMTEFTRMLLGSPFRSRIPQFVQY
                     AMARNQRDYDELVHVDRQINTFREQARLPDTVCVHYIYLAYRTALSRSRLIKYREVVA
                     YDEGAREEQCRQQPLFLGRHLADDLLSVMDKYFSLPNFLQDYIETHILSTENYDLRLS
                     GYSHQTTGPTLTGFFGTSSQVMRKLDTINSMSDSVFPVLERSLSGLLRLCASLKTANT
                     YATGSLAQYSQRQFLIPKETRFDGPIPLFRVQLPNDHHVFCAITCENWHQNLFPSDLL
                     KHVPDTEFTDEALTDMIWLHDDDVASSNAETQFYYTRHEIFNERLPTYNFIADFDLRL
                     RDGVTGLSKEVLFEICRGLRRVWVTVWQSLFEHTNPDYHPVYFFKSACKNLTPDFYDD
                     DNPPPSYETRTDYCKCSEKLGLRIICPFPERTLVIRPSVLRSIAQVLNHAICLDTLLH
                     QHLDPISHPESSLDTGIYHHGRSVRLPFMYKMDQEDGYFMYRRLLPIFIVPEGFREHP
                     LGFVRAQLDIRNLLHHHAPHYPPGSPRPPVSYSSSSSLSPDDHPSLPFSCTRIILGVR
                     DKLCPSPDINFMETRSVNVTRYEKRTLSDVIGYHLRGEVSGRPDSDPASDLNDLQRLV
                     VTRVWPLLLENLTQHYEPKVSEQFVPPHTLTFKPHGPHCVSVKRLEGSRTKDFRCLNY
                     THRNPQETVQVFIDLRTEHSYALWASLWSRCFTKKCHSNAKNVHISVKLRPPTSDQ"
     misc_feature    complement(91503..94217)
                     /locus_tag="BWV06_gp064"
                     /note="Herpesviridae UL52/UL70 DNA primase; Region:
                     Herpes_UL52; cl28059"
                     /db_xref="CDD:332880"
     gene            94230..94946
                     /locus_tag="BWV06_gp065"
                     /db_xref="GeneID:30855077"
     CDS             94230..94946
                     /locus_tag="BWV06_gp065"
                     /note="similar to HCMV UL71"
                     /codon_start=1
                     /product="Cy100.1"
                     /protein_id="YP_009337510.1"
                     /db_xref="GeneID:30855077"
                     /translation="MDLARRLWGFLSCQRRASAGADYVLLRPSEDVNMQEMQSFFEEN
                     FGTLGITPEDLKAFANDDEVTKHLLKLIPLYRHCQVKCRMLQDYLADSCQPHTRPAAE
                     VENQKSQRIMQALDVMILKLVVGEFSMSEDDTLEVLLNKFSTDQVALCEVQKVMGLVD
                     MDCDQSTSILDAAAAAAAANAENCSAAAEGGIDESVLAMIPHPPQEELPVVEEVCPPT
                     PIPPPSKPKRKKSTAVHMSV"
     misc_feature    94230..>94742
                     /locus_tag="BWV06_gp065"
                     /note="Herpes virus U44 protein; Region: Herpes_U44;
                     cl28003"
                     /db_xref="CDD:332824"
     gene            complement(95014..96045)
                     /locus_tag="BWV06_gp066"
                     /db_xref="GeneID:30855078"
     CDS             complement(95014..96045)
                     /locus_tag="BWV06_gp066"
                     /note="similar to HCMV UL72"
                     /codon_start=1
                     /product="Cy101"
                     /protein_id="YP_009337511.1"
                     /db_xref="GeneID:30855078"
                     /translation="MHDCSATLSQSTMLNVLSDRLDQQLSLVKQHKSRFQRLWRRASL
                     IKNGERQEPQDEHSVNLRYCLLFASNLNFQNVFRHPESNIYSPRRNVPYKWIPSSFIV
                     RQQHMQLAFYNKHIIWLSEQPNTSTPLGINLYVPIGYFGITFYKCLDSQFVCMPELIE
                     PGLQNLSMDVINLNYTFQAITPGTIEGDLCIFPCFCPEPWQVMNISPPNENYFFALRL
                     HQRIIIQPGHTQTVYLDAAFIHAPSTCALIVGTRQMNQLGIIIRPVIWLPGTVATVTL
                     VNTSGSAVYISGTTSVAKVVFTTRRFVYLLVHNHPIGQLLVPPTPDTGFTHMPEHHIL
                     QQLLACENE"
     misc_feature    complement(95017..96009)
                     /locus_tag="BWV06_gp066"
                     /note="dUTPase; Provisional; Region: PHA03128; cl28612"
                     /db_xref="CDD:333432"
     gene            96040..96351
                     /locus_tag="BWV06_gp067"
                     /db_xref="GeneID:30855079"
     CDS             96040..96351
                     /locus_tag="BWV06_gp067"
                     /note="similar to HCMV UL73"
                     /codon_start=1
                     /product="Cy102"
                     /protein_id="YP_009337512.1"
                     /db_xref="GeneID:30855079"
                     /translation="MHCKTMLRLFLWACLIVICVANNTSTASPTSKPTTVTTLKPIRK
                     HAEDDFYTAHCTSHMYQVSLRSFASIWICMNVVILIISFFVVLRHCCFQNFTTTTVAG
                     Y"
     misc_feature    96118..96339
                     /locus_tag="BWV06_gp067"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            complement(96332..97513)
                     /locus_tag="BWV06_gp068"
                     /db_xref="GeneID:30855080"
     CDS             complement(96332..97513)
                     /locus_tag="BWV06_gp068"
                     /note="similar to HCMV UL74"
                     /codon_start=1
                     /product="Cy103"
                     /protein_id="YP_009337513.1"
                     /db_xref="GeneID:30855080"
                     /translation="MGSEIKMWCIWLVVIISCSYLTCSKKKAKTTTYSPEMLQALKNP
                     TFRSYAYTIPMPKFPDKYRILAGPINNQSITYFWYDFNALQHRQPSNYIMCKFNHTNS
                     SMLLVPPPCGSIPSMNCLSEMINISLHNNTGEQACDVNTTYNPMLYNVPRWTTRIYVG
                     KNIVVLDSQSIYFLGLSEVIFRNLLRYNCSKSFYLTNAMSRNLFKFPHITLWKLKQGM
                     RRLHRRRKPKKNNTQKRSRRSANNTTTTIMPTVTTKLYNNSQESVIVDTSENYTLPIF
                     VTQLQDMVTWLYTTIRYNQEPFCDKSRNRERQSAWANHTRQILYNDTVWSIHGIVNLT
                     TLYEITPPYSNTTQINNSLFIDPLWDHIDSLAFKEEIRRNTSIETRLRPTNLSLSILP
                     P"
     misc_feature    complement(96398..97369)
                     /locus_tag="BWV06_gp068"
                     /note="Herpes UL74 glycoproteins; Region: Herpes_UL74;
                     pfam07982"
                     /db_xref="CDD:285256"
     gene            complement(97730..99892)
                     /locus_tag="BWV06_gp069"
                     /db_xref="GeneID:30855081"
     CDS             complement(97730..99892)
                     /locus_tag="BWV06_gp069"
                     /note="similar to HCMV UL75"
                     /codon_start=1
                     /product="Cy104"
                     /protein_id="YP_009337514.1"
                     /db_xref="GeneID:30855081"
                     /translation="MRRGLALCVLAAWLLACHAETSSNAYSHLTLELTGRPIQFLRQN
                     STKCNNNGTRRNLTLVRENAITFNFYESANHYTVFQLPRCLFTGEFADNLLNQVDLSK
                     TFQQYASTLNTYATVSQDNIQYKYYGQNLSYQNNLKEQASTVPPPENLRLQTTTSYGK
                     PTTVNASKIHAPAFNGTCYLFKDHELLFTTRESCLYQSFYVTEHDYMTITLTESFVVL
                     TVVIRETPLLLIFGDTKRIMFKAPYRRENFILKQTKHHQLIVLVKKDHIHYHTYIKAT
                     DFADSLLSKNYMDLDVLLSTWNRHAVNVLQNGQCRSTTKATVETALGYGILLYIASTS
                     PTTPTSIALAIDQQSSILLAEDFISSCMSKIQPRTTLLMYPNAVQLANSTLRTTGHIS
                     SVLTISRLIYILVKQHHQDLVSKHDMEQIRNLILLLHKTHISSFLSRFARQELYLASG
                     IIHSMLHHSTERRAIFAFETGLCSLAELSHWSQLIGSEEHNHVSDLYSPCAGSGRRDH
                     ALEHLQKMFPRATNSRTIKTALSVLETLRPQTLATFPEISCVSTTKSFAAFTVSHATT
                     YLVSTEYIAKGTSFPVLTTVVGRSIIITYIPANSTCSPSSSKHDTLPIVMIRNITLEH
                     CEFCQSTLVEYDDSEGIVNAMYIYDTDDLLFALNYDNHVIAKSPKTHYLMFLKNGTVF
                     EVTEAVVDQTDTHIALIVIYILAAIVGLYLLYRIVKLM"
     misc_feature    complement(97733..99892)
                     /locus_tag="BWV06_gp069"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03295"
                     /db_xref="CDD:223036"
     gene            100025..100909
                     /locus_tag="BWV06_gp070"
                     /db_xref="GeneID:30855082"
     CDS             100025..100909
                     /locus_tag="BWV06_gp070"
                     /note="similar to HCMV UL76"
                     /codon_start=1
                     /product="Cy105"
                     /protein_id="YP_009337515.1"
                     /db_xref="GeneID:30855082"
                     /translation="MSLGSGAITSLGDLPNFRKRNGQKKHLDIYRRIVRAFPSFVAFN
                     RLLGGLFPTYCKNYRRWLFFEVRLTQRIPDCVVLFVSPEAPRRVLCYVIEFKTTCSDA
                     DGQSVRQHVTHNLQYVQGLKQLKGALTDFEALKVPRGDSWSVIPTIIFFQQQATQPSL
                     ARAFRSAPFTLRTDSVIDYLKRRQDESVATLLSATHRSVRASCRKHSQVSSSRATKAS
                     GRLRRGAAQGGSGGQPGKKALPARRAQRSQPKNPDVLRRPGKSRVRGGGAAQTTVRSR
                     SAAVSGRRRRGNRRKGDL"
     misc_feature    100064..100597
                     /locus_tag="BWV06_gp070"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; cl27526"
                     /db_xref="CDD:332347"
     gene            100578..102365
                     /locus_tag="BWV06_gp071"
                     /db_xref="GeneID:30855083"
     CDS             100578..102365
                     /locus_tag="BWV06_gp071"
                     /note="similar to HCMV UL77"
                     /codon_start=1
                     /product="Cy106"
                     /protein_id="YP_009337516.1"
                     /db_xref="GeneID:30855083"
                     /translation="MSLLQPYYRLPIVLFEPHAENILRCPPHVLQRLVDDSVAGLRKE
                     EVVANQVRKRYLREELSDLNQRIQTYCEDLESRVSEAEALLKQQCEVDPPPCQDVAAA
                     ATAAKEIYSSGGGPEAPPQKVTRSDRAQAATWVAQCSDQEKEVLFFGITKNDPFIRFH
                     TDFRGELINTMFENASTWTFTFGVWYYRLKRSLYTQPRWKKAFRLVQMENFSISQELL
                     VGAVNALENVTVYPIYDCVLSDLEAAMCLLAAYGQNHWDGRDLPTSIQGVLTELPHLL
                     NKLSDEVGREITTWDGTATANYYAYQDSPDLKYYMPLSSGRHYSPGTFDRHVLVRVFH
                     RRQVIQSLPGYGAQTAAVVQERMSGQVRDDGLSVWCRRLLAGKVGRDVPIFVHEQQYL
                     RSGLTCISALLLIWKVVNSESVFAPRAGKFTLADILGNDALPRTSSEDDSYSYGHRVR
                     NFEFLLEHYIVPWYTRDPTVTISQLFPGIMLLAITESVRSGWDPARRNDGQAGDGSGT
                     VLMQISKVNPVADFMFAQSSKQYGELKRLELHDALLFHCEHGLGRLLSVALPRHRVFA
                     LGSSLFNVNDIYECIYFSVLGFLPAVVVM"
     misc_feature    100578..102362
                     /locus_tag="BWV06_gp071"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03252"
                     /db_xref="CDD:223024"
     gene            102492..103637
                     /locus_tag="BWV06_gp072"
                     /db_xref="GeneID:30855084"
     CDS             102492..103637
                     /locus_tag="BWV06_gp072"
                     /note="similar to HCMV UL78"
                     /codon_start=1
                     /product="Cy107"
                     /protein_id="YP_009337517.1"
                     /db_xref="GeneID:30855084"
                     /translation="MITERVLAGILAGMTAAGSLVILLAVVMWLNMLDRAGMPMAVGH
                     YTGNLVLAQVLCIFSMLASKIVAMTSAAGMGFCGIVVFVEDSGLYVTSLLFMFMILDR
                     MAAFLNGRLFWRQQTTKQNQSTSVYIILFCWVLGMAAAVPSAAVAAPNSRWERCEVPV
                     SYATIDMIVKLWFVLLAPFVLTMAVIIQSSYHRDRERIWYYARRVFMFYTACFVMMVP
                     YYFVRVMQSDFALVDIKAKTKAAGNGGCDSTFLDYLDMFTQVLNSFKLVVFALFIVLF
                     CSINPLETLGECLERADAERQSRSEASQGERRRPINTCCVKLVESIKHYVSTLSKATR
                     ENSDERANLPNNAEDIGTTGSDQLPTEVTVTPSSSAVFSTGGTVSPV"
     gene            complement(103739..104539)
                     /locus_tag="BWV06_gp073"
                     /db_xref="GeneID:30855085"
     CDS             complement(103739..104539)
                     /locus_tag="BWV06_gp073"
                     /note="similar to HCMV UL79"
                     /codon_start=1
                     /product="Cy108"
                     /protein_id="YP_009337518.1"
                     /db_xref="GeneID:30855085"
                     /translation="MSSPTDEARVRTGKFSFTCANHLILQISEKMSRGQPLNTLRLEE
                     LKILRLICVLLFNRGLETLLLRETTNNLGVSDNAVLSRKTPTSYWPHLYQELRRTFPQ
                     LDFHVIFHEEQAAQLSQKLSQPHLSTALLSRFVQRHTGLLISFPEDLARNGNLLFSLG
                     TLYGHRLFRLAAFFTRHWGTATYEPLIRIICQKMWYFYLISTGKMTISSEAFEIQRSR
                     HEMGIFTFIIEDYKAFAGTLSLTPRMTLNPEAVASAKALHTPTACGDM"
     misc_feature    complement(103745..104515)
                     /locus_tag="BWV06_gp073"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03364"
                     /db_xref="CDD:223057"
     gene            104538..106376
                     /locus_tag="BWV06_gp074"
                     /db_xref="GeneID:30855086"
     CDS             104538..106376
                     /locus_tag="BWV06_gp074"
                     /note="similar to HCMV UL80"
                     /codon_start=1
                     /product="Cy109"
                     /protein_id="YP_009337519.1"
                     /db_xref="GeneID:30855086"
                     /translation="MAAPVYVGGFLVRYDEAPEEAELVLPSDVVDRWLRESRGPLPLN
                     VNHDESATVGHVAGLKNVRAGLFCLGRVTSPKFLDIVQKASEKSELVSRGPPSQSSLQ
                     PDGVLEFLSGSYSGLSLSSRRDINAADGASGDAKTASFKHVAICSVGRRRGTLAVYGR
                     EPDWVMERFPDLTEADREALLAQLTTTAAVAGGEEEDDVVRKKNNNKSQGPDADPFQS
                     DPYGLLGNSVDALYIQERLPKLRYDKRLVGVTARESYVKASVSPAEQEACDIKVEKER
                     PNESQHSRAPGESMSHPMSSVATPAASSVAPSQASLALAHDGVYLPKDAFFSLIGASR
                     HATDSAGARSVYPAAPPHHAYPVMNYEDPSRSFDYTAWLRRAGYDAGHPQYPPVPFHH
                     LPPYRRRDFPMMDDSDRMAWERGYAHPSNYDSYGNNGGNSWSRGRNGGTGSHNNGNKR
                     RRDRDLSSSDEEDMSFPGEAEHGKARKRLKAHHTRGGGGDHSSDAKGDHRYDEIREAL
                     QELRREMMAVRQIAPPALLGPAQLTVPTSSPTTTSHPSDVVTSEPPQTSSSPPSAHSS
                     KSADRGVVNASCGVSVQPQDGGPTPPVKDIVDLNRRLFVAALNKME"
     misc_feature    104601..105602
                     /locus_tag="BWV06_gp074"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            105405..106376
                     /locus_tag="BWV06_gp075"
                     /db_xref="GeneID:30855087"
     CDS             105405..106376
                     /locus_tag="BWV06_gp075"
                     /note="similar to HCMV UL80.5"
                     /codon_start=1
                     /product="Cy109.1"
                     /protein_id="YP_009337520.1"
                     /db_xref="GeneID:30855087"
                     /translation="MSHPMSSVATPAASSVAPSQASLALAHDGVYLPKDAFFSLIGAS
                     RHATDSAGARSVYPAAPPHHAYPVMNYEDPSRSFDYTAWLRRAGYDAGHPQYPPVPFH
                     HLPPYRRRDFPMMDDSDRMAWERGYAHPSNYDSYGNNGGNSWSRGRNGGTGSHNNGNK
                     RRRDRDLSSSDEEDMSFPGEAEHGKARKRLKAHHTRGGGGDHSSDAKGDHRYDEIREA
                     LQELRREMMAVRQIAPPALLGPAQLTVPTSSPTTTSHPSDVVTSEPPQTSSSPPSAHS
                     SKSADRGVVNASCGVSVQPQDGGPTPPVKDIVDLNRRLFVAALNKME"
     misc_feature    <105405..105602
                     /locus_tag="BWV06_gp075"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            complement(106492..108141)
                     /locus_tag="BWV06_gp076"
                     /db_xref="GeneID:30855088"
     CDS             complement(106492..108141)
                     /locus_tag="BWV06_gp076"
                     /note="similar to HCMV UL82"
                     /codon_start=1
                     /product="Cy110"
                     /protein_id="YP_009337521.1"
                     /db_xref="GeneID:30855088"
                     /translation="MDRPPEEEEEPRPSTSRALAPAVTFERLTCQILRLVCTQHSPLE
                     IDAVQTMNWHTSVEVANRAVICAFQEMKSSRDALQLTDLNLKGHCSSTFRDSLRTDAC
                     NYANRRLSPGSQTSAMLVFALPVVRVPVTGIHLFRGRGNSQNRPPRANARTTIRRAQY
                     TWTVKVNVSAITWTRKRDQYVEGGYTFTTDFTFLTGLIPLTLVDAIDQLACSNGETYV
                     QKAETIGEENVILVSLVHFSLHPPTEVFLQLSVYAHRAEVMWRHNPNPFFERHSENGF
                     LMKCPLNVTIPPHQTYVVQFNNALETQDTCLAVFFPLELPGISMDAGPLPNRTKITVN
                     VQNLTANAITLAHMQMLGFIHLFRRGSVGVLPNKTETPRCSQIRLRAGLVPRDSILRG
                     ISEFAQQSNNSSSSEDEEEEGPPITPPIITEAIFDPFQTEDSSEDEDDEPQTTMDRLR
                     RETQKAKREGTTPPMTHRERLPKTAMLLVVPSWNLYIHPDLLLPLTARIAEEAVKNTS
                     YLRSELDGDICTAADLKTTLQALAQIPGRRSPSGRPQRPRI"
     misc_feature    complement(107062..108069)
                     /locus_tag="BWV06_gp076"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(108271..109893)
                     /locus_tag="BWV06_gp077"
                     /db_xref="GeneID:30855089"
     CDS             complement(108271..109893)
                     /locus_tag="BWV06_gp077"
                     /note="similar to HCMV UL83 (UL83A)"
                     /codon_start=1
                     /product="Cy111"
                     /protein_id="YP_009337522.1"
                     /db_xref="GeneID:30855089"
                     /translation="MALSQRYRLDYVSELGPIAGKVIQSVFDEAREPVKPHETKIVKT
                     GLRVQVHRPSIIFLTQFARNLKPDPRYEHNTLQIKHTTFEDQELKDVYLHVHNPTDKP
                     ITPADEPMSFFLYALPLRHLVPADLTLHPGGTYNPELPTYDAAVQAFAQGYHTRFNAY
                     HLQWTQRYNRWMPHGVHHTASFYVNTSPMPLWSINVANELVCSLRNTHVRKVQLVDKV
                     KGLVRIFLESFQEETPDDKVFIHLAWEQSSGIITMNRNPKPFLTPQQRNGYTILNPKR
                     LHLKPREHANVMIDTYFESDKYIGFICPNSVPGCSISCNPIMSTQCIFIEIRSLHDSV
                     YIEAFQAIASLHFFDRSLFFTYKKTDHSIFRDQYRITTSFEYHQGKGVPIVQDSSEDD
                     DSSSSESEDMDVFEVASTTPHAGTSSSSASKKREKLYKPLVQRKRFTEDDGARKSSSD
                     DDNDDFFPTLFWGVWQFGVRASELTPMIASVCGDQLPHQEFSWEGDDDLRIFSGLSGS
                     WHMYQTPKRRHYSPSEQLPSTSGESVSKRPCE"
     misc_feature    complement(108835..109851)
                     /locus_tag="BWV06_gp077"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(109962..111593)
                     /locus_tag="BWV06_gp078"
                     /db_xref="GeneID:30855090"
     CDS             complement(109962..111593)
                     /locus_tag="BWV06_gp078"
                     /note="similar to HCMV UL83 (UL83B)"
                     /codon_start=1
                     /product="Cy112"
                     /protein_id="YP_009337523.1"
                     /db_xref="GeneID:30855090"
                     /translation="MASRPPRFPDLVTDLGPTSGHLVKLIFNANKEHLNPHTTYIADT
                     HLNVTVNQPSVIMATQFTPESQPCQRYDTNLQIKHTAFEPRSLEPLVVHVHNPTDRPI
                     PTTTEPLSMYVYALPLDPVTPPELILRQGESHKRRTTVADAVVQQIDDKKWHTRLTAS
                     RLVWSRNQSRYTANSVYHTTSFIFNSQQMPLGSMNTASELVCSIPHTHVTNIRKISKD
                     EVKVYLECLQEDTPETKCFVHLAWENGNHDIVMNRNPKPYLRAHDRNGFTILCPQTLH
                     LKPGKTSHLMFDVCFESDKYVAIICPRTIPGISMSCNPLLPLQNLFMEIKAVHESLYI
                     EQYEELGWLYFFDRKMILTKGTAAEPTQARLVDQHRLMAKLEYHHVYGDQADDESGSS
                     ASDSDMEVFRHPPSGSSARRPSQPPSSSSRKPSSSAAASSTMTTRSKHRVTKAETSDE
                     SEEDDDDRETLVFSWPNWQCGIKSTSLVPIVASAHGDRLPYQDFPWGEGDDYRTFSGI
                     EIDLQPYQTQRRRRHTRLEAIPESCTVSVTKKHRS"
     misc_feature    complement(110538..111551)
                     /locus_tag="BWV06_gp078"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(111712..113133)
                     /locus_tag="BWV06_gp079"
                     /db_xref="GeneID:30855091"
     CDS             complement(111712..113133)
                     /locus_tag="BWV06_gp079"
                     /note="similar to HCMV UL84"
                     /codon_start=1
                     /product="Cy114"
                     /protein_id="YP_009337524.1"
                     /db_xref="GeneID:30855091"
                     /translation="MPRADKTLRNGPRGRPRKTPPSLLLDETILTLTDQHHVKRPLPR
                     QGTYRLIQLHVDFQPSDLQHPFQILLSTLLQLEPLSPHRDPEEQGLLCAVANPDSDIF
                     PILSPFPAQAGSCNIIRAIIEEQLTQMSIVRLSLNIFALKTMPPLRHQLPLRRKVTQH
                     SALHDCVSLHLPDLTFVNDKISNTSELTIPVKSALCWHTAEGGISGPRGLASRISVRL
                     SDATIQNMGPATFGQLYTDTDCPDLILSSLILYQDNILRFNVTFRSAQHQLPSNPIVS
                     FKLRLRQQTVTRPFFSDTPLPYFLPRKQPGGGLDVCLPYDLSLKTSHLIRIYRRFYGP
                     FLGLFIPHNRQELNMPVTIWLPRTWLEISVIGDNTHIPKNTVLGQLYFISSKHSLNRG
                     RLSALANQVKSSLHGTPHQVSLLGASFSLQDLAPMRLSNPSPETTQQQQSPTNNNKPV
                     TIAMVCNQRQPQQQQPQNSASPP"
     misc_feature    complement(111766..113055)
                     /locus_tag="BWV06_gp079"
                     /note="Cytomegalovirus UL84 protein; Region:
                     Cytomega_UL84; pfam06284"
                     /db_xref="CDD:283854"
     gene            complement(113165..114091)
                     /locus_tag="BWV06_gp080"
                     /db_xref="GeneID:30855092"
     CDS             complement(113165..114091)
                     /locus_tag="BWV06_gp080"
                     /note="similar to HCMV UL85"
                     /codon_start=1
                     /product="Cy117"
                     /protein_id="YP_009337525.1"
                     /db_xref="GeneID:30855092"
                     /translation="MDSTIFCTFEQKLSLTDVGKLAKLTGAIIPIPQRHHLIKHHHLG
                     LHQYIDSTRGYARLRSLLRNMTPTILRRIEGNQLAMQVPTHGHLYTVLNTGPVLWEKG
                     DALCQLPPLFSGPLVREHPVSVGNWNLVLPWLLPAPLAVEINQRILIMALYSLDRSYE
                     EVKAAVNQLQHVTFRDATFTIPDPVIENHLLLDMKTACLSMSMVANLASDLTVNYVRK
                     LALEDSSMLLTKCQELLMRLNRDDDGTGGNNSNRLLRGRPSHVSPDEEISRLSALFVM
                     LRQLDDIIHEQVMFTVCDVSPDNKSATCIFKG"
     misc_feature    complement(113168..114091)
                     /locus_tag="BWV06_gp080"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03259"
                     /db_xref="CDD:165517"
     gene            complement(114152..118183)
                     /locus_tag="BWV06_gp081"
                     /db_xref="GeneID:30855093"
     CDS             complement(114152..118183)
                     /locus_tag="BWV06_gp081"
                     /note="similar to HCMV UL86"
                     /codon_start=1
                     /product="Cy118"
                     /protein_id="YP_009337526.1"
                     /db_xref="GeneID:30855093"
                     /translation="MENWSAVELLPKVGIPADFLTHVKTSAGEEMFDSLRIYFGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLQTALASAAHAIKFDDLNKLTTGKMLFHIQVPRVAS
                     GAGMPTSRQTTIMVTKYSEKSPITIPFELSAACLTHLRETFENTILDKILNVEAIHTV
                     LRVLKNTADAMERGLIHCFIQVLLRKAPPYFVVQTLVENATLCRQALNRIQRSNILQS
                     FKTKMISTIFLLNRTSDRDYILKLLTKMVESTTNSILENPATYVTASGQQLRGVMVST
                     AQVIQTLMTLLKSNISKQGVSAPATYGNFVLSPENAVTAIAHHSILADFNSYTAHLTS
                     GNPDLTGSSLEKAGQNSQTSLPMDILQLGEHAVALEHHRHVYKNTDTKNPLERNIDLT
                     FFFPVGLYIPESRAYTTVENKIKLTETKDNALPTSVYLLNRDRGLERLDFVDALQCLC
                     HPVVHEATPCLQVFTERGVPTDPAVARLTECRFQQESMAGIARRLTHFYRVRREVPRT
                     PNEMKQDYTPSDFYKIGNLSLYTELHPFFDFAHHQENGETATLCTPRIVTGNIPDGLA
                     PSAFQELRASHIAEMVRLRPPPDYEATLQLFKSTVTCPNYPELFYLVDLLVHGNVDAF
                     LVIRPFIARCIVSAFQNRQMLAFAHSYTMIAMIVEHLGDGLLSSQIHTHYRTIMAILR
                     LVTRVSSLPGLNNGQLVEEPLSAYANALHDHRLWPPFVCHLPRNREGVQIIADRQPLN
                     TANIESRHHGVSDVPRMAAMDADEPLFVDDYQATDDEWTLQKIFYLCLLPAMTNNRAC
                     GIGLNLKTLIVDLFYRPAFTMPTEPESVGEMLTQLVDEIATNEDVNLFEACRELFLVL
                     QFVPEHAKVLEVRAQLDPAQRHGATDFTSLQHVLYNGCCAITAPKILAEYCIVVPFHR
                     FYSDPTICAALNDDIKRFVTDFPHYHRHDGGFPLATAFAHEYWNWLRSPFSRYTAGCP
                     NTLQSVLTLACMLYKISPVSIALMAKSGVHPGFGLTAVRTDTFEVDMLLYSGKSCTSL
                     IINNPQVTKEERDINTTYHVTQNINTVDMGLGYTSATCVAYLNRSRSDMGVRVQNLFR
                     VFPMHVHRHDEVDRWIRHAAGVDRPQFLDTETISMLTFGSMSEKNSVANLHGQKAACE
                     LIITPVSTDINYFKIPNNPRGRTSCMLGVDPYDTDAAIKTLYDHTEPDAQTFASTHNP
                     WASNRGSLADIMYNIKNRERLGYNSQFYSPCAQFFNTEEIINANKTLFKTIDEYLLRA
                     KDCIRGDTDTQYICVEGTEQLIECPCRLMQEALPILSTTTQALMESKLKNPSGSLATS
                     ETHFGNYIIGETIPLHQHMLFNS"
     misc_feature    complement(114173..118147)
                     /locus_tag="BWV06_gp081"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     gene            118198..120750
                     /locus_tag="BWV06_gp082"
                     /db_xref="GeneID:30855094"
     CDS             118198..120750
                     /locus_tag="BWV06_gp082"
                     /note="similar to HCMV UL87"
                     /codon_start=1
                     /product="Cy122"
                     /protein_id="YP_009337527.1"
                     /db_xref="GeneID:30855094"
                     /translation="MASSPTVFQCRAAQDALIVESTAEPQVVNVPVHVNSYNLTQELS
                     SVEDARFCQTQPVDAERVRGVFGALYRAAAPHLREESDRIKLILGRLLLGPVAVPCYC
                     DEWEANEYMVDAPQFCGGPLLYVHRRCHCPIVGRALAFTVMEGHIATHVFRGLLSLSE
                     WNQHLPDMFCPCGSLDRRDRYSMACLPRDLTLYINDYPYFMMEIGRVLTVSEVDDYVS
                     LMINYLGEAVTPRLQVHYKLLFGVNVRPVAPLALISTCEFFVLELQKMWLGVEYHNEV
                     TADFFGRVFSQLHRDRGRVMMALRLPEQTVCHLSHFTLGRFKRQVLYFKLSITYGKYK
                     AGVAKNVLCYRRLSLAFGEHDTVWRNLFYVYYEIGRIGTVNSSESRSSPPPPPSSTRP
                     VNHSQPPPARWSSASSRGPATTAGVTTHRDSSGDRLKRYVCIISRLMFVRYGQTYRRE
                     KHDHVFDFTGRTLREAAQQQRRQKQLAAQRHATSRRKFIGGMEFSEITGVSLDRIAVN
                     AFNTNRVINMKAALSGRVGCRVNRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYT
                     NSLNVNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQTVIRSER
                     SKVYWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGCDLEAILLQELSCIKNMRDVCI
                     DYGLHRVFTKMELRNSYQIPFLSKQLILFIRACLLKLHGRDKRLYLDRLVFEAVQRGV
                     FDYSKNITAHTKIKHTCALIGSRLANNVPKILTRNKKIKLDHLGRNANVVTVCRHLEA
                     NKISRARLKVLVDVLATLQGLSETTHTQNVIRQTLLRLCGAVPSSASSSSSV"
     misc_feature    118207..120720
                     /locus_tag="BWV06_gp082"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03375"
                     /db_xref="CDD:223064"
     gene            120762..121964
                     /locus_tag="BWV06_gp083"
                     /db_xref="GeneID:30855095"
     CDS             120762..121964
                     /locus_tag="BWV06_gp083"
                     /note="similar to HCMV UL88"
                     /codon_start=1
                     /product="Cy123"
                     /protein_id="YP_009337528.1"
                     /db_xref="GeneID:30855095"
                     /translation="MDNDKNKAGVSVSSDEELPGPGWRDAALIMHNGMVREHMFYHPD
                     VAEIVRRMIPPPPDAEEGCVFASELAFYTSGRCNRASSVFSIYWQNNSEIVYALTGIT
                     HCIKIVVECGQVGSDSVERQFYDTPGIYLIRVSDGTVVPRNVVWPGTSVRWSKEVGIR
                     VVQRRVTVARAFVSLFRNYLFWTKQPFSEDLCPCPQDVEDRLFPLLNLSRGDIEVFDK
                     RVCCAYKRLQKNDLPRAGRRLLDHCVNLAASKKILLLDLPRLENFFLAQVCLYELDED
                     EVGEELLGMLCGKSTESDSTFLLHRKTMKVAACIAFILNCFYKHQERLPEVNQRVDEC
                     DLAVIALRRYYRHHAGIQTRAIAMAQKFLTDYSESFSPFKSFSRMEVQVPLDAAVTRK
                     QLVSVLRS"
     misc_feature    120816..121961
                     /locus_tag="BWV06_gp083"
                     /note="Herpesvirus U59 protein; Region: Herpes_U59;
                     pfam04529"
                     /db_xref="CDD:309600"
     gene            complement(121961..127498)
                     /locus_tag="BWV06_gp084"
                     /db_xref="GeneID:30855096"
     CDS             complement(join(121961..123094,126617..127498))
                     /locus_tag="BWV06_gp084"
                     /note="similar to HCMV UL89"
                     /codon_start=1
                     /product="Cy124"
                     /protein_id="YP_009337529.1"
                     /db_xref="GeneID:30855096"
                     /translation="MLRGESASRIQERYQELLKRKNHPSSCISTSFTNVAALCRKRYQ
                     MMHPELGLAHCCNEAFLPLMTFCGRYRDYHSEEDRRTLLFHENLKTALDNLNFLPCPE
                     DQRQSYQKLDALTELYRDPQFVQINNFMTDFKRWLDGGFATMEGDAKPIRLEPFQKNL
                     LIHVIFFIAVTKIPVLANRVLQYLVHAFEIDFLSQTSVEVFKQKATVFLVPRRHGKTW
                     FIIPIICFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRHTFAKDYVVENKDFVISI
                     DHKGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFI
                     SSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHTFTEKGDATACPCYRLHKPTFI
                     SLNSQVRKTANMFMPGSFMDEIIGGTNKITESNVLITDQSRDEFDILRYSTLNVNAQE
                     HFGKTIYVYLDPAFTTNRKASGTGIAAVGLYRHQFIIYGLEHYFLRDLSESSETAIAE
                     CAAHMLTSVINLHPYINELRIAVEGNSNQAAAVRIACLIRQNVQCNSLIPVLFYHTPD
                     QNNIEQPFYLMGRDKRLAVEQFISRFNSGYIKASQEIVSYTIKLNHDPIEYLLEQIQN
                     LHRITLAEGNTTYSAKRHHKYSDDLVVAVIMATYLCDDIYTARFKAS"
     misc_feature    complement(join(121964..123094,126617..127498))
                     /locus_tag="BWV06_gp084"
                     /note="DNA packaging terminase subunit 1; Provisional;
                     Region: PHA03372"
                     /db_xref="CDD:177609"
     gene            123225..123533
                     /locus_tag="BWV06_gp085"
                     /db_xref="GeneID:30855097"
     CDS             123225..123533
                     /locus_tag="BWV06_gp085"
                     /note="similar to HCMV UL91"
                     /codon_start=1
                     /product="Cy126"
                     /protein_id="YP_009337530.1"
                     /db_xref="GeneID:30855097"
                     /translation="MNALLAELNRLGVSHVTTEDVFTFAENVFHNFGFLFQTEESGPR
                     KIDLVSSLFEHLTVECVNDILDACSHESPDGNGTSAAPPHAQKEQGGGSSGGGRTGHV
                     "
     gene            123421..124131
                     /locus_tag="BWV06_gp086"
                     /db_xref="GeneID:30855098"
     CDS             123421..124131
                     /locus_tag="BWV06_gp086"
                     /note="similar to HCMV UL92"
                     /codon_start=1
                     /product="Cy127"
                     /protein_id="YP_009337531.1"
                     /db_xref="GeneID:30855098"
                     /translation="MHAVMNHPTGTGPPRHHRMHKKSKVAAAAAAGALDMCDVSGTCD
                     MRHVQNVFTEEIQLHSLYVCTRCFRTHLCDLGSGCALVSTLEGSVCVKTGLVYEALYP
                     VAREHLLEPIEETSLDDVNVIGAVLAEVYRYLMSHAARYADVIQEVVERDRLKKQVEE
                     NIYFTFNKVFRSMQNVNRISVPVISQLFTQLIIGIYSKQTKYDSCVIKVSRKKREDAL
                     LKQMRSEYGNAPVFGLGV"
     misc_feature    123547..124107
                     /locus_tag="BWV06_gp086"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            124097..125662
                     /locus_tag="BWV06_gp087"
                     /db_xref="GeneID:30855099"
     CDS             124097..125662
                     /locus_tag="BWV06_gp087"
                     /note="similar to HCMV UL93"
                     /codon_start=1
                     /product="Cy128"
                     /protein_id="YP_009337532.1"
                     /db_xref="GeneID:30855099"
                     /translation="METHLFSDLAFEQVFEEDPQLPLHVVLDPVDLSFAEAETVRYVY
                     YRSDPDPVGRWRRAAFRVFLRPFELLTYLRDAGLTVAPTARVLCHHALFTTLGIRCAE
                     QRLSGAQMLYLRLVWNEERFRDWEFLARDLLREEMSVCQSTEPADRPDPSLLMTDAML
                     ELAKSSSTTAPFFEMPSSGTGNNNASSASAADESSQVERRVIQFLRGDSELTYHAGPL
                     EPPSKIRGHEIVQPRIEVNPDVIYASGPHEDDRTSKTDEWQKGGVVRLGSVWDVRQRL
                     RLHVLWYAQSFWRSRGLKYEDREEDLRLTLDSYFDRLSVEYQLLREVYREIKAVLRSD
                     RMVAQKFSCHLSIETSWLLIWELFDRALELWRDQADVNSCIIKALAHKLRSKARSSHG
                     NSVSAGKTNPTETWYADVVRCVRAEVNLGLEVQVETCSQSGLWLVRGRDGQLRKWITQ
                     PQTYVLYATPGLVFHWVLPGGFAISSRVCLDGVGRDHFERFQMSAPVLTKRMLLETGW
                     TRTEASGIPSCGL"
     misc_feature    124097..125536
                     /locus_tag="BWV06_gp087"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:309621"
     gene            125538..126578
                     /locus_tag="BWV06_gp088"
                     /db_xref="GeneID:30855100"
     CDS             125538..126578
                     /locus_tag="BWV06_gp088"
                     /note="similar to HCMV UL94"
                     /codon_start=1
                     /product="Cy129"
                     /protein_id="YP_009337533.1"
                     /db_xref="GeneID:30855100"
                     /translation="MASGGITSNDSRCLRQFLQKECCWRQVGRGQKHREFQAVACRSA
                     IFSPPGGDASCLACQLLLFKRGGENLICFSCNGNYMGTFCCPRIQRVRQDLVGLHTTY
                     KLVFLGQLGPARVDFVPAFSPMTSVVPRCSITPSLLYEVCTLVPPEEAEKIRVKGCSG
                     SYEPGMEKAISLGGAGAWLVNNSSGYTLYFYILCYDLFTVCGNDQETPSMARLMALAT
                     ACGQVGCTYCKDHGGHVDPTGCYIGPVPDKGNCLCYTLCNSPTMNPITNENPVAFFCD
                     VERATYLCAVGSKTKSKVTLADSLDYHIGAKNETGDWLPLNASAWQLVRVEEPVSRMI
                     VCACPVLKNLVH"
     misc_feature    125538..126575
                     /locus_tag="BWV06_gp088"
                     /note="Herpesvirus UL16/UL94 family; Region: Herpes_UL16;
                     cl28066"
                     /db_xref="CDD:332887"
     gene            127497..128789
                     /locus_tag="BWV06_gp089"
                     /db_xref="GeneID:30855101"
     CDS             127497..128789
                     /locus_tag="BWV06_gp089"
                     /note="similar to HCMV UL95"
                     /codon_start=1
                     /product="Cy130"
                     /protein_id="YP_009337534.1"
                     /db_xref="GeneID:30855101"
                     /translation="MATYVSPPSAAAAAASSSSPAANTTTTPLSFSSSPVSVVPDGVP
                     PRSVGLTAAAGIAASTAVSTSLCAVERMVELSTQTPADFEVQETLRFDEAVNMALVAC
                     EAVSPYDRFRLIETPDENFLLVTNVIPREPAEMPAVGAEAERTFPTRHHDVLDGFSNL
                     SVPLPPPCGVRDYALHNVDRLTYEGELVYGSYVLYRKNHVELSLSSNKAQYVETVLRN
                     AYTPGLLDHHNVCDIEGLLYLLYCGPRSFCSRDTCFGREKHGCPFPALLPKLFYEPVR
                     DYMTYMNLAELYVYVWYRGYDFPSASDSSSGGDDDELRLPLKAVSLDRLKEVLKAVRG
                     RFVGREVPTWPASSRTCLLCALYSQNRLCLDLARDEAKTVHYSPIVIQDCPAAVTDVT
                     LSHILPGQTAVTLFPVYHVGKLLDALTETEAGVVSLNL"
     misc_feature    127710..128762
                     /locus_tag="BWV06_gp089"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            128786..129175
                     /locus_tag="BWV06_gp090"
                     /db_xref="GeneID:30855102"
     CDS             128786..129175
                     /locus_tag="BWV06_gp090"
                     /note="similar to HCMV UL96"
                     /codon_start=1
                     /product="Cy131"
                     /protein_id="YP_009337535.1"
                     /db_xref="GeneID:30855102"
                     /translation="MTSANKNLLKEAMRLSLEKQQNQFLRRVYGPRHRVTSHHSLQLM
                     RVAAREQTRYSQAVVGQVTENVVRDREDLKRELQRARVLQKAADVDNALDSLIELKDT
                     VEDVRDSFVDSVASTCEVDLLEGDDTE"
     misc_feature    128822..129091
                     /locus_tag="BWV06_gp090"
                     /note="Protein of unknown function (DUF2664); Region:
                     DUF2664; pfam10867"
                     /db_xref="CDD:287800"
     gene            129232..131058
                     /locus_tag="BWV06_gp091"
                     /db_xref="GeneID:30855103"
     CDS             129232..131058
                     /locus_tag="BWV06_gp091"
                     /note="similar to HCMV UL97"
                     /codon_start=1
                     /product="Cy132"
                     /protein_id="YP_009337536.1"
                     /db_xref="GeneID:30855103"
                     /translation="MSTRSKAKSRPRSASAESGRPWQPAPLRRSKTSQRRAWMRQAAM
                     AAAVRESQAAAAAASAASSTRNVTTVRKSTTPPSPAAMLPPQSSLSRGRTTSRQSSID
                     APVLYVADPQLQCCEDSHWSFEYDEEAPTQNTEIIQPRAPLRSITPSVHGNDDCDAAS
                     SQASQVSVDEEHEDVHCTCSNEHVIATSIKGLVCDASLFSRMTQPELCEMAVTYLLVY
                     VPKDENFCKRVCYSVDVTDASRRIGCGSFGEIWPIDRRRVVKIARKHTETILSAYMSG
                     LIRTKAGPEAEEMPGVYHGLLTATGCCLMHNLTVYQRFHSDLFHFENWDLTSVPSYRR
                     AFHHLANAIKFLNHTCKVCHFDISPMNVLINVNPHYHSEILHVVLCDYSLSEPYPVCN
                     DRCVVVFQETGTARRIPNCTHRLRECYHPAFRPLPLQKLMICNPHARFPVSNSPRRFC
                     MIELAALGNVLAFCLVRLLDRRGIEAVHNGPESLLFKHAATACHALENNRLTACSDAC
                     LLIMAAQLSYHAGLLGDDGLAVVSQTVSFVEAKMSSCRVRAFRRYYHECLGALPFDYV
                     RKNLERLLAMVDGVYLYNSFRLAANISTEEDLDGDCRQLFSD"
     misc_feature    129955..>130461
                     /locus_tag="BWV06_gp091"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:328722"
     misc_feature    order(129955..129966,129973..129975,129979..129981,
                     130003..130005,130009..130011,130162..130173,
                     130297..130299,130309..130314,130318..130320,
                     130369..130374)
                     /locus_tag="BWV06_gp091"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    130312..130860
                     /locus_tag="BWV06_gp091"
                     /note="Region: UL97; pfam06734"
                     /db_xref="CDD:284210"
     gene            131109..132779
                     /locus_tag="BWV06_gp092"
                     /db_xref="GeneID:30855104"
     CDS             131109..132779
                     /locus_tag="BWV06_gp092"
                     /note="similar to HCMV UL98"
                     /codon_start=1
                     /product="Cy134"
                     /protein_id="YP_009337537.1"
                     /db_xref="GeneID:30855104"
                     /translation="MWDETGDENEDLVRLLSLRDDEPLSMFIMNTFLLKQESFRNLSF
                     SILRLAYAYRLFTKAARTYGLAVAEEFVSAVAALAQDELLRDILTNRYVESREEIHRS
                     LQRVAQCQEREELVDEVSDDYVWLSKLLDLAPNYRQLELYQILERESRGQSRNMVWHL
                     LRLDSVSATKFYEAFVFGCMPNALAQRSRAGASPGIQFGLQHEGVVKTLVEFHVMHGR
                     EPVRDGLGLLIDPTSGLIGASIDLCFGVCKSDSGDARTSLHISPCASVYEIKCRYKYL
                     RKKTDPFVQNVLQHADPASVAKFLLSHPIPGVEFRHDADIPSGREFLLSYDPLFKATL
                     KRGRPIKPPEALRDYIHDLLYLNKTERSEVIVFDAKNLDETINAPHSPAGPVADDAVE
                     TEGGSQRSFHDEDTPDLLGQLTLYEVSRFSLPVFVNPRHQYYFQLLIQQYVLSQYYIK
                     KHPDPERIDFRDLPNAHLVSAIFRERDESEVGRPLYLGGRVFSCDHIPLLIIVTPVVL
                     DPKFTRHVVSTVVDRWSRDLSRKTNLPVWVANAANEYVVSSVPRPASP"
     misc_feature    131166..132734
                     /locus_tag="BWV06_gp092"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     cl09232"
                     /db_xref="CDD:324346"
     gene            132716..133168
                     /locus_tag="BWV06_gp093"
                     /db_xref="GeneID:30855105"
     CDS             132716..133168
                     /locus_tag="BWV06_gp093"
                     /note="similar to HCMV UL99"
                     /codon_start=1
                     /product="Cy137"
                     /protein_id="YP_009337538.1"
                     /db_xref="GeneID:30855105"
                     /translation="MGGQCCKRICCFFGASSGKPLRDTMGRPVCLRSFADIDNTSSED
                     EADLLSINSDRLSLTSQDSMAPAPKPKKKKKTKTQSAQHTTQKAQLTLALMEDEDGYH
                     SPTRVTRTYNRPSPPTKAKTPRAEKIAARPPTPKNQRRSSSRSYESVY"
     gene            complement(133338..134408)
                     /locus_tag="BWV06_gp094"
                     /db_xref="GeneID:30855106"
     CDS             complement(133338..134408)
                     /locus_tag="BWV06_gp094"
                     /note="similar to HCMV UL100"
                     /codon_start=1
                     /product="Cy138"
                     /protein_id="YP_009337539.1"
                     /db_xref="GeneID:30855106"
                     /translation="MATSKVDWMNSRIWGVSVLMVVFTFINLDGHVVMMNIPGVGYPC
                     AYFNVVDYSEMNMSNYNVMHLTTPMLFLDTVQIIMYVAFTMIVFLCVVIYYICCWMKI
                     SYRKEEGLNLNQRTRDIAYMGDSLSTFIFILVMDTFELFTLAMSFRLPSVIAFMACLH
                     FFCITIYNVNLVTNYQNFKQNLFSLQRIHPKLKGTIQYRTLIVNLVQMLLGFNIAVIS
                     MSLCLGFGNNFFVQTGHMVMAVFFVFAFISIIYFLLLEVVFYRYVKVQFGFHVGTFCG
                     LCGLIYPIIKYELAYTPEYTSSVAVAFAINFLIWAGFTACRCTRYFRNHHSVKYKHLP
                     ATDELASLKEASMATSDVEEMA"
     misc_feature    complement(133386..134408)
                     /locus_tag="BWV06_gp094"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     cl28128"
                     /db_xref="CDD:332949"
     gene            134597..136774
                     /locus_tag="BWV06_gp095"
                     /db_xref="GeneID:30855107"
     CDS             134597..136774
                     /locus_tag="BWV06_gp095"
                     /note="similar to HCMV UL102"
                     /codon_start=1
                     /product="Cy139"
                     /protein_id="YP_009337540.1"
                     /db_xref="GeneID:30855107"
                     /translation="MSAGTTFTGVSCHLSWYGIIEDAVPVVQCLFIHIGRNNSEPKLQ
                     TFIVRADPLPAADLRVVHRGGYANLAATADGEERQQSLDRRSSVLARVLLEGSALIRV
                     LAHPFSPVQIRTDQHELEILEAAPALDIEAAAVSNALSLFHVAKMVIIGSYPDLTEPR
                     SVTVGEERVSEEYGTHANKKMRRGYYAFDVAMSFRIGAHKYVLERDDEALVSRLFEIR
                     EVSFLRTCLRIVTPIGFIAVAVTDEQCCLLLKSAWTRLYEVLFRGFAGQAPLCDYLGP
                     DLFEAGGSRSFFFPGFPPVPVYPVNGLGCLLRETALDAAGEVISWCGLPDIVGSVGKL
                     EVQPSTLSLGVPEDEWRVFGGEDTDPLRINGTAFRQASETLFSHLCTRAGEGEFLSAN
                     VHAKDSTLHRLVIVNLVESVVAKCILARDFNTALRFNNRLHTKNVCKQFIDNLRYRSG
                     RAFWQIQSLLGYISQHVTSACTSAGLLWVLSRGFCEFYVYDGTMPHGPVSAETCVRTV
                     VECYWRKLFGDVPGPVCRLQASAPGIILLWGGMRLVSPFGVDEHDDWWSVVGQVLGRL
                     PTLFRKRPTAQELESVYREVLFRFVSRRNDVDFWLLRCDPGEHEVRPHVGVIDCAPFY
                     GVWSEQSEIIVQSRDSALAAEIGYTVYLKRAFVMLTACMEAMSVCNVALVVPATNSSS
                     SSSAVWPGPLEEREEWLRALSGEARQAAERVITEGSRFFRLNV"
     misc_feature    135236..135454
                     /locus_tag="BWV06_gp095"
                     /note="Herpesvirus DNA helicase/primase complex associated
                     protein; Region: Herpes_HEPA; cl28051"
                     /db_xref="CDD:332872"
     gene            complement(136796..137551)
                     /locus_tag="BWV06_gp096"
                     /db_xref="GeneID:30855108"
     CDS             complement(136796..137551)
                     /locus_tag="BWV06_gp096"
                     /note="similar to HCMV UL103"
                     /codon_start=1
                     /product="Cy140"
                     /protein_id="YP_009337541.1"
                     /db_xref="GeneID:30855108"
                     /translation="MQAAPSDPPGMDILMVRGVLEVHTDETSHNVIVTTPQIVDITVS
                     NDRLWVHTDHGMLCSISEYRGEMSLKSSFVGYSTIFLLENEDAIKTVKLTSMRLKHRC
                     GIVRTSNLMHFTLCTILSCVENLTLTRKCLLDLLGYLKVVNIRDQFGTLLRISCQKLI
                     CSTLYLFFDDKTPEIVQQVPKVFILFYESRQSFLHTILRFWFRITRQDESYKVTMKLM
                     ERQTLNGKLVEVALIEVLNSNFPSLPLCDPNML"
     misc_feature    complement(136829..137500)
                     /locus_tag="BWV06_gp096"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7; cl28121"
                     /db_xref="CDD:332942"
     gene            complement(137478..139448)
                     /locus_tag="BWV06_gp097"
                     /db_xref="GeneID:30855109"
     CDS             complement(137478..139448)
                     /locus_tag="BWV06_gp097"
                     /note="similar to HCMV UL104"
                     /codon_start=1
                     /product="Cy141"
                     /protein_id="YP_009337542.1"
                     /db_xref="GeneID:30855109"
                     /translation="MDLNHWYEKSSGSKRTSERDLTLSTIRSILAADERLRIKASSYL
                     TGRDDDTVIDIFPTAQTLSYIRLLHGFIGTCRGKSIHQVLRDPCVLRKQLLYGLCKTI
                     FDTITVRQVADEWKIHSTLFPYQALDDEDLENYLLVWSASVRQSVQTGVLGTLRDILY
                     QFADNDDYGLYVDWYVTVGIIPLMDVKSKPAEIAQRAAFIRAAIHKSTETHPLAQDLL
                     NSNLHLLQQVVTHLCGVRIVNSPELRIFKRIKSEKIEAQLKERTINRYIVTEPLAYER
                     NQLFFTTPISHLHEEILRYDSLCRHQKICQLLNTYPVKAVTTSRHEMNCKRIVDMMEK
                     HDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQSRLMPSRTPGGGP
                     STSAPPVTNATQDRDIRDLFKKQMIKCLEEQIQAQVDEIQDLKSLNQAWESRVRELRD
                     LLSRYARQRSAQTFEREPKLHHLSITEAVRKAQEVAFNPLAIEDNRVVANSFFSQFIP
                     NTEKLENLLTELWENEYFRTFRMKRLVTAQGAEEAIVYSNYTVERVVIPYLFSVLSLS
                     TLEPIPEEYLHLSFGEIVAAAYDDSKFRQYVELICNREKARRRQMTRQPVVHRPPSDA
                     ERPSQQQQDAGGPFRPSRHGHLDGARGIGSPY"
     misc_feature    complement(137637..139262)
                     /locus_tag="BWV06_gp097"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            139285..141858
                     /locus_tag="BWV06_gp098"
                     /db_xref="GeneID:30855110"
     CDS             139285..141858
                     /locus_tag="BWV06_gp098"
                     /note="similar to HCMV UL105"
                     /codon_start=1
                     /product="Cy142"
                     /protein_id="YP_009337543.1"
                     /db_xref="GeneID:30855110"
                     /translation="MSMTVSSSRPVKYEDALILNLSSAAKIERIVDKVKSLSDVRFEP
                     EDFSYQWFKSMSRVERSADQDVRVPCTDQWPFFPFRTLLVTGTAGAGKTSSIQVLAAN
                     LNCVITGTTVIAAQNLSAILNRTRSAQVKTIYRVFGFNSKHVPLAEGGNDILKQYRIC
                     ESRDENTIQRLQVNDLLTYWPVIADIMEKYLNMLERKASLEDVSEMCESNVIIIDECG
                     LLLRHMLQVVVFFYYFYNAVCNTTLYRERRVPCIICVGSPTQTEALESRYDHITQNKN
                     IRKGIDVLSALIQNKVLMDYCDIANNWVMFINNKRCTDLDFSDLLKYMEFGIPLTEEH
                     ITYVDRFVKPPSSIRNPSYASDMTRLFLSHVEVQAYFKRLHEQIRQSERHRLFDLPVY
                     CVVNNRAYQELCDLSDPLSGSPQPVDIWFRQNLTRIINYSQFVDHNLSNEILKETLRA
                     EDTEEALETLLTLRITYIQGSSVGVNSKVRACVVGYHGTFERFVEILQKDTFIERTPC
                     EQAGYAYSLVSGLLFSAMYLFYSSPYTNEEVLRELGRIDLPVISSLCVDEKGVSEAGV
                     SSGTHTQTRVAVSGGDDDEAMVLGIDEDTYDIPCMNEEVSDSDLLAQTSLYEDPFFGK
                     YVKPPSISLLSFEETVQIYTTFRDIFLKRYHILQRATGGRFAALPMVTYNRRNVVVKS
                     NCQIVSQTGSFVGMLSHVSPAQTYTLEGYTTDNILSLPGGHRIHQEVAQRGLSRLVLK
                     DALGFLFVLDVNVSRFVESTQGKSLHVCTTVDYGITSRTAMTIAKSQGLSLEKVAVDF
                     GDHPKNLKMSHIYVAMSRVTDPEYLVMNVNPLRLPYEKNTTITPYICRALKDRRTMLI
                     F"
     misc_feature    139288..141855
                     /locus_tag="BWV06_gp098"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     gene            145152..146327
                     /locus_tag="BWV06_gp099"
                     /db_xref="GeneID:30855111"
     CDS             join(145152..145340,145435..145656,146094..146156,
                     146241..146327)
                     /locus_tag="BWV06_gp099"
                     /note="similar to HCMV UL111A"
                     /codon_start=1
                     /product="Cy143"
                     /protein_id="YP_009337544.1"
                     /db_xref="GeneID:30855111"
                     /translation="MRRRRSFGIVVAGAIGTLLMMAVVVFSAHEHKEVPPACDPVHGN
                     LAGIFKELRATYASIREGLQKKDTVYYTSLFNDRVLQEMLSPMGCRVTNELMEHYLDG
                     VLPRALHLDYDNSTLNGLHAFASSMQALYQHMLKCPALACTGKTPAWMYFLEVEHKLN
                     PWRGTAKAAAEADLLLNYLETFLLQF"
     misc_feature    join(145281..145340,145435..145656,146094..146156,
                     146241..146315)
                     /locus_tag="BWV06_gp099"
                     /note="Interleukin 10; Region: IL10; cl02501"
                     /db_xref="CDD:295330"
     gene            146570..148350
                     /locus_tag="BWV06_gp100"
                     /db_xref="GeneID:30855112"
     CDS             join(146570..147269,147395..148350)
                     /locus_tag="BWV06_gp100"
                     /note="similar to HCMV UL112/UL113"
                     /codon_start=1
                     /product="Cy144/Cy145"
                     /protein_id="YP_009337545.1"
                     /db_xref="GeneID:30855112"
                     /translation="MEETTSTRTYWTFRGVSRVLHQSVNTGFDVRQSSFESATLVRCL
                     DGEGTTTTLGKGWLCCTVVQNGDSNAPKGQPQPGFMSLDVTVEDHLDNLFVRGTVVNN
                     KNVSSVVGQGKSGDSSLLTVISEGDTLQVTFIRHHTKFSDSIAQASSSGASLSSGIPS
                     SSSSVSASVPSAAALEERRARAERHERKKHQHQQQQQQQANSMQDGSGQIRVSGGDRD
                     PRVLNRPKDRRSETDGSPLDKRPKTHHEPKTAAEHTPRHMPMDHNPASDPVAFLNYSS
                     HAPLTDHPGSDGALLQNETAGFGDAEERPEELGSRAPSPARGNSGTEAGADAGVRAST
                     SATDDGGDDEHVTPSTSSGLSNRHLPPPNSQASSAPLSPHPRSPHFEDIIQSLTRLIN
                     ECGKGDRGDTPAPSRRTPECGDSHASPAATSTASTAAAATAVPVSEAPRPVCEIRPYM
                     VNPAAAPQPPPEPQQPATNRRTRGGARPRNGSRGGGGGRRGASTSGRRRRRNQDDDSE
                     DEILPGPSRRRTVPPSFAEDGLEIIDAAEEAAIAAASIASFFD"
     misc_feature    146591..>146995
                     /locus_tag="BWV06_gp100"
                     /note="HSV U79 / HCMV P34; Region: U79_P34; pfam03064"
                     /db_xref="CDD:281109"
     gene            complement(148465..149208)
                     /locus_tag="BWV06_gp101"
                     /db_xref="GeneID:30855113"
     CDS             complement(148465..149208)
                     /locus_tag="BWV06_gp101"
                     /note="similar to HCMV UL114"
                     /codon_start=1
                     /product="Cy146"
                     /protein_id="YP_009337546.1"
                     /db_xref="GeneID:30855113"
                     /translation="MALKQWMLENIPDNKACMLNHDEQTRLLSVSKEWLVFLNIPSHD
                     LDLLRETVDAVARARQSDTVYPPPEHVHRWSYLCAPDNVYVVIVGQDPYCDGSASGVA
                     FGTLPGQVAPPSLQNVYRELCRTVAGFQRPIGGCIDDWCRRGVLLLNTVFTVVRGQPG
                     SHRHLGWQVLSERVISRLSECREHLVFMLWGAEAQTLECLINKSRHLILKAWHPSPKN
                     TKSFLGNEHFVLANEYLRKHHDKTIDWRL"
     misc_feature    complement(148468..149208)
                     /locus_tag="BWV06_gp101"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03200"
                     /db_xref="CDD:165467"
     misc_feature    complement(order(148570..148572,148762..148764,
                     148867..148869,148900..148905,148930..148944))
                     /locus_tag="BWV06_gp101"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(148558..148566,148570..148575,
                     148633..148638,148867..148875,148930..148932,
                     148936..148941))
                     /locus_tag="BWV06_gp101"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(148558..148566,148570..148572,
                     148633..148638,148732..148737,148867..148875,
                     148927..148929,148930..148932,148939..148941))
                     /locus_tag="BWV06_gp101"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(148570..148572,148936..148938))
                     /locus_tag="BWV06_gp101"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(149171..149947)
                     /locus_tag="BWV06_gp102"
                     /db_xref="GeneID:30855114"
     CDS             complement(149171..149947)
                     /locus_tag="BWV06_gp102"
                     /note="similar to HCMV UL115"
                     /codon_start=1
                     /product="Cy147"
                     /protein_id="YP_009337547.1"
                     /db_xref="GeneID:30855114"
                     /translation="MWRLLVSAAVLVTLVVAETLPQNLTCLELTRRCFTGETFSPEDD
                     SWAKPLIKVSHPDGNLSQLLRYTPLTKHAASTIPLDDTFMDFVALLHNNPAQLRTLLT
                     LLKSDGAPTWMKIMQGYSECGDTGSIYTCVDNVCRAYDLRYLTYSSSIFTENVLGFDF
                     GHKGQFAALVVVRHEDIKMHRPVRIPVATRADRNGLQLFYALYNLVRELLVRHDLDTA
                     LIDRLDKYYLDIPDDWKQPLTNNPALLHNGLKAVDVGKHS"
     misc_feature    complement(149207..149947)
                     /locus_tag="BWV06_gp102"
                     /note="envelope glycoprotein L; Provisional; Region:
                     PHA03302"
                     /db_xref="CDD:223038"
     gene            complement(149958..151037)
                     /locus_tag="BWV06_gp103"
                     /db_xref="GeneID:30855115"
     CDS             complement(149958..151037)
                     /locus_tag="BWV06_gp103"
                     /note="similar to HCMV UL116"
                     /codon_start=1
                     /product="Cy148"
                     /protein_id="YP_009337548.1"
                     /db_xref="GeneID:30855115"
                     /translation="MRWVAMRWLLLIVATSAKASSTTAGNTSTPTASTITSTVTTAST
                     TNMSTPSPASSPATTNTTTSSPSTKSSTSSTNTTITTTGTASATTPKSSTSVTSSPAN
                     STSTSTKPSTTNTSSPITTSSPASNTSTTTSSTSTVNGTNSTTETNTTSLPDTTADMN
                     VTTTEPYNSTGYENVTINITTPSPYEALQIVDLCNETISIVFKDPGEEDESSETTEYS
                     DEEPVASSNEDDSTYFPQSPGYTLTYDTEDTIYFQATCDRNDTYNITSCDYTNKSVNS
                     WSTVTSVSFFPPTLTPCHKPVAIIKIGNDSLVVSASATSNLVDAIYKLLGLPDVNSDF
                     INQLGRYHPITLQGQIEYRDWYTTE"
     gene            complement(151019..152167)
                     /locus_tag="BWV06_gp104"
                     /db_xref="GeneID:30855116"
     CDS             complement(151019..152167)
                     /locus_tag="BWV06_gp104"
                     /note="similar to HCMV UL117"
                     /codon_start=1
                     /product="Cy150"
                     /protein_id="YP_009337549.1"
                     /db_xref="GeneID:30855116"
                     /translation="MFSNINIVYTSQRVSKSLAPANKRKTHRTIVVVPQQRFLRIPPD
                     NQDVNHVRIIHPPPSYDARQPPTPPKLTKSLYPYGTSLIRRYARDVKQRKRLIVFNTT
                     SPAAEDSHASSGSGKKMDQDVIDDFLADTFQRDVSVANNSSNDDMYIDDLSLSLSPSS
                     SPEPSPSTSTASSETTSIPTIDLMNHRVLLETDRETTDLNTTPYLLPNDYRFAPSCVI
                     KYRYIFEELSRVSRVYDSTAIQIQVSAACGNAFQNLKTTLLKLHNITVLSGSQIITQT
                     VPHTPQAVAAFKYCHNSSDNVLDTVRSVIPRAVSYHETGVHQLYVSGATKKDLINAAT
                     LCAAVAEKQPDIFNINICALSYPSIAAPHLPLYNYFTEFQPQACDGWQ"
     misc_feature    complement(151055..151513)
                     /locus_tag="BWV06_gp104"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(152194..153554)
                     /locus_tag="BWV06_gp105"
                     /db_xref="GeneID:30855117"
     CDS             complement(join(152194..152801,152888..153554))
                     /locus_tag="BWV06_gp105"
                     /note="similar to HCMV UL119/UL118"
                     /codon_start=1
                     /product="Cy152/Cy151"
                     /protein_id="YP_009337550.1"
                     /db_xref="GeneID:30855117"
                     /translation="MLGTGHVLALVAAVLIAQQAIGGTSTTSTVSTTSSPTTVKSTST
                     VTSSATSVTTSLTSSSAATSSVTSSNAASSSTSGTATSTATSTQKTSTSNSSTGTDTQ
                     TTSSNTTTAPATTESATTSSNASENSTTENSTDTTTVDTTSDTSTTATSTTTKKPQVP
                     DIYVTCESAYSYNYLVLQTTCQIHNMSHAQNVSRDLISIECFEQVGCDGNLTSIGSVT
                     TSNTSKGMFYNISTQSFTMYTQAPNVTTQYTCKFIATGQTLNTSWEFLVMPIKAVFAS
                     PSNDTMTQLRVLVTNHPCTNETVYSSSKAFVYFGNTNHSSHKVQNITRHNQSLWEYIF
                     HFTTHDLPNTAHMRILLGDRYSVSTHVFIRRDPDEWPIIGTLGYIVLAFLLFMLFALL
                     YITYVLMRQRNPWAYRRLDEEKPYPVPYFKQW"
     gene            complement(153603..154199)
                     /locus_tag="BWV06_gp106"
                     /db_xref="GeneID:30855118"
     CDS             complement(153603..154199)
                     /locus_tag="BWV06_gp106"
                     /note="similar to HCMV UL120"
                     /codon_start=1
                     /product="Cy154"
                     /protein_id="YP_009337551.1"
                     /db_xref="GeneID:30855118"
                     /translation="MLRFYHAVYLGIVCMVIIMTVVYSLPFYAGDPLAPHVKVAYIYY
                     NASNLTIYCNTSGRHSRFLAGGIMITTKYNTTFLKGGYHGYDRHPRPLYLKFVKVLDT
                     APYGFYLNSTVTCWGSNGTYGVRSFMVTKITNTSDKDAIVLVNDTDLVETPDAALNWW
                     PRSQQNRIVMIVLLAQLVFVVFIINACLIWSCKFKRHN"
     gene            complement(154201..154749)
                     /locus_tag="BWV06_gp107"
                     /db_xref="GeneID:30855119"
     CDS             complement(154201..154749)
                     /locus_tag="BWV06_gp107"
                     /note="similar to HCMV UL121"
                     /codon_start=1
                     /product="Cy155"
                     /protein_id="YP_009337552.1"
                     /db_xref="GeneID:30855119"
                     /translation="MMLGLAIVLLTSVVVSVCGVQTPDMCWDRNHIKVKCLLRQLDSR
                     LYWFMNDTKRVWAFDYASQTPLSIPYRVEVRGSLWSSESAVILRMPPYPMTTVGLLLK
                     IDEDREGVLCVGVVPKKRYLNPCGWDSDLSLWYCVCVLLTVGVMIAGILKLDYDTTRH
                     LTDYKSWLSRRTRYFGPDVKRW"
     misc_feature    complement(154276..154656)
                     /locus_tag="BWV06_gp107"
                     /note="Protein of unknown function (DUF2677); Region:
                     DUF2677; pfam10838"
                     /db_xref="CDD:313926"
     gene            complement(155015..158848)
                     /locus_tag="BWV06_gp108"
                     /db_xref="GeneID:30855120"
     CDS             complement(join(155015..156579,158446..158630,
                     158733..158848))
                     /locus_tag="BWV06_gp108"
                     /note="similar to HCMV UL122; IE2"
                     /codon_start=1
                     /product="Cy156"
                     /protein_id="YP_009337553.1"
                     /db_xref="GeneID:30855120"
                     /translation="MESRKRKPEDETHTEETGDPEEGTSGGPSTGPSPPKHPKKDMAL
                     QEAVNLLEKMLADEEKRLTQINLGDPLFEVTGDDTIKTLEEIIQEGDDVVGAHQLVGP
                     PPPTPLDILAQAVSQAGIDSSSAGMTAPTPSSMITTTAPTIGPTTTAIKVPGMEITTS
                     LQGTPKPKSKPKPKIPAPPSAAVAAPAPSSSTTTSSSTSSTKPAVCKPTDSMSQRKKS
                     RKTQHPMKVIIKPPSPPTCMLKPSEIKQEGESFIRYKGQDIQPTSGCIVISDSEEEED
                     TVPEVSARATSEQQGVQLKITTKMSGASGQIPMDSSSSSSSDSECCDECAGDHFSSAS
                     TITSPVSPIHTPPPAPMMPSTSKGKTPKAPRTKSTKRLTPLDCERVRSAMREKAGTVF
                     KNPTVETKRGRVRADEVSRMFRETTRSLEYKNLPFLSTNVHQLMAEAVNACKSMQVNH
                     RGIIVTYTRTHEVKEAVDVTRVKLGKVPNLSISTPFLVEHTMPNVYPAEVVRKTAEAC
                     ASGIKQAWDLKAVQPHDMCPRSSDYRNMIIHAATPVDFLGSLQILVPLVQRFPKQVAI
                     RIFTNENSNSFMLPIYDQAAKMYAVGQFEETKDEDLANLNMAIEKAIEDMNQESQ"
     misc_feature    complement(join(<158471..158630,158733..158818))
                     /locus_tag="BWV06_gp108"
                     /note="Cytomegalovirus IE1 protein; Region: Herpes_IE1;
                     pfam07340"
                     /db_xref="CDD:284701"
     misc_feature    complement(155120..155605)
                     /locus_tag="BWV06_gp108"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(157003..158848)
                     /locus_tag="BWV06_gp109"
                     /db_xref="GeneID:30855121"
     CDS             complement(join(157003..158357,158446..158630,
                     158733..158848))
                     /locus_tag="BWV06_gp109"
                     /note="similar to HCMV UL123; IE1"
                     /codon_start=1
                     /product="Cy156"
                     /protein_id="YP_009337554.1"
                     /db_xref="GeneID:30855121"
                     /translation="MESRKRKPEDETHTEETGDPEEGTSGGPSTGPSPPKHPKKDMAL
                     QEAVNLLEKMLADEEKRLTQINLGDPLFEVTGDDTIKTLEEIIQEGDDVVGAHQLVVK
                     QVKLRVQRNRRLADDIIKEQLTDTRKVFSDKIDKLEQGIQNSYLLLEKLKIPFKNMRC
                     LLEVANEQFNDTPVPPQYKDKFMVCLKKIVEYAVNSSSNLEKFIMSKIKTKRGDIKDR
                     VAYTCMKYTIMAMQGTGGPKAINNEEHAKLFLKQLSNYDDLKDANQAGVELIKQLDKE
                     QKEVAFHVSSFDHLITTLGMALYKEGYHKNDEAMLGMHTPITMLSDQVRVLILYLIDE
                     IIHAIHTNSNQSNDELIDGLKPKTRIVINEFHATLMMGTEKMKFYSLNELREIVNDKL
                     NEDKFPVVSGLLPENVPGADIPLASVIIHSDTEDEEEQESETDEEQESEADEEEQETE
                     TGDEGAETQAEGTDETDIEGTESETQIGSEAQPEAAESETQVEQTEGETEVETPQETE
                     EGEESEVEMTVIKYAKPHVKEEEGAGSSSKSLHPMQTRSKTDK"
     misc_feature    complement(join(157474..158357,158446..158630,
                     158733..158818))
                     /locus_tag="BWV06_gp109"
                     /note="Cytomegalovirus IE1 protein; Region: Herpes_IE1;
                     pfam07340"
                     /db_xref="CDD:284701"
     gene            158847..159302
                     /locus_tag="BWV06_gp110"
                     /db_xref="GeneID:30855122"
     CDS             158847..159302
                     /locus_tag="BWV06_gp110"
                     /note="similar to HCMV UL124"
                     /codon_start=1
                     /product="Cy156.2"
                     /protein_id="YP_009337555.1"
                     /db_xref="GeneID:30855122"
                     /translation="MVTGGYWNMRERLSIYCICLYLVAQATFILSSSASPTGTSLSTT
                     KGSGTEPLTSSATKLITAQPGSAVAAVVLAAQYKAESGSSLSSSSVILPTVLAASGMV
                     VLVILLIGLNLSSTFWSPQVDEENELEEGPSRLHTDTTFISASTVDLCA"
     gene            complement(161918..162822)
                     /locus_tag="BWV06_gp111"
                     /db_xref="GeneID:30855123"
     CDS             complement(join(161918..162371,162458..162595,
                     162683..162822))
                     /locus_tag="BWV06_gp111"
                     /note="similar to HCMV UL128"
                     /codon_start=1
                     /product="Cy157.5"
                     /protein_id="YP_009337556.1"
                     /db_xref="GeneID:30855123"
                     /translation="MFICYIVCILLLLPTNLLAKSCCSLININYTPQDCYDFKICNNR
                     TVSLTCRIGQICYPPNSTTHMQQSVIMSLTNNLTRHRLYTNKPSCNHSPVYVHSDGSL
                     RCANVHNSTEHVLGLARKIDYTWIDNTRLRRPFMDFNWFLKKLLEYGKNDTYHNGFLR
                     TVIAVNGTHSPYDDVSNTTQLPQVNVTGATSASYTMPPTPVAATIDSDSYPYEEDIDG
                     LLGTIHMVEYRNHTRKLIVCGPYIG"
     gene            complement(162824..163933)
                     /locus_tag="BWV06_gp112"
                     /db_xref="GeneID:30855124"
     CDS             complement(join(162824..163556,163644..163933))
                     /locus_tag="BWV06_gp112"
                     /note="similar to HCMV UL130"
                     /codon_start=1
                     /product="Cy157.4"
                     /protein_id="YP_009337557.1"
                     /db_xref="GeneID:30855124"
                     /translation="MKNYKQQLYTFVLLMLLRYGFNDTSINDTSIKNLKLGNFCPMYP
                     SPRQNFALFTSYTTHQTGPECGNTSLYIFHNKYNQYLIERPSAWSNRLAFYLSAQHSS
                     VFQKISKMATSPATSMNITEEEKKTFAAHMIPMRSTTLRYIVKDGVEVEHCQMRVITW
                     AKTEANFISFKVKIELSNAYRRPSSICTRPNILVPEPDKISPTVKTPTVTTPKRTARS
                     TVKATPKPATAKPAPAKPAPAKPAPVKPATAPKPVAAKPAAAKSAAKPVAAKPVAAKP
                     ASAAKSQNSAPKGQRSQPSQKPKPKPKTPVPIRYKQYFQSNGKRRYPLASRYSSAWLF
                     RHHPPG"
     misc_feature    complement(join(163265..163556,163644..163819))
                     /locus_tag="BWV06_gp112"
                     /note="HCMV glycoprotein pUL130; Region: Gp_UL130;
                     pfam11668"
                     /db_xref="CDD:288512"
     gene            complement(163930..164530)
                     /locus_tag="BWV06_gp113"
                     /db_xref="GeneID:30855125"
     CDS             complement(join(163930..164194,164277..164530))
                     /locus_tag="BWV06_gp113"
                     /note="similar to HCMV UL131A"
                     /codon_start=1
                     /product="Cy157.6"
                     /protein_id="YP_009337558.1"
                     /db_xref="GeneID:30855125"
                     /translation="MGACRVFITVTVCVLFCAFTVQGSICTKEFGNWNPNYRPDGYWD
                     ICSRQIDATLRNQLLEKIINASVSYHYATSHNHDDVSLLKRINVTEVALVVNSVQVRP
                     GEIDECLYRQQPEEEIKNKNTRQPQLTRRIGLIKDYISAKKLITFAASGSHTSQSRIL
                     TIAIRLPLIIKR"
     gene            complement(164574..165230)
                     /locus_tag="BWV06_gp114"
                     /db_xref="GeneID:30855126"
     CDS             complement(164574..165230)
                     /locus_tag="BWV06_gp114"
                     /note="similar to HCMV UL132"
                     /codon_start=1
                     /product="Cy160"
                     /protein_id="YP_009337559.1"
                     /db_xref="GeneID:30855126"
                     /translation="MTANTTTANSTATVTTTAATTSNTTSVSTNVTTVLTATTTAEPG
                     SVLTELLGIIIYCASTVALLCLLLVLVAALYSTCHTRNKVKTKYSEQEAAKLIKSSRR
                     SSPSSKKSRPNKGDYQQLWQSQSETDSTSDDEADNNVLYFDKKGNLTSFVNPQYGHRS
                     SMMIESQADDDENIHYYMSIYDELAAEAMADPSESWEMPKVLQVSTREVTLKEPEYDN
                     "
     misc_feature    complement(164583..165092)
                     /locus_tag="BWV06_gp114"
                     /note="Glycoprotein UL132; Region: gpUL132; pfam11359"
                     /db_xref="CDD:288251"
     gene            complement(165305..166285)
                     /locus_tag="BWV06_gp115"
                     /db_xref="GeneID:30855127"
     CDS             complement(165305..166285)
                     /locus_tag="BWV06_gp115"
                     /note="similar to HCMV UL148"
                     /codon_start=1
                     /product="Cy159"
                     /protein_id="YP_009337560.1"
                     /db_xref="GeneID:30855127"
                     /translation="MAYNSIFLGCLIIALLLHSLPTSTIAKDMAGHVHVHMLNAPEDA
                     ASTSGPVIQLANGFITCRKFTELGWALCTSWDDMECFPFWRRTFSETKNLTVMSDDPY
                     YAGVVLTVRTLIGESLELTSYLGVRHSIANVGYYVMYLSYAKVLPAKFTHKDVDYVRF
                     AIYLHTEIDAQQTPDNDFIFTFATPGTFETTDLMSSFVIGTDDGQNGTLNFTTLGGGK
                     HRYNNVELSSEMKGNCVHHSAIIRNVASPRSWVSFDFSLYWRRTKIAYSYVQYYFPKP
                     LHSPEPKGPAWQTIYHCFSLLTQIRYETVAITVVLIFLIGALLKRNRDSH"
     gene            complement(166490..166924)
                     /locus_tag="BWV06_gp116"
                     /db_xref="GeneID:30855128"
     CDS             complement(166490..166924)
                     /locus_tag="BWV06_gp116"
                     /note="similar to HCMV UL147"
                     /codon_start=1
                     /product="Cy158"
                     /protein_id="YP_009337561.1"
                     /db_xref="GeneID:30855128"
                     /translation="MKCFGLQIHSLGIILYILLLKCVIIHSGTKTEFCECANVTLFTS
                     IPNGTLYLQPLPPNENCTKQEVIAVLPNNTRTCLNPHALAVRVFFNRLFLRISKNEEG
                     LYEVVDTQLELPAWNITRKYYKRYLQKKVNSENAKILSRMIL"
     misc_feature    complement(166643..166834)
                     /locus_tag="BWV06_gp116"
                     /note="1 of 4 subgroup designations based on the
                     arrangement of the two N-terminal cysteine residues;
                     includes a number of secreted growth factors and
                     interferons involved in mitogenic, chemotactic, and
                     inflammatory activity; many members contain an RCxC
                     motif...; Region: Chemokine_CXC; cd00273"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166664..166666,166679..166681,
                     166697..166705,166712..166717,166745..166753,
                     166778..166795,166808..166810,166826..166834))
                     /locus_tag="BWV06_gp116"
                     /note="receptor binding site; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(166826..166834)
                     /locus_tag="BWV06_gp116"
                     /note="ELR motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166646..166651,166658..166660,
                     166670..166672,166691..166693,166700..166705,
                     166715..166717,166721..166732,166760..166768,
                     166775..166780,166820..166822,166829..166831))
                     /locus_tag="BWV06_gp116"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166700..166705,166715..166717,
                     166724..166726,166730..166732,166760..166762,
                     166766..166768,166820..166822,166829..166831))
                     /locus_tag="BWV06_gp116"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166817..166819,166823..166828))
                     /locus_tag="BWV06_gp116"
                     /note="RCXC motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166778..166795,166802..166822))
                     /locus_tag="BWV06_gp116"
                     /note="N-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166697..166699,166703..166705,
                     166715..166717,166724..166726,166781..166783,
                     166793..166795,166805..166807,166811..166816))
                     /locus_tag="BWV06_gp116"
                     /note="receptor binding cleft; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166643..166645,166652..166654,
                     166658..166669,166673..166675,166682..166684,
                     166784..166786,166790..166792))
                     /locus_tag="BWV06_gp116"
                     /note="glycosaminoglycan (GAG) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166700..166705,166712..166714,
                     166718..166720,166775..166777,166784..166786))
                     /locus_tag="BWV06_gp116"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(166646..166651,166658..166660,
                     166670..166672,166691..166693,166721..166723,
                     166727..166729,166763..166765,166775..166780))
                     /locus_tag="BWV06_gp116"
                     /note="dimer interface (I form) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(166745..166753)
                     /locus_tag="BWV06_gp116"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(166745..166753)
                     /locus_tag="BWV06_gp116"
                     /note="GPH motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(166706..166714)
                     /locus_tag="BWV06_gp116"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238171"
     gene            complement(167002..167346)
                     /locus_tag="BWV06_gp117"
                     /db_xref="GeneID:30855129"
     CDS             complement(167002..167346)
                     /locus_tag="BWV06_gp117"
                     /note="similar to HCMV UL146 (UL146A)"
                     /codon_start=1
                     /product="Cy158.1"
                     /protein_id="YP_009337562.1"
                     /db_xref="GeneID:30855129"
                     /translation="MNTVRVNIAAMLLICLILSGFSGSQGSELRCSCVKYYYGIPWTA
                     TCVYLKPKSVECNNYELIVYDGSPHKTCVRVRNPSVFDRLDKQTWFTVTKKPNRHISL
                     KPQRTSCAVPKS"
     gene            complement(167423..167786)
                     /locus_tag="BWV06_gp118"
                     /db_xref="GeneID:30855130"
     CDS             complement(join(167423..167519,167596..167786))
                     /locus_tag="BWV06_gp118"
                     /note="similar to HCMV UL146 (UL146B)"
                     /codon_start=1
                     /product="Cy158.2"
                     /protein_id="YP_009337563.1"
                     /db_xref="GeneID:30855130"
                     /translation="MQFNKLACNIFVVTMVFMLILSGTVFANHPRCLCPRTMKGINAT
                     DIQIVRIKLPSSECDKTEIIVQRRNGFEVCLDTTSPLGKKLMEKYLKRYEQ"
     misc_feature    complement(join(167438..167519,167596..167696))
                     /locus_tag="BWV06_gp118"
                     /note="Chemokine: small cytokines, including a number of
                     secreted growth factors and interferons involved in
                     mitogenic, chemotactic, and inflammatory activity;
                     distinguished from other cytokines by their receptors,
                     which are G-protein coupled receptors; divided...; Region:
                     Chemokine; cl00134"
                     /db_xref="CDD:320775"
     misc_feature    complement(order(167441..167470,167649..167666,
                     167676..167690))
                     /locus_tag="BWV06_gp118"
                     /note="putative receptor binding site; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(167652..167666,167676..167684))
                     /locus_tag="BWV06_gp118"
                     /note="N-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(167498..167500,167504..167506,
                     167652..167660))
                     /locus_tag="BWV06_gp118"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(167450..167452,167459..167464,
                     167471..167473,167477..167479,167607..167609,
                     167634..167636))
                     /locus_tag="BWV06_gp118"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(167607..167609,167631..167633))
                     /locus_tag="BWV06_gp118"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(167504..167506,167510..167512))
                     /locus_tag="BWV06_gp118"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238098"
     gene            complement(167909..168235)
                     /locus_tag="BWV06_gp119"
                     /db_xref="GeneID:30855131"
     CDS             complement(167909..168235)
                     /locus_tag="BWV06_gp119"
                     /note="similar to HCMV UL146 (UL146C)"
                     /codon_start=1
                     /product="Cy158.3"
                     /protein_id="YP_009337564.1"
                     /db_xref="GeneID:30855131"
                     /translation="MNCAIFNPRVLGVALLLMTLIAHHQTAASELRCQCLQVTQGIHP
                     KNIQSMTITKPNGGCDRREIIATLKNGQKVCLNPEAPMMKKVLSKFPGGTYSSFWQHF
                     MTLFTD"
     misc_feature    complement(167969..168148)
                     /locus_tag="BWV06_gp119"
                     /note="Chemokine_CXC: 1 of 4 subgroup designations based
                     on the arrangement of the two N-terminal cysteine
                     residues; includes a number of secreted growth factors and
                     interferons involved in mitogenic, chemotactic, and
                     inflammatory activity; many members...; Region:
                     Chemokine_CXC; cd00273"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(167981..167983,167996..167998,
                     168014..168022,168029..168034,168062..168070,
                     168095..168112,168122..168124,168140..168148))
                     /locus_tag="BWV06_gp119"
                     /note="receptor binding site; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(168140..168148)
                     /locus_tag="BWV06_gp119"
                     /note="ELR motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(167975..167977,167987..167989,
                     168008..168010,168017..168022,168032..168034,
                     168038..168049,168077..168085,168092..168097,
                     168134..168136,168143..168145))
                     /locus_tag="BWV06_gp119"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(168017..168022,168032..168034,
                     168041..168043,168047..168049,168077..168079,
                     168083..168085,168134..168136,168143..168145))
                     /locus_tag="BWV06_gp119"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(168131..168133,168137..168142))
                     /locus_tag="BWV06_gp119"
                     /note="RCXC motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(168095..168112,168116..168136))
                     /locus_tag="BWV06_gp119"
                     /note="N-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(168014..168016,168020..168022,
                     168032..168034,168041..168043,168098..168100,
                     168110..168112,168119..168121,168125..168130))
                     /locus_tag="BWV06_gp119"
                     /note="receptor binding cleft; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(167969..167971,167975..167986,
                     167990..167992,167999..168001,168101..168103,
                     168107..168109))
                     /locus_tag="BWV06_gp119"
                     /note="glycosaminoglycan (GAG) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(168017..168022,168029..168031,
                     168035..168037,168092..168094,168101..168103))
                     /locus_tag="BWV06_gp119"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(167975..167977,167987..167989,
                     168008..168010,168038..168040,168044..168046,
                     168080..168082,168092..168097))
                     /locus_tag="BWV06_gp119"
                     /note="dimer interface (I form) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(168062..168070)
                     /locus_tag="BWV06_gp119"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(168062..168070)
                     /locus_tag="BWV06_gp119"
                     /note="GPH motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(168023..168031)
                     /locus_tag="BWV06_gp119"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238171"
     gene            complement(168358..168690)
                     /locus_tag="BWV06_gp120"
                     /db_xref="GeneID:30855132"
     CDS             complement(168358..168690)
                     /locus_tag="BWV06_gp120"
                     /note="similar to HCMV UL146 (UL146E)"
                     /codon_start=1
                     /product="Cy161.1"
                     /protein_id="YP_009337565.1"
                     /db_xref="GeneID:30855132"
                     /translation="MRVCVAYVLLCLSVHGLVAEQRCQCIGKKYNRIPHKTLCLSIEH
                     AGPRCEVTEAIASFNPIHNRPPICLNYENLRNRFPATPGTWCRVGKSLIKVNDKNCEI
                     CNRFVTLE"
     gene            complement(168773..169189)
                     /locus_tag="BWV06_gp121"
                     /db_xref="GeneID:30855133"
     CDS             complement(168773..169189)
                     /locus_tag="BWV06_gp121"
                     /note="similar to HCMV UL146 (UL146G)"
                     /codon_start=1
                     /product="Cy161"
                     /protein_id="YP_009337566.1"
                     /db_xref="GeneID:30855133"
                     /translation="MRSLVLLCVVIMFLCGTVQGTAREKECPCKGKTKLGFIPPKSDC
                     LWLHQYGSPCGNEAIAHFPQTVMNKNGKPRLPLCLDFKIVNSTIPNGNGIYCVKKTVN
                     GTREYVHNCNQCNKFDLHLRMDKIWHANSLWWLDWK"
     gene            complement(169375..169680)
                     /locus_tag="BWV06_gp122"
                     /db_xref="GeneID:30855134"
     CDS             complement(169375..169680)
                     /locus_tag="BWV06_gp122"
                     /note="similar to HCMV UL145"
                     /codon_start=1
                     /product="Cy162"
                     /protein_id="YP_009337567.1"
                     /db_xref="GeneID:30855134"
                     /translation="MVFYQYHNAVQLLSARSRDGPGRWERLTHHASCADDHGACTVLM
                     ATSQKRSLVLRRHSAITAVTLRLIPSKILKKLEESDWIPGAWIASETFPTSDVVSGL"
     gene            complement(170100..170615)
                     /locus_tag="BWV06_gp123"
                     /db_xref="GeneID:30855135"
     CDS             complement(170100..170615)
                     /locus_tag="BWV06_gp123"
                     /note="similar to HCMV UL144"
                     /codon_start=1
                     /product="Cy163"
                     /protein_id="YP_009337568.1"
                     /db_xref="GeneID:30855135"
                     /translation="MLLLSVIWAAVLASRSAAPACKQDEYAVGSECCPKCGKGYRVKT
                     NCSETTGTVCEPCPAGSYNDKRETICTQCDTCNSSSIAVNRCNTTHNVRCRLTNSSTA
                     SAHVDSGQHQQAGNHSVLPEDDAARDWWFLLIFVIFLFSIILLALGCRLILVNTTYGK
                     MLTAYMYEKIA"
     misc_feature    complement(170241..170555)
                     /locus_tag="BWV06_gp123"
                     /note="Tumor necrosis factor receptor superfamily member
                     14 (TNFRSF14), also known as herpes virus entry mediator
                     (HVEM); Region: TNFRSF14; cd10582"
                     /db_xref="CDD:276908"
     misc_feature    complement(170454..170555)
                     /locus_tag="BWV06_gp123"
                     /note="CRD1 [structural motif]; Region: CRD1"
                     /db_xref="CDD:276908"
     misc_feature    complement(order(170421..170423,170448..170450,
                     170454..170468,170472..170477,170487..170489,
                     170496..170498,170505..170507,170511..170516))
                     /locus_tag="BWV06_gp123"
                     /note="polypeptide ligand binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:276908"
     misc_feature    complement(170334..170447)
                     /locus_tag="BWV06_gp123"
                     /note="CRD2 [structural motif]; Region: CRD2"
                     /db_xref="CDD:276908"
     misc_feature    complement(170253..170330)
                     /locus_tag="BWV06_gp123"
                     /note="CRD3 [structural motif]; Region: CRD3"
                     /db_xref="CDD:276908"
     gene            complement(170831..172126)
                     /locus_tag="BWV06_gp124"
                     /db_xref="GeneID:30855136"
     CDS             complement(170831..172126)
                     /locus_tag="BWV06_gp124"
                     /note="similar to HCMV UL141"
                     /codon_start=1
                     /product="Cy164"
                     /protein_id="YP_009337569.1"
                     /db_xref="GeneID:30855136"
                     /translation="MSCTVRFRKGFGRGSEEAETVQLLAEGQEGADSADAESASKRTI
                     HDGALRVKACTPVSAPRAAMWVRRAMVAMTIVMVSLTPRVRGGSIDHTMWDECYEHNS
                     PAPLIMPIGSQVTVPCAFLPHSWPMVSIRARFCQSEYGGYELKINATNGTAVDDDLTH
                     RLINASWKFHDLAISHYVTLTMNISDNTTGMFDCVLRNATHGFLTSRFTIVTQIETLH
                     RPGDPDCAPKLGFHADGKKIWSSEYNEWQRHQCGTFYGFDRLYYYLAANNQSNTKPPC
                     PPSEPDRCWPVLQQYVLDGDCFRSQNFRREPPLPTEKTPVPIFVIDWQWVSLGLTMMV
                     IGGVCLGLVLVVRCACGEMCRNRERFQKKMNAYRPMSTHFMRPPGYDELYSVADDEES
                     DSGYFEKEDRSESYNDLVDENVYDEVAVPPLYSKIKRRL"
     misc_feature    complement(170975..171973)
                     /locus_tag="BWV06_gp124"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            complement(172210..172437)
                     /locus_tag="BWV06_gp125"
                     /db_xref="GeneID:30855137"
     CDS             complement(172210..172437)
                     /locus_tag="BWV06_gp125"
                     /note="old world monkey specific ORF number 11 (O11)"
                     /codon_start=1
                     /product="Cy164.1"
                     /protein_id="YP_009337570.1"
                     /db_xref="GeneID:30855137"
                     /translation="MEIPIVVATILSFLIFMLIIISICCTKPWKRLRYFTLPAIVYRK
                     KQADESSLTWDPTSGDTMMILSSRTAQPISS"
     gene            complement(172620..173066)
                     /locus_tag="BWV06_gp126"
                     /db_xref="GeneID:30855138"
     CDS             complement(172620..173066)
                     /locus_tag="BWV06_gp126"
                     /note="old world monkey specific ORF number 12 (O12)"
                     /codon_start=1
                     /product="Cy165"
                     /protein_id="YP_009337571.1"
                     /db_xref="GeneID:30855138"
                     /translation="MDPIIQAQLLTAIFVVLLIFNVLASIYLCYYPRHACATLQYVFT
                     CSCFLSWYRYGCNCKDFRSLRVLENDEPETALEIIVRTCEEWWYGPKGPPDPVQYYSP
                     PTYESHEQQLHEQQPHELPRVEITSDSSGDRAAETVVDIENHTHMV"
     gene            complement(173113..173640)
                     /locus_tag="BWV06_gp127"
                     /db_xref="GeneID:30855139"
     CDS             complement(173113..173640)
                     /locus_tag="BWV06_gp127"
                     /note="old world monkey specific ORF number 13 (O13)"
                     /codon_start=1
                     /product="Cy166"
                     /protein_id="YP_009337572.1"
                     /db_xref="GeneID:30855139"
                     /translation="MGSDDTELYALLAVIVICTILTILGIVYICYYPREAKAAIMDML
                     TCACVVSCYRYGCDCQKFRTLTSLNSGELFTIGGWITDRFRRWWRGSAPPIDPVQYYS
                     PPREGDNNEGLVPEVQNVQPVDTVVTIEENQPVTRVVSKQPLLTQAAAPQTPVQTHEE
                     VQECLEVAISSATLE"
     gene            complement(173771..174274)
                     /locus_tag="BWV06_gp128"
                     /db_xref="GeneID:30855140"
     CDS             complement(173771..174274)
                     /locus_tag="BWV06_gp128"
                     /note="old world monkey specific ORF number 14 (O14)"
                     /codon_start=1
                     /product="Cy167"
                     /protein_id="YP_009337573.1"
                     /db_xref="GeneID:30855140"
                     /translation="MEMIVVILCAIGVGIMGTGFLILTLVYPLHMMAVCQGVFTCPWL
                     GILLGGCRKSCRSKNSDPDLEVGLLKSYLKGEEIRRQAEGVLMEIDYLKELKTKKPRI
                     SKPPRSRSADGTQEPMSSIQEEQTDALDEDVFEVSSDAAPILGSEAPVAMQTVVSTQP
                     VSDSSQQ"
     gene            complement(174528..175187)
                     /locus_tag="BWV06_gp129"
                     /db_xref="GeneID:30855141"
     CDS             complement(174528..175187)
                     /locus_tag="BWV06_gp129"
                     /note="old world monkey specific ORF number 15 (O15)"
                     /codon_start=1
                     /product="Cy168"
                     /protein_id="YP_009337574.1"
                     /db_xref="GeneID:30855141"
                     /translation="MLTNQEDKIIVGLVLSIAIVAILLFLYLLIFHVRRVGSVCKDIF
                     TCYCFRSLVTRIRGEKFDSEYRNVYLRENLKRFAQDYKRVLIMCPPASGKKIPTNGVS
                     IEMDEAVNTQSEKIVTAALPAIPTSRSLSHADTETERIYKNCEKVNLMMEGEYAVITE
                     VPNNTTPDPPSSSPYATIFATDMMQIPNVTPEMAAVIETAVRSTLQMLMKMQPQVSSE
                     K"
     gene            complement(175290..175853)
                     /locus_tag="BWV06_gp130"
                     /db_xref="GeneID:30855142"
     CDS             complement(175290..175853)
                     /locus_tag="BWV06_gp130"
                     /note="old world monkey specific ORF number 16 (O16)"
                     /codon_start=1
                     /product="Cy169"
                     /protein_id="YP_009337575.1"
                     /db_xref="GeneID:30855142"
                     /translation="MRLLASVRAAFCKLKKCLRGRRGRGHESCPAKPIMVSRAAQTEL
                     TYSTPAARHTHIEVRVDVSRIPSEKAGAVDLQQLKDRLTSLIDAGLRNALDGVMLSGT
                     LKTAIYVEVICFSYPIIMTGVIDTDNFSSTMANRFQKVTGNAVQIAYDGLPRHARGTP
                     NKFQKGMIDMYCATRPCQIHSKRCHST"
     gene            complement(175987..176553)
                     /locus_tag="BWV06_gp131"
                     /db_xref="GeneID:30855143"
     CDS             complement(175987..176553)
                     /locus_tag="BWV06_gp131"
                     /note="old world monkey specific ORF number 17 (O17)"
                     /codon_start=1
                     /product="Cy170"
                     /protein_id="YP_009337576.1"
                     /db_xref="GeneID:30855143"
                     /translation="MTCVTIHDNMNQCQDTACSTLDLQHLEPHPRNEHRCAIVRMLST
                     VYRTLKGWMQRFLSIFRRKRKQSQCTQNTATIESMVKTALSYSTSVSGHTMIDMEVDL
                     CAFLTENTYTLQSCTFSEELTTLLTEKVQSVLFSVQAINPYQSSAEAKVLISNCPAAL
                     AEIMDDEGFSETMNSKFQAAFEHVLECA"
     gene            complement(176556..177395)
                     /locus_tag="BWV06_gp132"
                     /db_xref="GeneID:30855144"
     CDS             complement(176556..177395)
                     /locus_tag="BWV06_gp132"
                     /note="old world monkey specific ORF number 18 (O18)"
                     /codon_start=1
                     /product="Cy171"
                     /protein_id="YP_009337577.1"
                     /db_xref="GeneID:30855144"
                     /translation="MDTATIVLLSIGIPAAIIFDILIILYRDRVCPYIWNLFGRLCTR
                     FNCPVRMPDEETKRDASTGDEEESMCVCSLWCASLWAGFCQCVSRCVAFIGRCCSQIS
                     VRNKLTKENLEFYFPCCFTCFNWLTAKLYPTEPPQSRRGQPENKKQTEVEFVTVDLEG
                     FECELPTLDEPPRAQTHTNVAEADNAETQALIHKPPSKHSVSEAPDTEEEAARTPTPD
                     SVPDSVPDPDSDPEPCPAPAPTPEPNADIPAAAGVTPEVALLIQSTVEAAVKAALLNA
                     PKS"
     misc_feature    complement(<176655..>176960)
                     /locus_tag="BWV06_gp132"
                     /note="DNA polymerase III, delta subunit; Region:
                     DNA_pol3_delta2; cl26247"
                     /db_xref="CDD:331068"
     gene            complement(177596..178126)
                     /locus_tag="BWV06_gp133"
                     /db_xref="GeneID:30855145"
     CDS             complement(177596..178126)
                     /locus_tag="BWV06_gp133"
                     /note="old world monkey specific ORF number 19 (O19)"
                     /codon_start=1
                     /product="Cy172"
                     /protein_id="YP_009337578.1"
                     /db_xref="GeneID:30855145"
                     /translation="MTTSSYRNMNATSPGNTNSAGSVLDMWPLGVLVCGAGGMTSLVG
                     LIYLIYDWPFTCRLCYEVCCDCGPWCRCRHDCSHCCQKDRYEVRRRSHWSRRHQEDEA
                     NQRVEWEVVNTWDPSTNNNQDDKTEVQVAPPRPTVLCGPVCATTEKVFVETELTSSAV
                     YTPQVHKYRAVLVSEL"
     gene            complement(178178..179305)
                     /locus_tag="BWV06_gp134"
                     /db_xref="GeneID:30855146"
     CDS             complement(178178..179305)
                     /locus_tag="BWV06_gp134"
                     /note="RL11T"
                     /codon_start=1
                     /product="Cy173"
                     /protein_id="YP_009337579.1"
                     /db_xref="GeneID:30855146"
                     /translation="MHFRISYLIKDRTIYIFIAILSRYAAANNTSTVATTTNATSTFI
                     STSPISTTNMSVTSTITSTALSTSETTANVSTPTQTQNTVTSSGTVNTSSTDTSITTN
                     ISTSSAATVTSSNSSEIFTNTSGNTTITTSSSAITTTPTSTHNINITSINSTVNTTTT
                     RTSTAAVLGYTLVKVNATVGETVNLTATNFSITTHHHTYWVLMHNKTGKPTEHELCRT
                     SGSHQTKHHYGTLCYNCSKSTLMLYNVTHNDSRRYVLKTQDNSPKPEAFDLTVTSGNG
                     TSYPNSTPDFCTFVSSAPPTSSTTVNVYLQDVAAPATHAVWALALVITVVVALMFGQG
                     RMRRMRYYRQRHSDDREELIVKYRPERRRLTTGYEQMYISS"
     misc_feature    complement(<178970..179251)
                     /locus_tag="BWV06_gp134"
                     /note="Marek's disease glycoprotein A; Region: Marek_A;
                     cl28111"
                     /db_xref="CDD:332932"
     misc_feature    complement(178307..>178462)
                     /locus_tag="BWV06_gp134"
                     /note="vicinal oxygen chelate (VOC) family; Region: VOC;
                     cl14632"
                     /db_xref="CDD:326334"
     gene            complement(180434..181516)
                     /locus_tag="BWV06_gp135"
                     /db_xref="GeneID:30855147"
     CDS             complement(180434..181516)
                     /locus_tag="BWV06_gp135"
                     /note="old world monkey specific ORF number 20 (O20)"
                     /codon_start=1
                     /product="Cy174"
                     /protein_id="YP_009337580.1"
                     /db_xref="GeneID:30855147"
                     /translation="MMQPVSPKHAHALILLMMWPSGTSGEALRCASKDYTSNTDMKYQ
                     LPTNMTKIVSGPTKNETLSGPYTVTCVFVSGECTRGIYFTACDQNSSTQVYMYKNHAP
                     IFPNDESKTSATNTDGFTMRWPISPYAPGTYDCFSYDNVTNIMNITRRTQVTPMGITY
                     ASKHPTNQSVYNVSCSFNSTFPGTVTLIVQGAVNATVIHNETVKLCGQDLYWNYLVLT
                     FGGTPTFQCTNKATNCLLSGYSRLWSNTTRTPGPPIPILHNCSNYSHPWWTTTARPVT
                     TTSMSTTQLTSLPTSASTSFTYNVSLVVYEAQYASRELHGLWILVVLIICAAVACWLR
                     LPQAVVQMFRKCVASLQRKHNVYTNV"
     gene            complement(182362..183009)
                     /locus_tag="BWV06_gp136"
                     /db_xref="GeneID:30855148"
     CDS             complement(182362..183009)
                     /locus_tag="BWV06_gp136"
                     /note="old world monkey specific ORF number 21 (O21)"
                     /codon_start=1
                     /product="Cy176"
                     /protein_id="YP_009337581.1"
                     /db_xref="GeneID:30855148"
                     /translation="MDTVLWIMDFTSRFFQIALCVVFLLGLLMAFLLFLSTKCCIWLP
                     LRRHRNRKSLWPRRLQRLTAKNPCPSDANAAVVAQAASAVSAMSSASPPSPPSSPAVQ
                     CDDTQQPATRVCHANRQCTDLATLLKRHSKEATKKPSLSKRLLSFRCRKQSSGVKTPG
                     AGANNNCCQQKGGTEGSQVLALSTARPPLPPRPPRPPPPRRIPPRRTVTTTSSSP"
     gene            complement(183069..183734)
                     /locus_tag="BWV06_gp137"
                     /db_xref="GeneID:30855149"
     CDS             complement(183069..183734)
                     /locus_tag="BWV06_gp137"
                     /note="old world monkey specific ORF number 22 (O22)"
                     /codon_start=1
                     /product="Cy178"
                     /protein_id="YP_009337582.1"
                     /db_xref="GeneID:30855149"
                     /translation="MLSYMYVMCTFFRCTFAFTVTTLFVAFLLALTNEFCRCCGFSLR
                     QRTRYLAVQRLLPMAATYRLCKRVFRAVSVPVHAVISSFSAVSDNNPTPSAQLHANDH
                     TAFTGGPNRAPRTRSLSLSRVSPRSACHHPVHTHTSYTIHTSVDSSSSSPSSTFHSVL
                     LHHATAAAQGSRLSRPPRPPRHHDDDNALHGTGARRKPASRHRSDYHDSSPRPARSAP
                     KAL"
     gene            185037..185525
                     /locus_tag="BWV06_gp138"
                     /db_xref="GeneID:30855150"
     CDS             185037..185525
                     /locus_tag="BWV06_gp138"
                     /note="old world monkey specific ORF number 23 (O23)"
                     /codon_start=1
                     /product="Cy179"
                     /protein_id="YP_009337583.1"
                     /db_xref="GeneID:30855150"
                     /translation="MPSTTPICTSPEAPPKPPRLHRQRMQSTDCKRPSETDSDKEKSP
                     SAPHSTSNPTPKPPSKPLSHPAPEPTQNPQRKRQKTVVKRPSHPPPPPPTQTAVIPTV
                     CVSPPPSDPPSKPPPVPPKRRPELHLPLKGPRMVSIELPCLTGSGSPTYDYPVNSART
                     LL"
     gene            complement(185549..186055)
                     /locus_tag="BWV06_gp139"
                     /db_xref="GeneID:30855151"
     CDS             complement(185549..186055)
                     /locus_tag="BWV06_gp139"
                     /note="similar to HCMV US1"
                     /codon_start=1
                     /product="Cy181"
                     /protein_id="YP_009337584.1"
                     /db_xref="GeneID:30855151"
                     /translation="MEPAVSCGLVGHTPMRELAWRRVADDSHDLWCACMDWKAHVEYV
                     VPLAEDILPRPESWPAQVEAQWRLQIKGAHDVWCQCGDWRGHALRSRSLTLDSDSSRS
                     SRSSTCSYVSVASCPAAILECPGAADEASWWKRVKGRFRMRGWWERWLQRRRQRAAEK
                     ETTQPSSA"
     gene            complement(186290..186880)
                     /locus_tag="BWV06_gp140"
                     /db_xref="GeneID:30855152"
     CDS             complement(186290..186880)
                     /locus_tag="BWV06_gp140"
                     /note="similar to HCMV US2"
                     /codon_start=1
                     /product="Cy182"
                     /protein_id="YP_009337585.1"
                     /db_xref="GeneID:30855152"
                     /translation="MAVSLAILVLGGVALQLGLTFGWDFPTPVLTEEELAARRALYTV
                     QQTACYLEGGKLFMKGYITGNIDSYLVQVMVNRDKGFEYLRFFEKDIKLSSDKLEYDL
                     RYYEIDWTTTKVDMRFSLNISDEIWIICEPHVKPDFLAHDYFWTMCRAYWFKDWWLIL
                     WCVLVTIAHFMVCGVPIVLYLFHERTLKVFLRAFMC"
     misc_feature    complement(186386..186868)
                     /locus_tag="BWV06_gp140"
                     /note="Cytomegalovirus US3 protein; Region: Cytomega_US3;
                     pfam05963"
                     /db_xref="CDD:283588"
     gene            complement(187413..187961)
                     /locus_tag="BWV06_gp141"
                     /db_xref="GeneID:30855153"
     CDS             complement(187413..187961)
                     /locus_tag="BWV06_gp141"
                     /note="similar to HCMV US3"
                     /codon_start=1
                     /product="Cy184"
                     /protein_id="YP_009337586.1"
                     /db_xref="GeneID:30855153"
                     /translation="MKILVTTLGLLSLLLVINASPLPLSSSYELLHSRCHVKGGKMAA
                     TFTVRSDFAKLQRVEIVTHDRNSIRRSHEKQTHSTLTTRTWEVHEAVSPTIYRVDLRM
                     YHDYGLAKTFVCYVNEVQVEIDHTSIFWYAERVSRRNDWILLARLAFYVAVGFAIITF
                     IAAKFSLHVRLFGEVSINNHKV"
     gene            complement(188958..189470)
                     /locus_tag="BWV06_gp142"
                     /db_xref="GeneID:30855154"
     CDS             complement(188958..189470)
                     /locus_tag="BWV06_gp142"
                     /note="similar to HCMV US6"
                     /codon_start=1
                     /product="Cy185"
                     /protein_id="YP_009337587.1"
                     /db_xref="GeneID:30855154"
                     /translation="MKPLCGSCGSNENVVIGSLICLLVLSGVASAWRNDSNTLQKQDG
                     NMDKTCERVPQPDNGLHQKEAGRHCPFVDQGPACDAFMRRYERAIRILGCDPELRFHH
                     GHALNIRGLFGCPKATPKGIVFLLERYGGATLMLYIIMILLSLMLTALMLYVIEDLDR
                     VRCLRRCGSH"
     gene            complement(189740..190429)
                     /locus_tag="BWV06_gp143"
                     /db_xref="GeneID:30855155"
     CDS             complement(189740..190429)
                     /locus_tag="BWV06_gp143"
                     /note="similar to HCMV US8"
                     /codon_start=1
                     /product="Cy186"
                     /protein_id="YP_009337588.1"
                     /db_xref="GeneID:30855155"
                     /translation="MPRSPKMYCYHLPRALLFTCLLLIVPAERCNKICQQRRTYKPKS
                     GIPDGHIYGYTELDPECKIEDGRLHVNGIVLGDFSDPTWLHVYLRNYYDGKYMFAFST
                     NPGHPVVIMNDTMYSHAMHPMQLLEEAKTYKKDHGIIHHARLEHASRLRYQFHLPVSY
                     MFKEVVVQVDHYYKPLFIKCVPDYDLTQFLKFQLYEYKNFHGSCLSKLYWTFMSIVYV
                     VVAWLIITHMR"
     gene            complement(190674..191246)
                     /locus_tag="BWV06_gp144"
                     /db_xref="GeneID:30855156"
     CDS             complement(190674..191246)
                     /locus_tag="BWV06_gp144"
                     /note="similar to HCMV US10"
                     /codon_start=1
                     /product="Cy187"
                     /protein_id="YP_009337589.1"
                     /db_xref="GeneID:30855156"
                     /translation="MRLLVVFLLAYFWIQHRATADESDIEEANATCTIMGGILKVTWC
                     MMGKALPNETTVFPYYESRENSQRKRCLPMPNTTFSSNDTICLTTRTPAPADLGRILL
                     RECRECTCAIPCYPETIASWDFLFNGDFQRLVYEGRYATIAWLWCMDIMLGTAILLVV
                     MAIGCAIGECYWKCFMEPRIPYRPLSSKED"
     gene            complement(191455..191829)
                     /locus_tag="BWV06_gp145"
                     /db_xref="GeneID:30855157"
     CDS             complement(191455..191829)
                     /locus_tag="BWV06_gp145"
                     /codon_start=1
                     /product="Cy188"
                     /protein_id="YP_009337590.1"
                     /db_xref="GeneID:30855157"
                     /translation="MRLIVLGLLAVLPIVIVAETFHMEDAINSIRAYQNLSAAEKAQY
                     ERELDRWYLKMKLRFYDELDAMDRPNSTECYRWLATRWMFYTYDKLNGAAWSFPRYPC
                     PYADDQSSQSSESYETESSCSA"
     gene            complement(192116..192961)
                     /locus_tag="BWV06_gp146"
                     /db_xref="GeneID:30855158"
     CDS             complement(192116..192961)
                     /locus_tag="BWV06_gp146"
                     /note="similar to HCMV US11"
                     /codon_start=1
                     /product="Cy189"
                     /protein_id="YP_009337591.1"
                     /db_xref="GeneID:30855158"
                     /translation="MARFSKVHIFWIYDKEACRHQPGHCHVTKLLHKNDPSWCCLRQQ
                     HQDQAIATMKLLNLFVLSGFIMYVAWIDTLILSVSPPPHPPMFEVIDPNSMGIDGKMS
                     DFLMNLSLPSLPATKVVPNYHLENPRSQCHLINDNYLDAMWTYSGNATAPDLYLSADV
                     ITKFSSERLPEPTNVSTEYEQRYILKNIQLTKHVSAINLYVHPCAYCNAHVITCEPKL
                     RISWFPFWASIDQLDRLMFEGRHLHAYWGLFLMFIRWSFMLCMLIQMHWSLTGRSYWF
                     YGIWE"
     misc_feature    complement(192236..>192625)
                     /locus_tag="BWV06_gp146"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(193172..193930)
                     /locus_tag="BWV06_gp147"
                     /db_xref="GeneID:30855159"
     CDS             complement(193172..193930)
                     /locus_tag="BWV06_gp147"
                     /note="similar to HCMV US12"
                     /codon_start=1
                     /product="Cy190"
                     /protein_id="YP_009337592.1"
                     /db_xref="GeneID:30855159"
                     /translation="MGYQTTARHQDDDDVEEVMRWMRRFVWLVRVYTAMAIQLAITMG
                     LCLLCIMSSWRIQTPYLKDTLPIWMMIVPTVLRFNLRRKTTYRLTVWPAAVVYTALNT
                     WALVIWSMCLERTVMWQAYVFSLVLELSCTVFACVLASTRPRGRLVVACLIVALPLFC
                     AIVYYQSWTPAQKWIAVLTAVIVDLITLALLHDILMVLCYNPRSLFDRHAIRAALLLY
                     VDQVLVLMMAIVPLTADKWYPEYFSSTFPEQPVV"
     gene            complement(194012..194776)
                     /locus_tag="BWV06_gp148"
                     /db_xref="GeneID:30855160"
     CDS             complement(194012..194776)
                     /locus_tag="BWV06_gp148"
                     /note="similar to HCMV US13"
                     /codon_start=1
                     /product="Cy192"
                     /protein_id="YP_009337593.1"
                     /db_xref="GeneID:30855160"
                     /translation="MESFRFQVRFNESTAWIQRFKILVQVYSYFIFEFTVTAVFTLYI
                     WFSYPQWHNTCQNDPAPILAILLPVICLACLIIRWERQPSDLFTMTVYVVWVTLSITV
                     FGFCGEVSKALAAHVISVALFTLTTTAAFFDNFDENRYDRPVRRYAMILTLGASSLVA
                     LLAIAASNPTTVTHIMLSTYTVFLDLFMILFFWMTQRHRKHLWEKQIIQGSLTLYVSY
                     YALFQVTFLMLIPNIWHVPFNRVFSSFSWNNAQVKT"
     gene            complement(194889..195722)
                     /locus_tag="BWV06_gp149"
                     /db_xref="GeneID:30855161"
     CDS             complement(194889..195722)
                     /locus_tag="BWV06_gp149"
                     /note="similar to HCMV US14 (US14A)"
                     /codon_start=1
                     /product="Cy194"
                     /protein_id="YP_009337594.1"
                     /db_xref="GeneID:30855161"
                     /translation="MPFAPRLQPFTVHRPPAPMIQLDLDERSSLSWLRQHLPLASVYL
                     CLLFVIAVCICSYGAFKSQFHCMVFNTEICGVEPAFILIIVPVLLMFVWNMFDHRQDD
                     MIHMGNGLLYIVVFACIGSTLISFCTDGITAGLSLLFTTTFFLTCSGLALWSSRPLPS
                     KCRYIATLVSTFLLLLFYFGQLSHSVMRNGLSIILHGSMGIIIWENIYITKFNLTMKH
                     VVSACIVYVDILIVMYYMYVYLLTPSLWTLDPHKMLTGVSQLWNGSFNRTFCSPSSVY
                     G"
     gene            complement(195853..196581)
                     /locus_tag="BWV06_gp150"
                     /db_xref="GeneID:30855162"
     CDS             complement(195853..196581)
                     /locus_tag="BWV06_gp150"
                     /note="similar to HCMV US14 (US14B)"
                     /codon_start=1
                     /product="Cy195"
                     /protein_id="YP_009337595.1"
                     /db_xref="GeneID:30855162"
                     /translation="MERSSVASISWLQRTTCIFKIYGCFTLALVATVLVYGLARFTFP
                     MLYNNATNCRVDPAPSVLFLIPVVLFMVSHLLEESVDQTSSWIYSVTLTCLSTSVFHL
                     CTNDHTIWQTFVLSLLLFCTYGIPGICLHWIRPLAGCFITSFAVAFSLIALLSKNLSV
                     ILRAAGYAIFSLGFVLLIPTQFYLVHRRPERIKSSSLQLYTLFIVLYQVSIFCWTKDI
                     WSANVHNMFSVFRSSTLSAHVPKS"
     gene            complement(196674..197432)
                     /locus_tag="BWV06_gp151"
                     /db_xref="GeneID:30855163"
     CDS             complement(196674..197432)
                     /locus_tag="BWV06_gp151"
                     /note="similar to HCMV US14 (US14C)"
                     /codon_start=1
                     /product="Cy196"
                     /protein_id="YP_009337596.1"
                     /db_xref="GeneID:30855163"
                     /translation="MESEYRWHLNMHWLRRFTMIFQVYAWLGMEVAVTVAMYGVYRTA
                     RPYLTVDCVKDPAPLLMMCIPAAILIVENTPKRIAHTIDGLFWELYYMTVSCLLVSTC
                     TDDWTVFQSFLLTALMFILQSAAAVFDNMQMYRRKMLAMLFSMTVLFTMSLIYSFGHL
                     APSHMLFITMYFLFLVLTSIDVYMETVAIRHKHPVDEIRWPSIMLYVNWVLLYEANVM
                     LLTPGLWSARWDGMFSSLIAYFKQYSANTAHVTP"
     misc_feature    complement(<196875..>197021)
                     /locus_tag="BWV06_gp151"
                     /note="Potassium-transporting ATPase A subunit; Region:
                     KdpA; cl00903"
                     /db_xref="CDD:321240"
     gene            complement(197538..198263)
                     /locus_tag="BWV06_gp152"
                     /db_xref="GeneID:30855164"
     CDS             complement(197538..198263)
                     /locus_tag="BWV06_gp152"
                     /note="similar to HCMV US14 (US14D)"
                     /codon_start=1
                     /product="Cy197"
                     /protein_id="YP_009337597.1"
                     /db_xref="GeneID:30855164"
                     /translation="MASKMMTKLTNHVIWLNRCIHVWSVYGWLAFQVSITVLVYGLVR
                     CQQYLFDTCAQEPVRQIMMTSPALVFIQESYINRVIRKGSLWKNCGVALFCVIHIAFS
                     HVWFSGCVATWTVIQSWIATFCLFILMIYVSDGSNWKPLIKRQVLSDMLCAGALAANC
                     FVHSVTRPSVTLWWIAQTLYIVGTVGFMNAMCLQLSNVRQQQRSNERAMSISLLLYCI
                     FHLVHYNNVIMWSFPWKAEDPWL"
     gene            complement(198241..199065)
                     /locus_tag="BWV06_gp153"
                     /db_xref="GeneID:30855165"
     CDS             complement(198241..199065)
                     /locus_tag="BWV06_gp153"
                     /note="similar to HCMV US17"
                     /codon_start=1
                     /product="Cy198"
                     /protein_id="YP_009337598.1"
                     /db_xref="GeneID:30855165"
                     /translation="MTGHQVMRLIKKTRIQNQSLKLSHRCCFFSLHLYRTVSLQVSCT
                     FVIGGLMILAAPYVKIPESICQTGFLPALSLLIPNACLTILHAKKQHSNSWTVLTIYT
                     LVTATAVVLANLCVDITLVTWSGLLAGILFVTCTGLACLGDLHYRRWRTLGLIFFLIL
                     TITLVALSLQPLSLPNKILLGYYVIVLAFMLGVTVFDTSQLSKVSSSQETCVLGLCLY
                     EDLIYCYLLVLLILTTESSLERLTSWMQHFSPSSTQNETRPTVDSSATTHGFENDD"
     misc_feature    complement(198370..198966)
                     /locus_tag="BWV06_gp153"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     gene            complement(199171..199971)
                     /locus_tag="BWV06_gp154"
                     /db_xref="GeneID:30855166"
     CDS             complement(199171..199971)
                     /locus_tag="BWV06_gp154"
                     /note="similar to HCMV US18"
                     /codon_start=1
                     /product="Cy199"
                     /protein_id="YP_009337599.1"
                     /db_xref="GeneID:30855166"
                     /translation="MSLQEPLDSELAESWMHQNLLEWIDKFRSVVSVYSNTLFEVTAT
                     LSVCALFWFSFPSVTELCLLCAVPTGAMLIPILCLGLACCYQKELINRSGSATFMCIL
                     IETGTCVMTGFCCPRQNLGLGLSLTAVVIVLCNSIVFYAGRNAVRWRMFFVIYGWCML
                     CFVFFLTFAKAAIIYKIFTVMYMCLISAVAYLLVHQLLLIIYPTSSELILTEAAELAR
                     SLAVYTAIIALFNIISMMFSVNQWMGNMIQQMNHTEPSWAWFLLQNSP"
     gene            complement(200091..200876)
                     /locus_tag="BWV06_gp155"
                     /db_xref="GeneID:30855167"
     CDS             complement(200091..200876)
                     /locus_tag="BWV06_gp155"
                     /note="similar to HCMV US19"
                     /codon_start=1
                     /product="Cy200"
                     /protein_id="YP_009337600.1"
                     /db_xref="GeneID:30855167"
                     /translation="MGAVFNNETDMEDELRLLGRRIMFWMQVCVAIVLQLASTVIVSL
                     VIWIVSPSSFREFCNIIPRYSILSLFVPMLSLFILHVWGQCRCMHQLVFIVIYMFPNA
                     TALIMMATCRSFQTIFMASLLPLIIMMFNLGLICFTRLRMGVNRLHRWFFPVMLMNST
                     FMVLALIALPASDTLWVGGYIALLLTFVIGLSIHDMTIIGKQELFEDATLVLTIRIYI
                     ETLIMYIIGLLIIDPDFWRNTTSSPFDLDFSLGRWWAAEVNLN"
     gene            complement(200937..201698)
                     /locus_tag="BWV06_gp156"
                     /db_xref="GeneID:30855168"
     CDS             complement(200937..201698)
                     /locus_tag="BWV06_gp156"
                     /note="similar to HCMV US20"
                     /codon_start=1
                     /product="Cy201"
                     /protein_id="YP_009337601.1"
                     /db_xref="GeneID:30855168"
                     /translation="MVEQDNAENTMESAPSDSSPLMVTPEEAVVWFKNFVVWLRVYGV
                     YTFALTCTFAIASLIWLGYPQNQNLCVNNHSTVLTLLVPLTCMVTSYLLGARHPSNLT
                     VLFFYICVNLVPTILFNICSEGYVIVTAYIMSVATFIAFTGLTFIAGLNYGRWKWIIG
                     MYIIVLALFLTSTAFQSAPWHTKLTNSISAFSISFFAFILAYDTYVVIYQSSFMYCIR
                     GGIRLYVDTIAIFLVIIFMISMPKWVEHAKNSTLT"
     misc_feature    complement(200979..201581)
                     /locus_tag="BWV06_gp156"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     gene            complement(201746..202432)
                     /locus_tag="BWV06_gp157"
                     /db_xref="GeneID:30855169"
     CDS             complement(201746..202432)
                     /locus_tag="BWV06_gp157"
                     /note="similar to HCMV US21"
                     /codon_start=1
                     /product="Cy202"
                     /protein_id="YP_009337602.1"
                     /db_xref="GeneID:30855169"
                     /translation="MQLSDEVRIVRSVFLLRVYILLWFQSLLFLSICALCWLVLPDRL
                     EHVVCNMRMMLFCLMLSVICLGILNWAEPQFPKNLFVSLIYTLLTAVAVTTSGFQFGN
                     RSAVYAMLSTVLLFIVLSIATYRFARDIEFYRPLITASSALIIILASIFYYFPDEVGE
                     MVVMFGGLAVIVASVICDTQDTLHRIEYESYIPAALCLYMDLMYLFVTLLYFVSTPNS
                     QEVSRVVYKS"
     misc_feature    complement(201791..202411)
                     /locus_tag="BWV06_gp157"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     gene            complement(202554..204278)
                     /locus_tag="BWV06_gp158"
                     /db_xref="GeneID:30855170"
     CDS             complement(202554..204278)
                     /locus_tag="BWV06_gp158"
                     /note="similar to HCMV US22"
                     /codon_start=1
                     /product="Cy203"
                     /protein_id="YP_009337603.1"
                     /db_xref="GeneID:30855170"
                     /translation="MTLLSRSAAEAWGTYLKQRDERPEDVIRCDYGVFSLRNLVFQRC
                     LTMLQGVYLRQYDQPCLREYIKKNSGTIIPLRNPCSWFLVLRSGIDIPQVESRSFDEY
                     LCCKEKLEALGILGVQLRDGSDRKKIQETTCVVLLGSYGFVYVYDWDSDGLFQIGTSL
                     KELAHHGLLTCESVYRHPQTPFSTTEPRFQVEKLLCLDPTDARGLAKTAEEFHGVNVV
                     VKTPGRSEADPLLLLGTVEKLRQMYPFAKMREDNFNNLIKYINQRMCCRWYVLGVTGR
                     YANFGILLTCGIILLDECGVCYVLRIDESDVFRLADNIQMLFRCGFLKLRGITRFDRG
                     LRGEARLESECYCNHGARKQDLSWCSMVNTVTAEQLCGAYDWLTRSNRAHDKIPTSCC
                     WGRSDLMPTGVLQENQNWCFPWSSVTVLQGPQSGAWQENDELTEKASDGTVMFRVDRG
                     FSPRTVKFEGESDDSEEEEEDDDNQSEEAPQHQPVVIVSQETNGSVDSYDDESESSLS
                     SDTHEPPPPDIMAIIQKEWQNDEPITNERQLLLRRARRAKYMKRWHCSLERVSIYDPL
                     NANIHCFD"
     misc_feature    complement(<203133..204161)
                     /locus_tag="BWV06_gp158"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(204437..206308)
                     /locus_tag="BWV06_gp159"
                     /db_xref="GeneID:30855171"
     CDS             complement(204437..206308)
                     /locus_tag="BWV06_gp159"
                     /note="similar to HCMV US23"
                     /codon_start=1
                     /product="Cy204"
                     /protein_id="YP_009337604.1"
                     /db_xref="GeneID:30855171"
                     /translation="MWRTRWEDGAPSFTRPDDFPYCHARYDTYLRVMADFKDLFLRQA
                     NIDSVRVWVRERIDHVLCLGIPCNWFVHVRPGSHMPELRDQLLDDITCCRERMAVIGK
                     CIMWVQDRFVETELIMCMASDTKMYIYEPSQDILILAAEHMDELARFGLLHAECVYRQ
                     FYTPYATRVPHDVVSAMLTQAHDADSLAQCVGAYHNRDVNLHTPGRHADTLKLLANFG
                     CLSDLWPFEAIDPYHLAECQMYLSLRLRCRWYIMGAVGTYRLGGFFEVSSIVIFDRFG
                     RIYTVIVRPYTDRTSHVCLAPGNVYRVADTLSEFFKGGLMKLYVRRRHEHHLRTIARL
                     ERGVRCIHLDETYRLHFTAFDHGVSRDFVRQYRWLCRPDRFRADMITTWDGWDAFTIW
                     HTRVLRGDFVDRRRPHENRDEGAPPRRRRALFNPDDLPPPPPPPPPPSPPQQQPQPSP
                     PPQQQHEQQVPAEEAAAAAAAVAQQEVPAPQPPEAPAFQVPALPAPALQAPPPPPIPR
                     MQDDFDDVHEDDIEVIGRENEGFQMEEDEEEDDDWEDLGFDLDEDSMYDLKDIDAWHA
                     ERQAAQADRWRLGQKLMDAYHTEVDVSEPEVEARRVHLNRDLSPDWISSFDLRAFFQ"
     misc_feature    complement(204440..206308)
                     /locus_tag="BWV06_gp159"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     gene            complement(206332..207762)
                     /locus_tag="BWV06_gp160"
                     /db_xref="GeneID:30855172"
     CDS             complement(206332..207762)
                     /locus_tag="BWV06_gp160"
                     /note="similar to HCMV US24"
                     /codon_start=1
                     /product="Cy209"
                     /protein_id="YP_009337605.1"
                     /db_xref="GeneID:30855172"
                     /translation="MAEFSDRPVDELQFYRQVLIDFRDLFFCLDAPQIEHYVWRYRGR
                     RLCLGPPQGWYVELQRDQQLVQAQHAARKLICCNEPLCALGYALKLIPEPHRDHERDY
                     LQTDFVICMGRFCRIYAFDPRENYMVLVAHHLEELAKYGVLRSEFIYRDSVHNQLRRL
                     SPTLIRSGPRSIRTMHILFLNETTPDSFYVTADRILDHDVKLHTPGYGTVIMRLMKTV
                     TELRTVWPFSSLTETEAKRWWWGIRANLATPWYLLGVTGRPRLGRSFVAEVMVVLDWF
                     GAVYAIQLDEPNHNLRRVANTLTEFFRMGLLKLVFAYRRFEPERQRKIRMEHQCICPH
                     VEEREMDRRHELLAPFEREERRQRFVQQHYDWLCLTERFDPRQGAWERLDPNVLVLHR
                     YDTVQQTYVLESDIVGVEAAEREAASHQEDTGPRLHCLVTTKSSTRERTTERVLAALV
                     YQSRLVTYTDPFPFKSLTGSREFVPI"
     misc_feature    complement(<206638..207720)
                     /locus_tag="BWV06_gp160"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            complement(208125..209918)
                     /locus_tag="BWV06_gp161"
                     /db_xref="GeneID:30855173"
     CDS             complement(208125..209918)
                     /locus_tag="BWV06_gp161"
                     /note="similar to HCMV US26"
                     /codon_start=1
                     /product="Cy211"
                     /protein_id="YP_009337606.1"
                     /db_xref="GeneID:30855173"
                     /translation="MLRQSYRYASGPAVRRTLGALKDLFSHQESQSSLRILVSLKAEC
                     RVSVPISAPPGWRMVFATFPSVFGEDTPCQGPGSPWSKLICCEEPLEVLGVLQYWPGR
                     RNEDDGDSSDEDSEDEYCDDSCLYVDDLLPPSKSKRVVLMGRYESLWVLDRDQNVLYF
                     LASGLDDFARHGLLHCESIYSGKFRMPMLTTQPDDVISHLRMNDYSLCQLQRAMARYR
                     GQCIPLRTPGEMTRPMLICAEADDLKSCWPFLCMDNLMFEKLMQFFKDRLCCGVLIFG
                     VVGEVLPSGVFHAEWVILMDAFGELFYFDVYRRDVWRLADDIDSLLTMGLLKIYQAGR
                     RFSLALSDAERLEMPPHCPHRTYQFWDRYLYMDRGMGHKHQETRFQWLVRRDRFCRLN
                     PGGCYSRNSHHEVSGAADGSWEPHVRCDFPQATEVEAAHNFWRRLSDYVHSKEVKQGV
                     RCYSIWNQMNPVLERAIVNLRQSMSAEGHASEPESASAPNDAKPAMLYKKPQVPESDD
                     DDLLEIDGGGARVQAACLSSPSRSVETDARPPTDSSSEEGGDEDGGEDVTCDYYTQVL
                     INRAAKAAILEGCPYPRPAVPRPGSYLPPWL"
     misc_feature    complement(<208752..209906)
                     /locus_tag="BWV06_gp161"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     gene            210090..211076
                     /locus_tag="BWV06_gp162"
                     /db_xref="GeneID:30855174"
     CDS             210090..211076
                     /locus_tag="BWV06_gp162"
                     /note="similar to HCMV US28 (US28A)"
                     /codon_start=1
                     /product="Cy214"
                     /protein_id="YP_009337607.1"
                     /db_xref="GeneID:30855174"
                     /translation="MNSSQHNISVFLSIGAGPVITGYTCVFLFGILGHFYLYWKNHQR
                     RHRTNSFSDVLFRHLMITEEVFTLTVPVWAYHLTTHGNLPGSWCRSLTFVFYLTVFAR
                     AFFYLLLIWDRYSVIICRHPLPVNLNYSQVIGLSVWLVAVLSASPFSIFNGSVKQCLG
                     NMGSIPSESSAVLNLEVHLCSFWLPLIMSANCYYQAKRRASPDQLHELYRCSLLITII
                     TTYAIVWFPFHLALLIDALISISHVEPSSALHWASIVVTCKSFTFVYAGISPLVYFTC
                     CPTVRRELLMSLRPFFTWISGKTRRGYVPIKTQPLNIPDEPMDNKLPHLLNE"
     misc_feature    210156..210908
                     /locus_tag="BWV06_gp162"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    210156..210218
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    210246..210311
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    210354..210422
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    210483..210530
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    210600..210671
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    210723..210788
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    210837..210908
                     /locus_tag="BWV06_gp162"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            211411..212424
                     /locus_tag="BWV06_gp163"
                     /db_xref="GeneID:30855175"
     CDS             211411..212424
                     /locus_tag="BWV06_gp163"
                     /note="similar to HCMV US28 (US28B)"
                     /codon_start=1
                     /product="Cy215"
                     /protein_id="YP_009337608.1"
                     /db_xref="GeneID:30855175"
                     /translation="MTNTNNTTCHLNGTLETFKITRPVAISAYTVLVVIGLLGNIVLL
                     SVLVVKRKLKFPNDIYFFNASLADVFAVCMLPAWVNYALDSTQLSKFSCITFTFGFYV
                     SLFIQAWMLILVTVERYGSLVWIAPITRNKAIANCVLFWLISILLAAPYYSFRNENDQ
                     HQCIMRNYVWCVGTTWHIVLDFLVTATTFIIPVITVLALSFKMARWSTFGYRNLTSRT
                     SLILILILTVAAGFWGPFHLFMFIEDVAGQIYHIQKDCWYLQLRHLCSLMTETLVFLR
                     SVFNPYIYMIISYKFRQQVRSLLKRTQYDALDTTQLAETMELKAKGVAVADPAPHDCE
                     CFL"
     misc_feature    211492..212289
                     /locus_tag="BWV06_gp163"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    211492..211557
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    211582..211647
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    211690..211758
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    211813..211860
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    211942..212013
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    212059..212133
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    212197..212274
                     /locus_tag="BWV06_gp163"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            212559..213560
                     /locus_tag="BWV06_gp164"
                     /db_xref="GeneID:30855176"
     CDS             212559..213560
                     /locus_tag="BWV06_gp164"
                     /note="similar to HCMV US28 (US28D)"
                     /codon_start=1
                     /product="Cy216"
                     /protein_id="YP_009337609.1"
                     /db_xref="GeneID:30855176"
                     /translation="MTNTGHCHINESLATYGIAPAATITLYTIAGICGVTGNLLLLLV
                     LFTRRIHWFANDIYYLNMIFTDFLVFITLPAWVYYLLNYTQLSHYACIALSFVFYVSI
                     FIQADFMVAVAIERYRSLVKNKPLSVKKASVSCACIWIIVIVASSPYYMFRSQHETKS
                     CILGNYTWHMNSPFRTTMDASINIWSFVVPAVTTLLIARRIYVCTSGNKKMNARASGL
                     LEAMVISMLFFGGLFNLNIFRDIVADTSEENKDCTYLKQEHFIRMVGVALVYGRAIFN
                     PFMYMCVSTRLRQEIKCLFMRIPYETLDAEHAKLMVDLKNRNANVPDPKPREYESVL"
     misc_feature    212631..213431
                     /locus_tag="BWV06_gp164"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    212631..212699
                     /locus_tag="BWV06_gp164"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    212724..212789
                     /locus_tag="BWV06_gp164"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    212832..212900
                     /locus_tag="BWV06_gp164"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    212955..213002
                     /locus_tag="BWV06_gp164"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    213192..213272
                     /locus_tag="BWV06_gp164"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    213333..213410
                     /locus_tag="BWV06_gp164"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            213633..214655
                     /locus_tag="BWV06_gp165"
                     /db_xref="GeneID:30855177"
     CDS             213633..214655
                     /locus_tag="BWV06_gp165"
                     /note="similar to HCMV US28 (US28E)"
                     /codon_start=1
                     /product="Cy218"
                     /protein_id="YP_009337610.1"
                     /db_xref="GeneID:30855177"
                     /translation="MNNTSCNFNVTLNASAPSRYIAIALYSIVICIGFIGNLLLCIVL
                     VKKRKLRYSSDVYFLHASMADLVSTVMLPLWLHYVLNFAQLSREACISFSVTFYVPLF
                     VQAWLLISIAMERYSNLVWMAPISVKTAFKHCIGTWIVSAFVASPYYAYRNSHDEHEC
                     ILGNYTWHINEPLHTCMDVVIIVWTFLAPVLVTIIASVKMRRTTWGNPRLNEKNSDIL
                     VVLVVMTVFFWGPFNIMLVIDNILQRYYDNTMNCDVEKVKHIMAMISEAIVYFRGITA
                     PIIYVGISGRFREEIYSLFRRQPYSDLDPDANQFMIELTSQGRSRNRNARQSESNVPQ
                     PEECFW"
     misc_feature    213702..214505
                     /locus_tag="BWV06_gp165"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    213702..213770
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    213795..213860
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    213903..213971
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    214032..214076
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    214155..214226
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    214272..214343
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    214407..214484
                     /locus_tag="BWV06_gp165"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            214800..216251
                     /locus_tag="BWV06_gp166"
                     /db_xref="GeneID:30855178"
     CDS             214800..216251
                     /locus_tag="BWV06_gp166"
                     /note="similar to HCMV US28 (US28F)"
                     /codon_start=1
                     /product="Cy220"
                     /protein_id="YP_009337611.1"
                     /db_xref="GeneID:30855178"
                     /translation="MTSTTMNTTTNSSTTPQSSSTTMTTKTSTPGNTTTGTTSTLTTT
                     STTSNATSITSTLSTTGNQTATTNATTLSSTLTTSTNISSTLSTVSTVASNATCNSTI
                     TTNITTAFTTAANTTASSLTSIVTSLATTIETTSFDYDESAEACNLTDIVHTTRSVTV
                     TFYTIIFILGLLGNFLVLMTIIWNRRISFTVEIYFVNLAISDLMFVCTLPFWIMYLLE
                     HDVMSHASCVTMTAIFYCALFASTVFLLLIVLDRCYAILLGTEKANRRLLRNAVSGCM
                     LMWGLCFILALPHFIFMKKGTNVCVAEYEPGLNNFYVIFINTEVNLCTLVLPAAAIIY
                     WYLKLTKALKTHERLRHRLTSLNIVLAVVIVFALFWLPYNLMLMMYSLVHMQIPWECS
                     SEKILRRSLIITESIALSHCCINPIIYLLFGPRCRSEFCHLLRCCFTRLCPHRSWSAI
                     RAETVSISLSHSQVSASSEDDDNDVHDELQFLI"
     misc_feature    215280..216089
                     /locus_tag="BWV06_gp166"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:333717"
     misc_feature    215280..215348
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    215373..215438
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    215481..215549
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    215616..215666
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     misc_feature    215739..215810
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320095"
     misc_feature    215856..215933
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320095"
     misc_feature    215991..216068
                     /locus_tag="BWV06_gp166"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320095"
     gene            216412..217731
                     /locus_tag="BWV06_gp167"
                     /db_xref="GeneID:30855179"
     CDS             216412..217731
                     /locus_tag="BWV06_gp167"
                     /note="similar to HCMV US29"
                     /codon_start=1
                     /product="Cy221"
                     /protein_id="YP_009337612.1"
                     /db_xref="GeneID:30855179"
                     /translation="MLTRPWYIDIWWITLGCAPAMSVTVLLTTATVGAHSIVVHEASP
                     PPPSSSSLRLPITSPSSTHFTDSSKPSYVEPSAAGPTRQRTNALNRRRRQQQRKPYTC
                     ITGTHWTTNLVFTSCENTPSFVKLEGVRKWTLKGQPLGETSYYGGCCRLAHGENAYII
                     LANGYGPAIHGHALRVDYATTNCTQPAIPFPTRLEITSTQGLQSRCGAHRFYFYGLEC
                     STQLAFSTLGVVDVRRCPSVLAVRPLRRPGTFWDEQLRGLSLDILVCLALVMLLFMEI
                     IPGQAFRYPIGTWRRVSAFPSTFRLHRWVKRNLASLFSRQTEHQKKPSEAAANRTWTV
                     PFPCSHTVLLAPIPFRLRRTMSFPSLQFSTSSAHNVSQITDDNPTHGTYESHNLPPVT
                     LPVTDYIEVIAEHAPIIYRQDASAVQAMLLQAALERDHNREHDRNRC"
     gene            217649..218470
                     /locus_tag="BWV06_gp168"
                     /db_xref="GeneID:30855180"
     CDS             217649..218470
                     /locus_tag="BWV06_gp168"
                     /note="similar to HCMV US30"
                     /codon_start=1
                     /product="Cy223"
                     /protein_id="YP_009337613.1"
                     /db_xref="GeneID:30855180"
                     /translation="MPAPYRRCYFRPLWNAIIIASTIAIAVNACHIEVGEDATVEQEC
                     RQRNVLLATGQLTPHSHRPHVLEFTFSTKDRLGSVQRLQLHITGLQLNNRTVLDQSVY
                     WRLFSRATTLEGGVKQKAKLRLISEQHVPARHCEITVGRDSGLDETEPWGLLNVLSYF
                     VWWVAMCLLAIDIIINAYQWIHKINSKTRTAVSVRAEILRNEREMFWKRRRARHGGVS
                     ESPVSSVPPRYACNEPWSLPSTADATASNQSAAATPAAPTPPEYSSSSVFPPFPQ"
     gene            218546..219031
                     /locus_tag="BWV06_gp169"
                     /db_xref="GeneID:30855181"
     CDS             218546..219031
                     /locus_tag="BWV06_gp169"
                     /note="similar to HCMV US31"
                     /codon_start=1
                     /product="Cy225"
                     /protein_id="YP_009337614.1"
                     /db_xref="GeneID:30855181"
                     /translation="MDKEETWRGLMVYSHSLWCICGHWKAHIVMSDEANSEEVACSNW
                     MEDAIMRWMRNSRETHDKWCRCTDWRGHALSLEENRISLVTLPAAMETKNTASRHNSR
                     LSCFTRVFKSFRKKGRCGRGSSTASNSSGASTISSHSWQWYRVTPPTPPQAECQRAPH
                     P"
     gene            219158..219718
                     /locus_tag="BWV06_gp170"
                     /db_xref="GeneID:30855182"
     CDS             219158..219718
                     /locus_tag="BWV06_gp170"
                     /note="similar to HCMV US32"
                     /codon_start=1
                     /product="Cy226"
                     /protein_id="YP_009337615.1"
                     /db_xref="GeneID:30855182"
                     /translation="MNRPRDLIPTLHDPCTQTELRWRRVLTESHALWCNCGDWTPHVE
                     CVDDAYFQLRWRSRQERTALRWRRQMHRLHNLWCMCGNWREHALHRRGRFTDSSSGSS
                     ASSSGESAENTFVWWKCLRKWNILWRHSYDFFDIPVPPESERETPAYSDSGSEGTPCT
                     SMIEIHRPQDCPIVMDVRPRYRETAV"
     gene            219861..220166
                     /locus_tag="BWV06_gp171"
                     /db_xref="GeneID:30855183"
     CDS             219861..220166
                     /locus_tag="BWV06_gp171"
                     /note="old world monkey specific ORF number 24 (O24)"
                     /codon_start=1
                     /product="Cy228"
                     /protein_id="YP_009337616.1"
                     /db_xref="GeneID:30855183"
                     /translation="MWHAIAAHTPSGVASAARALNNALSDLVCRISMLCARRRRRAVT
                     QETATAGSSEAKQAEQNQEQPQTSPSTSFLGRALVLVGQQLLAANQAACPPPSWLWK"
     gene            complement(220410..220790)
                     /locus_tag="BWV06_gp172"
                     /db_xref="GeneID:30855184"
     CDS             complement(220410..220790)
                     /locus_tag="BWV06_gp172"
                     /note="old world monkey specific ORF number 25 (O25)"
                     /codon_start=1
                     /product="Cy228.1"
                     /protein_id="YP_009337617.1"
                     /db_xref="GeneID:30855184"
                     /translation="MGALTKFHRTLRRGWNAFLSTFCCGRSQCTNKAQGQRPPAPTST
                     AEDMLQSCWDTCANYLHQEMNTDTPSPPPAEAPRTMEAYWQAMKSTFHDNHFGDTSNT
                     RGFGNPCYLDILPGFSPVLRRQSC"
     gene            complement(220888..222963)
                     /locus_tag="BWV06_gp173"
                     /db_xref="GeneID:30855185"
     CDS             complement(220888..222963)
                     /locus_tag="BWV06_gp173"
                     /note="similar to HCMV TRS1"
                     /codon_start=1
                     /product="Cy230"
                     /protein_id="YP_009337618.1"
                     /db_xref="GeneID:30855185"
                     /translation="MRPHRSPHSWQQLRYAGLRNSPDPHSHRLPAPPHHWRPHPPSPL
                     HHMSGLMQALPTPPPQTPAAMHPPAHAPGAPTTLTLPSIDTRTRLASIPAQQHALTKD
                     EFLIMATAWADAFIANTTARATRKWCQRQTGQLLPLGRPANFYAVVTPRSHMRDVGAT
                     DLRQLSPTDDWIVLVATIVHEMSPTPQDPPTLCRHEGLFLAIGCHFRVFLFDLPRHTL
                     HLAATDADDFFRHGIGDLARVYACPTLPPLTVHPPEPVELLSRTWPSASAAAAAVGHS
                     AAGHTICLQTPGRTPQPWLLTTSWEEVERWQPFCKWPHAGSIVAAVRNFISERLCCTF
                     HLLGIVTTHPWLEYLSEWAAARANWFDTRSRNPSREHARLAAYQGNTVKRRPKPNKHS
                     RHNAPASDVPTVPTPAPAAAAATHSPKCHAELPSDERAEVDDDGRLLEKNPLAVMLII
                     IDELGVVYGYCTYDGLIYPLAEDLSHFLRVGLLAALTAGYAAASSDQAAVRLLPDQDP
                     YVWERPRPDALYLWPRPSGGPRDLPSQFAFLTRPARWRLDTDTSTCQSRDEDGWRVRD
                     AQALALPAEAGQEPIPQSDQALVSRALRYDLRYWKLPSGPEEDEDPGEDDSFNLLPYR
                     TWAAGDYNPHWDPQSVRGPNTVMQRRICNHRARANRPFRRPLPIQPRDRDPSVFPKYS
                     TDGVLITPC"
     misc_feature    complement(<221944..222675)
                     /locus_tag="BWV06_gp173"
                     /note="US22 like; Region: US22; cl27432"
                     /db_xref="CDD:332253"
     repeat_region   223185..224064
                     /rpt_type=direct
                     /rpt_type=terminal
ORIGIN      
        1 gcactccggg gttccgtgcg tgcgttgagg gccggggggg tgtttgtggc gggggggtaa
       61 aaattggcac gttgccagct tgtaggagga aggcggcgaa ggagacacgg agagaaacag
      121 cgagagaccc gagcggccgc gctccgtccg cgctccgcca ggcccgcagg gaggatagat
      181 ccgtacagcg agacccctgc gagcctgcgg caaagcggac ggagcgcggg ttcgcaatcg
      241 cggcgacgga tacatacggc agatacacac acagagagaa attcaccagg acgaaagcgc
      301 cgcgcacccg gagcccccca ggtcccctcc ccgttccccc cttggcgtcg ggccaaggcc
      361 gcgaggggcg actgtccgac ctcgtctctg tgccaacgcc ccgcccaccc tcgcctcccc
      421 cctccccctc gcgcctgccg acaaccggcg aacacgcgcg cggacggaga ggcgcctggc
      481 gcctcggccc aaagcgtccc tgtctctgtg tcgcgccctt cccgggaggg gggccggggg
      541 tcgaggcggg gggcgtcaaa aatgcgccgt ctgtatgtgc tgccggggcg gcgcggaccg
      601 tgtttgtttg ctcgcgctcc ctgcttctgc ttttctcccc gcgccgcgaa acccgactcc
      661 gccagcgcct cggacggtga gtcatcgctg ccgcgtctac accgccagca cacggtgaaa
      721 cacaacccgc tttcttgtct tcacgttgaa attactaatg gcaacgttga aaaatacccc
      781 acttgctcgt ctacaccgcc acatctccac gctgactcaa ctccacacgc tgagtcaaca
      841 ccgacgcgcc ccgccaacac aagcactgag agacgggcag aaagggactt ccccccgggc
      901 gtcaagtggc ggcctgcagg ccccctagcg gccgccgcag gaaccatgcg tgaacgccgc
      961 ctactatcaa ctgtccgcta tgcttctcct actatcaact acgcgccctc gccatgcatg
     1021 ccctcacttc gctgcccgcg ctctcatact gctctcctca ctatcaacaa tccgctcctc
     1081 gctctgtctc tccacacatt tactcagctc ttcccccctc tctgccggcc acacttcacc
     1141 acgcactcct cgcccactct tcgcacatcc tccatctcct ctcgcactat gcttctcctc
     1201 gtccctccct ccctcgcatt tcccttacac tccctccagc gctcccaaac acgcactctt
     1261 aaaccttcca gcctcctccg cgtcgcactc actctcgcat cgcccaccat gccgcgcact
     1321 cccggagcct gtgctaacac aacctcgcct ttcgcgctgt cacctctcac ccgctggcga
     1381 gcctgcacca tcttcctacc cgcacaacgc tgcccaacat gcggcgactg gagcaccgca
     1441 gaacacgaat ccggcacctg ccgcgctccc gatgccgacc tcaccgacta ctctggtgga
     1501 tccacctccg atgacgaagc cgtcacagcc tacgcccgcg cgcttcgcag catgccaacc
     1561 aacccctcct acgccaagca cctctcctcg tcctctacac gctcccgctc ttcacgcacg
     1621 cgccatcgcc aatgccgacg ccgacccccc tcctctaccc cccactcacc tgtccaccgt
     1681 ctacctacgc cctccctctc ctcctctacc tccgacacat ctccatctcc tgcacacacc
     1741 tgtcccctcg ctcaccttcg cacacctcca cacaaccccc cacccccaac cacacgcaaa
     1801 caatacgatc ccctcggcga ccaggccgac gaagcacttc gcatctacgg ctacccgatc
     1861 agccgctacg atatgcgcac cggcaccgct gaccgactca gcccagaccg cggaggcccc
     1921 ctggaaccca attgctggtg cctctgggga gtgcacgcac acaaaaatca ccgtcctatc
     1981 atctccttat tgacagcgcg cactcgcgac ggtcccacca agagcggcgg ctgggatgtt
     2041 ctctacggcc gcggctacgg ctaccgcgca tttccaggtc ccgagggcga atctcgcccc
     2101 gtctggacac aacacatcgt ctttctcctc ggcggccacg gccctcgcct acaacttaac
     2161 cgtgcctgcg cccgcgaggc cgaagcccgc ggactcttac ccttttggcc tgtaccatcg
     2221 cccaaacctt cctcttcaac cgactccgac agctccctcg acagaattcc gcgctcccac
     2281 ctaccacgaa tccttcagaa acacacagcg cgcctcgccc tgtcccacac ctctaccagc
     2341 cgccaggccg aacgagcaga acgaggtgct tggattgttt ccgacacctt caccgcccct
     2401 ggattacgga atacttggaa cactcgtact catgaggaat tctggcaacg taactatatc
     2461 aaagactaca tggaacacag cgttttcctc ccaacttcgc caaatcgctt ctacgaccct
     2521 ttccaaagcc gccgcccttg tcgccactca tctactagca gctctgacac ggacgacagc
     2581 gacgacgaag aaaacaccac cgtacccatc gcacctgacg acacttacat ccctcccaat
     2641 gaaagctgca aacattctca acccgaaact gaatctcata ctttcaccac tcccgagaca
     2701 gaaaccactc gcctgtaatc atataaatag aatttatttt aataaataca catattgcat
     2761 cccagtgtta tgatctttgt cagttttctt cccccatgtc ttctcgtacg ccacatcctc
     2821 ctagctatct ggccgccgtc atatacggca gttgtcataa ttcatccctt tgttgtccat
     2881 tctcgccctt cgcatctcca aaatgccagt tccaagcttc caacgcgctg tgcctgcgct
     2941 ctgcctcctc ctgctgctga gcgctccact gctgcgttgg tcgtaccact tcgcccgaca
     3001 atattgtacc gattgcttca tctcggcggc gcactggctg ctgaacgcaa gcttctggct
     3061 cgtacctcgc ttgctgttcc tgtttggcta cattatggtt ctgtcttgga tcactctgct
     3121 gtgcatattc ctcgcactca gatgcatagg tgtatttcgt ggggcagaga tattcgacga
     3181 gccagcgggc cgcgaagctc agtagaatat tactccactt ctgcctctcc ctggtgtaga
     3241 tgtaccgtgt cgcttcccat tccatagtgt tcacgaacgc tcggccgcac gcacgccacc
     3301 aaggcgtatc gaacgcatcc accaattctt ccacgcgttc cagcaattcg tcccgttccg
     3361 tggcgctgga gcaagggaca agtgccatgt ttgcccgtct tcccgccgca cagcacgtcc
     3421 gtaggctgtc ggcactatac aaaggaggtc gccgctgcct ccaaggaaga ggagaacgca
     3481 cgcactttcc tctgcgcgct ccaattggaa aacgaggagt gttaaaacga caggaatccc
     3541 cggaggctct cattcggcaa agtcaggagc ggctcccaag tgtattctcc gaggatcgct
     3601 gggactgttt attagaaagc ccgtgcacgt catttttata catctatatc gaaaccgagt
     3661 gtgaaactcc agcgctatca tgtgtccggg gcttttcacc tacatcaccc ttacaggaat
     3721 ggtgatgcac gcagtgtccg ggaatccgcg tcagctcctg tgcaatgtca cccgttttcc
     3781 gggaaccaac gtgtctcagg tgcggctgag cgcgggcgac aatgtcacct ttctgtacaa
     3841 tgtgtcgcag ggccactctc tgacatggct gtactcgaac ctgaccgcga atagcagccg
     3901 acacctaagg aagtacacct tgtgcagtgt gacttctagc tataggatga ccgagacccg
     3961 caacaacatg tgcctgcact gtaaccgctc gagcctgacg ctctgctcgg cgagacccca
     4021 ggactcgggg ctgtatgtgt tacgcgatga gaccaataac actgatgtga tgcgctgtaa
     4081 tgtgactgtg accggcaatg gacagctgtc tgtcacgcac cgaccccaca gtcggcctac
     4141 ggtgacaaga atcagcagcg cgcacttgtc gggtatcact ctaggtcatg agaaacatcc
     4201 ccccaacacc tggaacacgt ggatggtcca catttcgttc gccaccatgg ccctggcttg
     4261 ctttggggta gcggtggttc tgtccggctg cgtgtgcctg cggtccgtgc gcgcctggac
     4321 tcagaagtat cggccgctaa atgaggaccc tgcgcctcag aagctcgatt ttccggatgg
     4381 gacgatgaaa gaacaccctc atgttactgt tatcgaacct acgaaaagtg cagacggcac
     4441 ggttgtgggt ttatcggcgg tgagcgatga taaacccgcc acactgtggc tgtcgaggtg
     4501 aaaatggaaa gtgaatgtgt gtatgtttcc aggaaatgac tgtcgttttc cacgaaataa
     4561 aggcgatgtg aaacgatgtc agtgtggact ggcgtgttgt gctttccatc atcagttatg
     4621 agaatctgaa tgcgtatgcg tgggagccaa ttgcgatacg tttatttgag atatggtgag
     4681 cctgtctcag attgtctacc tgactgtaat agcggctgat gatttagaca cagatctgtt
     4741 accgttaact ttcttggttc ttcgcaaatg gttgctaaca ttctgtacac gtcaccgtta
     4801 taccacaata ctaacgaaaa acgcggatac ataaaaacaa actaaacgat tattcggatt
     4861 gccatggtaa taaccattgt tatcctttat ttcttagtga aacctttgaa ttcaagtccc
     4921 gacatacata cgtatgcagt accaatcgga ggtaatgtca ctttgtcaga ctttaccaac
     4981 gacataacac attatatact tgggacatgg tactttacaa gttctttagg aatgtgccaa
     5041 atagatatca gtgataacga taggcatcgc aaattgtgca atatctttta tgcacaaaaa
     5101 gaatgtgaaa cgctaacatt atggagcgca tgcaaactag cgatacaaca ctcatgtaat
     5161 atgacaacat tgaccattta caatgtaaaa cattatacac ctaaagatta tacattgaaa
     5221 aagcgccata gaaattctac agaaaccaca caatactata ggattcaact tgtactccca
     5281 accacacaaa taccaaaaac caatactgtt atcttccccc cccccccaga aaacccaggt
     5341 gctttaactt ccgccaattc atcttataca actactatca ttgtaactgg tgtactatcc
     5401 atacttttgg ttatactggt cttaatgtat tgctataaaa acaaatcacc cagtcaacat
     5461 gaacactggt ataaaacact attctagtta tgtatgttat agtattatct ttatgtttcg
     5521 tgattcatct tgttcagaag atatttttta taattactca gcagtaaccg gtggatcagt
     5581 aacatttttt gacgtaactg ggttaaacgg attcgccaaa ggaacatggt attttctacc
     5641 tgcgaacgac agttgctatc ggacactgtt aacaaatgat gcgcttgcta aattgtgcag
     5701 catttattac catatagaac ttgcagactt gattacaaca acatcatcct gtccaacgta
     5761 cttcaatcat acatgtaaca taacatcctt aagtctctac aatatcagtg acaaagcacc
     5821 tacaagctac aaattggtaa aaaacacaga caggggaata aaaaatgtta cctattacaa
     5881 tttacacatt gtattattgg acaatgaatt cccttcccaa caagctcatc taacaagacc
     5941 acgagattcg ccgtacaata cgccaataat tgtgattgtt gtactgttaa ttgttattat
     6001 cgccatagtg tatatgcaat atagccacaa agaacaaaac tcaggaaaca aacggcatga
     6061 acttatacat ttcgaaatat aacattaaat catgtatctc catataatct tagaatatac
     6121 tgtagaagca aacaattatg tacataatca aatttacatt gtcaacaata atttcaggat
     6181 taggatattt acattatcgt aaaccattga gaatgcgacc cggacttata gaaacaatgt
     6241 agatatgacc caattatgct ttatgttcat atatattatc ctacaacaca catgttctag
     6301 tgctcaaaca atatcataca cagttatata tggtagtaac ataacattag agaaacccaa
     6361 aaacaacctt caagtatata catggtttta cagaaataca aacaaaggtg aatgcccatc
     6421 agacccagaa acagatatat ccacatacga agacattaaa ctatgtgaaa atgctagtaa
     6481 caaattacat agatataatc gaaagaaaca atgcatgcca gaacaatata actgcacgtc
     6541 agcaggacta cacctttaca acgtccataa tcagggaaca tctacatacc tgcttataca
     6601 acaagactct gaaaaatcac cacatgcaac cgcaaacact acctacattg ttaatattgt
     6661 ctcatctacc actcccacac tgtctcccaa tccaaccaca atgcacatcg ttacattagc
     6721 gggatctttt gcccaggtat cttcaaaaaa caaccacatt tccaccgttg tagtttcaat
     6781 tatccttact ttaatgctaa taacaggtct gagctgcttc tgttaccgaa gacaattgta
     6841 cagatatcta cgataaagcc cataatgacg accgaaccgg gcgctacagc ctctcttttt
     6901 ggagttgctc cagagttaga tgctatatat gtattagtaa ttattcttgt tatattatca
     6961 ctaattttgg aagtccagtg tattattcac tttttctatt atgcaagatc atttggctgc
     7021 tactgtcgaa aacgcacgcc acagcaacac caagaggtaa tgatggcatc cacctttcca
     7081 taaaagccaa gcacagaggc taagcgcgtc cgctacaaga tgaccgggac aatcatgata
     7141 gttttcatat ccctgggcgt catcggcgga ctctccctga tagtctttgg atccttctgc
     7201 ctttggaaac tatacgacag aatgcttcag tacttttaca aatacaaaag actgaaccct
     7261 atggaggcca gtgccataga acagtgactt tttttggaca ttgttcgagc tgcgacatac
     7321 caatatgctc gcaactcttt ttatctttgt gtgtttgctc atcgcgcgtc tgttaatgaa
     7381 ttttggatgc gagtgctttg acagattttg cgagaagctg cttgaacgat atgaacggca
     7441 cgaaagaatt gtgtgagtga cattgtatta ccactgcaac gtaagacgcc gtgagcgcca
     7501 taatggaagc aaaagctacg gaaaacaacc gttgaaagcg tttatcgagc attgtgcaat
     7561 atcatcaaac gaacatgacg aacttcacca tcgtaatcgt ggtgttctgc ttcatgttca
     7621 gtttggtatt cgggctgcta cttatcattt tgagtattct ctgctgcatc tgctatcgat
     7681 tgaaaagatg ggccagcgaa gtcagtgccg ccctcgccat gaagcagcag caacaacaat
     7741 cccgtatgat tatcatttga tacccatacg cgttacgcac caatatcccc cacccaccgc
     7801 cactatatca acacgctgtt aaagattgag cttccagtat gagccatccg agaatcgcaa
     7861 ttctcgggat tctcacaatg ggcaacgagg tcgtgttcat tgttatcgcc gttgtggcct
     7921 cgtttgtcgc ccttatcatg ggcattatac tggatctcat gtacctgcat gcatatcaga
     7981 aattttgcaa ctattactgc tgctgccctt ttcagagact gtcgatatac gatgcagagg
     8041 tcttggaaga gctcgaagtg taaaaggctg actatgtatg gaaacaacaa aaaagtgaca
     8101 cacggaattc cgattgtttt gtatttataa ctcagcatgc tctctcttta ttacaacccc
     8161 gggatcgaca tgctgttgca ccgagggtga ggaggaggat gatgaagagg aggaaggaga
     8221 tggtggtgac gaggaggacg aagacgacga gccgttgcgc gccttgagga gctcctcatc
     8281 gggaactcgg aacgcggcca acggacaccc cttgacgttg ctacagacta gagactgaat
     8341 agttgcgctc ttgacgatcc cgaaccccac gtctccgccg aaggtgctgg gcttccagta
     8401 ccccggggag cagatgacgt tcgccatgag gcctttgagg gagaacggag cccccaactc
     8461 gagaatgctc tcaccgaaga tggcgttggg acggggcttt tccaccaaga atccggtgta
     8521 cagctccaca gcctcgacgt ctccgtaaag ggccctgagt tcggcagcga tctccttttc
     8581 tcctgtttta ttaataaaaa ataacatgcc acgggcacat aatcaacaca ttttgcatcc
     8641 atattgtatg gacaaaaaca aataaaaaag actattgaaa atgtaatagc tgtcacctgt
     8701 gagttcttcg aacgactcgt agggttttaa cctgaaccgc tttctgtact ggttgaggga
     8761 ttgaaacctc atttcgcgac catgttctat agccgcccgg gagacccttc tgagggcggg
     8821 gggtacgttc ctgccgccag aaatctaggg agagaggagg gtggacaatg acaggtgatt
     8881 attaatttat tggtacatac acaaactacg tggagagaga tgattgaccg attcaacggc
     8941 acacttactc ggccggctat ttgtttcgtg aacgattcta ctagctgggt aatgccgtga
     9001 gtcatgagta tggaattgtt gtagacgaag ttaacgtagt catactttgt tttatcaatc
     9061 tcaaatgcat ccggcatgag agaatgccag tgatacaaca tgttaaactc ggaaaatata
     9121 cgattttggt actggaacga agtaccaaag agcagttcgg gcttaaacag cagctgaaaa
     9181 tggtagccgc tgagctgctg aacgtattgc gtcacgataa tgttgatggt ttccccgata
     9241 atgatgagtc gagtggtctg gaacagttgc tcgtcactcc attctggatg ttcttgtttc
     9301 agaacatcgc acaccctgtt gtgttccctg agccagatag tggcgtacat catgagccca
     9361 ggtaccaggc caaaagcctc ttgaccgaca gccagacgca tgttttcggg cacttcggga
     9421 ggatagatca tgtgcacctg gacgtctttg accgaggggg gatacatttc accgtcaatc
     9481 atctgatact tcatttttcc gtctttgaag agacgcagct tagtctgttt ttctggcgtc
     9541 tctccataga tgtggttgag atccacctag agatacagat cggtgaccgt gagaacgagt
     9601 atcctgacgt tgtgaaacag atggctaatt ggacaggaca cacattgttc ttaccccatg
     9661 tcccagtcct ttagtgaagg ccgggcctcg cgccaaatca gtcctaaaaa actggtgcgt
     9721 gaaatgttgg ccaaaaaagg caaacattaa gttggtgccc tggggatcgg gagtgaaggt
     9781 cctccgaaga agagtttttt ccacaacgtg tgccgcatcc ggcagctttg ttttacctgg
     9841 tgaacgagaa caattagcca ccgtgccagc gatgacaacg atcgcatggc gggcgcaccg
     9901 aggaaagtca cctttgaccc caacaggagt tggacaatcg tgaggaaccg gaggtagaat
     9961 ccttgcgtaa taggagagat tggagaaagc ttcccagctt gggtattcgt agtccgcgtt
    10021 gtatatggga gggctgtcaa tcaaatcgga tctacctgag ccagcaaaaa atagaatgat
    10081 aaaagcaaca attaggatga ttgacaaggg gaaggtagtc taagttcatt taatccatca
    10141 ggatgacatt acttactggt cagtatgtac cgcattaccg cgtggcggag gaaaggaata
    10201 ttgttgatca gccaccatat tgttgagaag tgagtcagcg tgtaatacac ggtatctgga
    10261 tcgggcttca ggagaagttt aatgcgagtt aataactcgg ctgtaaacaa aaatagaatg
    10321 ggaggacgcc atgatgacaa tatctgaata tggaacttcg taataaacat cagcatattc
    10381 tacaatctta cgagttgtgc agtcatggtc gtagaaaccc gtatgcgtgc aatcgcattt
    10441 gtactgatgg aaccccacgg tcatgcagat gcctctgttt tgacacggat gggagcaaca
    10501 agggttggct acgatgcgaa gagagagaga atgagagaca ataagtacga tgatgttttc
    10561 acccttatct agaatgtagt gtctttttga tacgtaccgg catgatttag aaaagtacag
    10621 taagagataa aggagaagaa gaaaaatatt ttgcgcatac tagcaccacc accgaggacc
    10681 cagtcgtcta cgactgaaga caccaatatt cgtggtatta tatatcggct tcaataaaat
    10741 aagacacgct aattgtttgt taatagcttt atttggtaaa ttgcttagtc aacattcatt
    10801 ccggaaaaag gagtgatata aacacttgac tccaagccac aagatggggc gagataagca
    10861 tgtatttgta cataacattc attatcttaa tgttcagcac tcgtgtcgag agcgtttctc
    10921 ttctgatcaa gaactatact gtgacatgga atagttccgt catcttgaaa gatgtggata
    10981 acaatacaat gaacaacttg ggtgaatggg cagcgtatct tgtcaataca acagtgtgtc
    11041 ccaacacgaa tgtgacattg tgtatgatta atccgcatct cttaccaaat aagacggata
    11101 accgaacaaa taacacacgc atatcacaat gcttaaacat gacaacgttt atttgtaaca
    11161 caactttaca gattacgaac attacaaacg aaacccatac agactacatg ttgacaagat
    11221 atcgcaattg cacaaatgga gataatagta atgagaacac tgagcccgag tatacacagt
    11281 ttcatttaga attcacaatg acaacgttac cgcccacaac tgttctacca acaacagcaa
    11341 tcgaaactac taccagtgga tacactacga catcagcatc atcagattta gaactaagta
    11401 aaagcttttc tatggcttca atcagtattc ccattattgt gtttgcggga ggcgggctac
    11461 tgcttggact cgggtattat gcttgcacac aaggatggta tccctgccgt acggaaacga
    11521 cgtcctcaac gcaaacagaa cgtttgctat cataaacctc cgcgtgcgcg gtttccagac
    11581 cgcaatgacc gttctctgct cgggaaatat gggaggagtt agcgagcaaa agctcatttt
    11641 gtataccatt gagcattaga agcggatcag ggaacgccgt tgtgccttgg cgtgctggac
    11701 gattgtcaag acggtgaatg tcacgaaaag cggacagaaa accagtgcca tgactaagta
    11761 cacgtgcttc aagtcgctgt ccacctgcgg catctttatg ctgctagtga acttgacatt
    11821 ggcgtgtgac tctcaatgtg cctgtaatag tagctgtggg ttcgcataca acgttaccca
    11881 cgtatccggc tacgaacata gcaacgtaac attgcacaca agcatcagcc acattaacat
    11941 atcaaacatg catatcggtc actggatacg ttacaactat ccggtgaact cgtatgcgtt
    12001 gtgtaccgtt tcgggcgaaa atgttgccag caccaagcat gacggctggt ccttcgagtg
    12061 caacggtacc agtttgacgt tgcacaacct gagcgccgat cagacgggga gctatatttt
    12121 taaaaaatat cctaggactg atggagcact ataccgtcac cgtgctacct attccaccgc
    12181 cgccggctcc tcaggtgact accgtaacca attgctcact tacctttttc agcgaacact
    12241 tctggcgaaa cgcaaccacg aggatcataa ccacgacaac gacgacgcaa aggacctcaa
    12301 caactaccac tactagcacc acaaaaccca cgacgacaac gcaccgtaca actgccggtc
    12361 gacttagcac ccccacgccc aaagaaagct ccacttcgac aactaccgag gagagtacca
    12421 ccaccacgtg gcctcccgga cgtccaaagt ttatttccaa gtattctaaa ctctcggtgt
    12481 atgcagcatg gacggccggg ctttttggta cggccctgtt catctttctc gtggtgtttg
    12541 tgtgcgcgct caggcacctt aataaaaaag aaggcgccct ctaccgaccg tcctcggatt
    12601 cctctgaaaa agacaacaag gaaaataaga agacgaaaac cacgcggtcc ggcgtgtacc
    12661 acctgctctc ttcagagaaa aagagtcctc aatcaacatc ttgcgctgtg aagtcaatgt
    12721 tttcttagag tagctactcg gtcccacccg gcattcgaac atgcgcgcgg atcgacaagc
    12781 taccctgaga agccattgcg agttttttag acgacgagcc acataataat ccagaccaac
    12841 ataatccaga tgacaatccc cagcagtacg cgcagaaaaa cgatcgcgtc ccaaacggta
    12901 acggtgccaa gcgggggcgg cggtgttgtg gggatgacga gcgaaacggc gtccatcgta
    12961 ccgcgacttc actgaaaaaa tgaaaggtga gactcagtgc ccgcggtaga aacacggtaa
    13021 ttatatctgt cataaataac ggaaacattt ggaccaaaga cagagaatga caacatggct
    13081 tcgattatgt atatcagaag cataaagacg acaagataaa cgagaaactc acacaagttt
    13141 gcgtgaaacg gtactgagga cacggaccac tatgaagacg caccttttca gactgatgtg
    13201 cgcctattcc atgatatttt ggccgattct ggcagcggaa aattcgacaa atagttcgtc
    13261 gaatgtcaac gcgacgactg aattaactac ggtatcaaca acacccagat cgacaaatag
    13321 ttcatgtctc aacaatacaa catggacaac gacgtatgga tcggcaagta cttcgcaaga
    13381 gaacactacg ccccctatat caacgacgga tacgagcaca tcacatacat caccaaatgc
    13441 ctcttttact tcaaacgtaa ctgtcacacc atatacaact gcgttaccaa atgaatcgac
    13501 gaatatgtca ataaatattt catacacaac aacgacctca ctaacaagta ctccaaaaat
    13561 aaacgtaacc acaccacccc catggccttt cgaaatgcat ggacactatt tcacactatg
    13621 ggtaaataac tgttattgtg gctatctgaa ggtcctccct ggaagtaatg taacctttaa
    13681 tgggacaaga actaacgaga gcgactcaat atggttttta gcgagatatt ttaattattg
    13741 gctttgcatt tttactgatg atgcaaatta tacaatggat tatatcaatt taacacatac
    13801 atgtacgtca gaaactatga ctttgtggaa cgtgatggaa ggcaattcgg ggatttattt
    13861 tcaacgacga acagataggc ataaatacga ttctacatat atctgttata tcctaaatgt
    13921 cacaacagat gctgctaaca ccacatatcc tgaaataacc agcacgaaat gtcaccgccc
    13981 accatggaaa aatcgtcccg actttgcaag cattgaagct catccaatta cccccgacta
    14041 tgaagagcta agtattcaag aacttttgga atcgttaagt gttaagggcg gtctgagagg
    14101 ctccttgctt aaatttgtac tccgattcgg atggttgtgc ggcattgtag ttggtgcaac
    14161 ggttacgctc attataattt tgaaactccc tcaaaaactg tgcttcctat ccagttttgt
    14221 accacaacat cgaggttaca aaagactgtc atctaatcag attctttaat tgtattacat
    14281 caaatccctc caagtgtata tattgcaata ttcaataaat ggactctttg gattaaacac
    14341 agctataacc atgcagatct caaggttggt ttatgcatct ctagctgtgt tctgggctgc
    14401 tgcagttata cacggacaga caagcgattc atcttccaaa acaacaacga ctctatgggc
    14461 aaataagaac agcacatcgc agccaaccac aatacaacta acgaccgaac cgacggcaag
    14521 tggatatcgc aatggttcac atcgaaacgg cacagcggca ccaccatgga caactattgc
    14581 agatgacaac acaaccacct tgcctccctg gcccattgaa atacagagca catacttttc
    14641 gctatgggtt aacggctgtt attgtggatc tttaagcgtt cttccaggag tcaacgtgac
    14701 actgaatagt actaaaaagc agaataacac cgagacacta tggtttcgat taggattttg
    14761 gactgattta ctctgcatct tctactttga caacgataat gactcagtaa aatacgacca
    14821 tttaaaattt acatgcacgc aaaacaacat cacactgtgg aatgtttcgg aaaaatattc
    14881 cggaatttac tgtgaacgcc aaatgtcatt gaccacatat aattctacat acatctgtta
    14941 caatctaacg gtgactgcag acgctaccaa tgcaacggag ccttcaatag tcacgacgaa
    15001 atgctaccgc agcagagaat actactatgc agacgatact tcagtgggaa cttcaactac
    15061 gagtgatagc gctctcaaca ttgacgaaat tttgaactca cgaaggcact ttcgggacaa
    15121 tattcagagt aatctgcttg gatctgtact tcaatttgga tggttgggtg tgattgtaat
    15181 cggatcaaca attaccctcg ctctagtgtt tcgtgtgcca caaaaattct gttatttgtt
    15241 ttatcgctgg aaacatagtt atcgcggcta cgaaaagata cctggtcaaa ttttgtaaac
    15301 attaacacac ggaataaact gtacatgtat tttgaataaa cattgtgcta taattatgaa
    15361 aatactaatg atgcttatat ttgtaatatg cgactcccaa accatttact tgcctacatg
    15421 tagtttgaaa acatgttgta taggcgatga tgtttcttta aactccaata taccaattgg
    15481 atgtaacata acaacgtggt atcgacataa aaacaatagt ggtgtaatgt tatgcagctt
    15541 ttcgggaggg ggtatgacgt ccagttctaa agaacgcatt aacagaactt gttcgcgtca
    15601 atcttttatt tttctcaaca ttcaactgcc atcaacagga acatactacg tcgtgggaaa
    15661 caattgcact acatcgccac ttatgtctac gtgttacaat gttacagttg aacccaggtc
    15721 taccactgct atgactgtta tgactcagaa tgtaaatata actgctatat tgccacaaca
    15781 tcttgcaagt aaatcgaatg caactacttt cgaaaatgag actgtaacgg tccacggtgc
    15841 ttggggactt gtcattgtcg cgttactttt cctgtgggtg gctattgagt tccgtctaca
    15901 tcaaaaagtg tgtgcgtatt tcagaaacta tgtaaccaca ttgtaattag tacacaaaac
    15961 atcagttata aataaaaatg tatactttaa acctggtaat gattatagta tatgtaatgg
    16021 ttactaaaac gttgttaatc gacgtatcaa catacctaag gtgtaaaagc gattttggaa
    16081 gttcgagaac ctgtacacaa caaaacaaaa gtgcctatac gggacaaaat gttaccctgg
    16141 gaataaacat gacaaaagac agatctgcct cttggcatcg caaaacaatt cagggaacga
    16201 tgcttttgtg tcaatattca gattcgacaa actgtaattc gtacaacgat atatgttatc
    16261 gatgtttatc aaattactct ttattacttc ttgatgttac atcacattac aatggtttat
    16321 actacttatc ctatctaaat gacaataatc agtacgccga tctgtgttac aatttaacga
    16381 ttaatataca attgaacata tcccaaacat tgataaatcg tacaaccata gaatgtatac
    16441 ctaaatctaa tatcaatata aacactgtaa aaaataaaaa tgtaaacaac aaacgaataa
    16501 caaatatcga atcgtataca aatcattcac ccaatataca atatacttgg atgcttttac
    16561 cattcataat aaccattgcg attgtattaa tttggaactt tatgcctaaa aagtacagcc
    16621 gattaaagag tcacagagaa tatacacgaa tacaatacta atggaaatct ccagggaata
    16681 tcgaattcaa tttgcttttg caaaaatgtt ttatttcaca acgcattgta tcttatctgt
    16741 atataacttt aacaataata aacatgtata tcttcaacat tgaattaatt attgtatacg
    16801 cataaaacga ttacatgtcc tggttaacct taataatact actaattttt ctagttatac
    16861 tatgctggtg cagtatacat caacaataca aatatcaacc atatacctgg gtattttgtt
    16921 tttacgaagc atgtactccg atacatcgtc ttcaaaaaaa ttaacttgta taccaattag
    16981 tagcaccgca ggacgcaacg tgactctaaa tccaccacca ttcaatcatc atactacata
    17041 tgtctactgg taccgacaga ttggcaaagg aacgaacgaa ttatgccgat acgttccaaa
    17101 taaacaagag aggaacgcca gaataaagtt tcaatgcctc aacaactaca gtttgttatt
    17161 gattaatgta acagcatcat acaatagtaa ctatacagtc aagctagatc tgggactagg
    17221 aacaatgtca attacttgtt atacattaac agtaaagaca actacgcaaa tggtaaagac
    17281 tacaaccaga aaaccaacta ccgcaacgtc gacaaccagc acaactaccg cgacaactat
    17341 acaaaccaca tttactacta aaagtcctaa tactaatgta cattcagatt ctgaccctga
    17401 agctatggta tcgctaaatg aaacaaacga aatgcagatc cgtgaacaca ccaatctgca
    17461 tgcaatatgg ctgttattac ctgtactaat agtaattatt tgttttttca ctgcaaactc
    17521 aaaaactacc gaactgtaag gtaacactgt tttaacaaaa atgctaatgc acatcgatgt
    17581 gcattagcaa tgaacaaaaa agggtctttt gtatggatta tgtggcacat tccacagttg
    17641 tatatatgtt atgtgacaaa tactaaatat gaaattgata acaatggtac gaatactagc
    17701 ttaggtaccc cgacatttga agcaattaca gcatccaaag tgtatattgc agtaccaaat
    17761 gtacatactg cacatgatga ttctaatccg gtcggatctc atggaaaagg acaaaacgac
    17821 gacgattacg caaacacaac gacagttatc atattggtaa tattatttat tgtaattatt
    17881 ttgctgtttt ttagaattcc acaacgatgt tgggaaggct accaaaagac aatggttaat
    17941 tcaccatatt gaagtaattt tgtgtatgac taagtaacgt tgaaaacact gtttgaacgt
    18001 tgaaaatgga tgtaggtcaa cctgtcaatc atgctcccaa cactgggaga gtatggttgg
    18061 ttcggataca ttggcgtaac gtgtttactt gtggtaactc aacttatcga cacatcaggt
    18121 cacaaatgct caaaaacaga aacaagaact ggaaccgtag gtactaacat cactctcgtt
    18181 actagtccac cccctaacaa caaaggactg ttgtactggt acaaacccaa ctgtaccagc
    18241 aatgatagat tgtgtgacta ctcagggttt actggtaata atgccgtctc taacaaaacg
    18301 aagttgaaat tttcctgcat gaacaattca acgaaactga ctcttattaa cgttacggct
    18361 cactattctg gtcaatattg tagtagaacc attacatcga atggaagcgt cgatatctgc
    18421 tttaatgtaa ctatacatct gcatacaacc ccagctccat ctcctttacc tgtccctttt
    18481 caaacaatac caggatggaa tcatcacacc accatccttc aggtacaaat accttcaagt
    18541 ggccagccag gtagctatga aagtcagcaa caagacgcgg cacacattgc cagtattttg
    18601 atattacttc tactatttat cgctatcata atcttgttct ttctaaagat cccccaaaaa
    18661 ctgtgggaaa aataccacaa aggtaaacgt gcaccatctg cctaacaaaa tgcatttcgg
    18721 gcatatactg tggaaagcac ttttcgtact aatcccttta atatatgtta atatggccgc
    18781 tgaatgcaaa tcaaccgaac atcatcgaga attagaagat gattgcgtta aatttacagt
    18841 accacaacct gatccaggac tttcccatta ttggtatcgc ccaaactgca cgacccgaga
    18901 catgttgtgt tacaaaacac ccagtggaga ggttgagctt aaagcacaaa atcgagacat
    18961 accatatata tgtctggaaa acagtactga gctactgtgg tgtaatgcat ggcaaaatca
    19021 ttccggaata tactgtcata gtgtttttac accatccaat gatggaataa atagagttga
    19081 tacatgtttt aacttaacaa ttactcccaa gacaaccaca acgaaaaaaa caaccacaaa
    19141 aaagacgaca accacaacta cactagcatc caaattgaag actcgcagca caccagtgat
    19201 aaaaaagcca catatagatg gtacaccccc accgtcacat aacaaaccat cacttcaaaa
    19261 accaccgtta aaaacacaag tacacacgac cctaactact ttactacaat catatccatc
    19321 tttaactacc acaccaggct acgaagtagt gcagcatact ccagaaaaac aggtacaaaa
    19381 tgtcacacac ctcgcaacta ttgtggtcct catagttgtg tttgttggca tagtcactct
    19441 tttcatattc aaaattccac aaaaactatg gagaaaacat aaagctaaaa cacatgcgcc
    19501 ttttttggaa cgggactatg attactagaa tataggaaag tccaatagca agcgcacacg
    19561 aaacgatcta ctatcacgta atcgtttctc ttcgttacta atatcacctg taccagctgt
    19621 gtaatgaata gtacaggtga agtttaaagc gcatcataaa ttacaaattc caatgaatct
    19681 cacatggaca cgtcttatat tattatcgaa tcaattacag atgatttgga ctttagattg
    19741 tacgataacg aaaattgtta caacacaatc tggtgctaat gtgcgacttg gagactcatc
    19801 tcgccaagga aacatcgttt ggcaccaacc accatgtaac aacgaacaag acgtgttatg
    19861 taacaaaaca tcaagaagcg aggaaatgtt atttataaac aaatctattt catttatgtg
    19921 cgagcagaag tccaacatgt tgaatttgcg tggattaacg cccggtaatt cagggcaata
    19981 ttgtaagaca atatccacta caaggaatgg taagaaagag agctatcgag aatgctacaa
    20041 tttaacggtc atatctaaca tcaaatcaac aacaccaaca attatgacaa cacaacagga
    20101 aacatcctca catagaacat caaatgtaac aacaccttca agatttctag gaagaaccgt
    20161 caataacaaa cgagagagat acgatgacct cgcacccgca ttggaacttg taggctttct
    20221 attttttatc actattgttg tattgttttg cttgcgaaca gagctattcg agggtgtgta
    20281 acatgaacat atacatgcac aaatacatac ttcaatggaa catagccata tcattagttc
    20341 atacgtgcat tcaaagtgca tatccatgta aaattacatc tctcattaat gttacagctt
    20401 atgaaactgt agttttgaat gccactctag cactggacaa atgcttcata atgtggtaca
    20461 aaagcccaac agaaggaatg tgtcaataca atgcatcaca cgcaatgaaa gcaagtagct
    20521 acaatggtaa actaaattac acttgcacat attatacatt aaccatattc catgcgaact
    20581 catcggccac agggatgtat tatacgcttg gtgcacctaa cgatgaatgt gttcgagaaa
    20641 aaatatgtta taaagtacag gtacagttta cagtacaaca tgaatcactt attgtcacac
    20701 aaattagccc cttactccaa attaatcact caatgtccga atctaccata atatggtata
    20761 tatttgtagc ttcagggcta ttcataatca tcttttatct agccaaaaat gcccattcat
    20821 actggaagca tggacattac cgcgtgcccc aaatatggtg gatacaggtg aatgaacctg
    20881 aagcataccg tgccatgatt tcctagagcc ccagttgact gttttactac atcggttttt
    20941 aaaccgaata aaacatggat aaatttggcc atcacaaact atgctcgaac agcgttaccg
    21001 tgttacatac aaatgtcaaa ttattctcgt ttccatattg gcatttatca ttaacctaca
    21061 ttgctctttc tatgtaagca aagcaatcaa tgtcagaaca ggagacaacg ttactctaaa
    21121 cgctacatta aagttagaaa atggaattgg tttttggtat tacaataaca aaacactctg
    21181 taaatgcact tcaaaaaatc cagaatccgt ttcccgacca cctctacaat tttcatgtaa
    21241 tcgaaattgt acactactcc tttttaatat gaccagtcat aacgctggag actattgtct
    21301 aatgactgaa ccaatatccg aaaatgaaaa gaacgtatcg tgttacaatg taactgtttt
    21361 gccaaccaac tttaactcaa ctataactac ccaatctcca ttgtcaatca tggtaacgac
    21421 aacgcctgtg ttgactacga caacgcgaac tacaccactt atcaccaatg gaactaagaa
    21481 aaatagaaac aagctcggtt ccactaaagc ccctacgact gcactacatt caagtaaacc
    21541 tttgctaacg acggtaacca ctactgctgc taccacagta ccgttgacta gttcaactac
    21601 tgtaactact accgctcata ccgcattaac tactggaata gcgccattaa ctactgtgac
    21661 tactacacgt aacgcattaa gcactggcat agtgcaatta actactgtga ctactaccgc
    21721 taagactgca tcgcccgaca gcaaaacgca ctctaatatc caaaatgctg caactactag
    21781 tgtccatact actgaaggga acactactgc cctaacaaca aatagcaaac ccgcaactac
    21841 cttacccacg acaacttatt ctacggtacc tcccacaaca gtagctaccg catctacgct
    21901 ttccacaaca ctacccacca ctaggtggta caccacgtca actagtacct ccacaaaaca
    21961 gcgaaacaca caaacctcct cctaccaaac aaccacgcct ctcctgaact ctcctacacc
    22021 aacgacaagt agtcaaaacg aaacaaagtc tccacacgtt aaacaccata acgctcatca
    22081 tcaccatgcc gtcacacacg ccttttgggt tatcctgtta atcgtagtta tagtaattat
    22141 cattttgtgg tggaataaga ttccgcaaag actatttcaa cactatcagg aacaaaagta
    22201 tggtggcgta gcgttgagcg atgattggca gttctactaa atgaccttga aaccaggaac
    22261 tctagcaaac tcgcgaacta catattgtca ctccgttaaa gaaaccgttc tcaaatcaac
    22321 gtctccaccc cgtccagggg ccgcctccaa gggcgatggc caggcacaga tgccataaat
    22381 gctggctcct gtggctgacg gtgattctgg gaagctggat acacttgctc aatgctctgg
    22441 aaattgtaga ggaatacgtg gaagaacagg agataatcat gcaaacaaca agacagatgg
    22501 cgttaagatt ggcagctgcg cctgttcgtg gacgacgaca ggagattgac ggcagaccgc
    22561 catctatccc gtcatggcta gatgttcggt ctccaagacc tccgagacgc cacgatgaaa
    22621 acaccatgca acgtaacatt cgttggcaac atgaacagat gcaagttttg atgagcttgc
    22681 accattcccg gatgcaagct cgaggctgga atcctgatca acgtactcca gacagacttc
    22741 cagctcattt tggacgctct gcttcgggtt ctcggcctgt tccaattcaa agaattggta
    22801 catcgacaag accaacaccg atggcagaag aagccgagga acctagagta acaattgtcc
    22861 gcaacagacg tccagacaat tcgagtcccg gaccgcgtct tccacacaaa agacgcaatg
    22921 ctgtcacttt cacgggatct acggattccc tggatctcac aagactgcgc cttagctacg
    22981 aaaggcgtca ccgcaaagga tactatcgtt ggaaacatca tgggaaacgt tcacccacag
    23041 taaaggccca cataccacca cccagaccaa caatttcgga tcccatggaa ttccgaccag
    23101 cgccatcacc tgttccacaa agacgtaccc tgaatgaacg cttcaacgac ttgcttcgca
    23161 gacacagcgc tcatgagaac atcaggcaca agtggcatgt gcgacctaaa gatgaccccg
    23221 tctggatcta taatgacggt gaatctgaag tcacatctat cggagaacga gcaagccttc
    23281 tcacaagaac ccgctcatgg atccaaagcc atatgcaccg cacatacact tggcgtcttg
    23341 gaagctcagg gggcggcaat gaacctttgg tgagatcatt atcgacagag cagccacgca
    23401 acaacaacgc caatcaatca agactccatt caccatcaga atccgtgcaa gtgaatctcg
    23461 agaccggaga agttgtagtt acatgtcaca acacgggagc aaatgaacaa caacatgtgt
    23521 tgacatccaa tcaactatgc agcagaaact ccatggaagt gaccgatgca tgcgacagag
    23581 aaactccacg tcgagcgctg ttgggttcca gcatagctct ctggctctcc ggtatgtgga
    23641 tgcggcacta ccgtaagtcg tcctaagatc accttgacat tgcatgatcc agaggtgagt
    23701 gaatcggtga aggtgggaga gggtcttgca ttttttctct ctataaccta gtgatccgca
    23761 ccacccaggt gatcatgcta aggacatcgc tgccagtaaa ctctgcatat tagctcattg
    23821 ggtcccgccc cagcaccacc ctaacctttt ggaatagaat atatatctaa cattgaaaac
    23881 actaagattt caccgaacat agattatttt gtccaccaac cgcactcaaa tacaaccagt
    23941 atgtacttca tcattgtatt gctgatcact atactaacta ttgattgcgt cccccctgcc
    24001 tactgggacc aattcctgca tccatcaatg gacaatggcg aagtatcggc tcccctgatg
    24061 ccaccgtatg gggatcgctt caacctaaca tgtgactttc caaccggtga ttggagcgaa
    24121 gcggcgttgc agattcgttt ttgctaccac cccagctgcc gcagctttct catggtaaca
    24181 cccaaggaca ttaacgggga gtttaaaaac aaaagtgaca atcatctgcc ggagttgcag
    24241 tggaaattag agaccgtcgg ccccgtacag agactgactg tgtcatttct agttgtcagc
    24301 agtgtatctg gcatttacag gtgtaccatt ctaactggaa taaacataga ggtgttgaag
    24361 accgtgatca tcatcgcaga tgtggagcta cgccgacgac ctgacacgta ctgcgatatc
    24421 aggttcagcc atctgtccca gttgcaatac ctatggaccc ccaaccctga taaggtgagg
    24481 ctgctaaact gtggagaggt tcgagaaagg aacagtctat ggcaaaaaca cgtacattac
    24541 gcggtaggta tgtctggctt ggagccatct tgtacagtga acagagatat ggtgttgtgt
    24601 catcggtatg tggctgagag tctgagagac aataactgca cgagggctgc cgaagagaaa
    24661 cgcgcaatga ttctacgcgg taagccgctc gaggaggact ggttttggat gtgtatggca
    24721 ggcatgttca ccgtatgtat cgtgggcatc ctgacactgt gtttgagact ccggtacaag
    24781 agacatcttg actggagtca cgatctggag agtgaggaga cgagaagacg gaggttgaaa
    24841 aagagaaact gaggagttgg cattttttaa gttgtgggtt ttggaaagcg aataaatgag
    24901 gtagctagaa aaagccatgc gtctgtataa gctagtgatt ctttttaatg ctatgtaaaa
    24961 atcatggtgt caaaggtgac gggatattga ttataatgtg aaagtgtgaa tctaacctga
    25021 tcggggacat ggaaggtggg agggggaagt atgtgttgat tatttcctaa ataaaacatt
    25081 tatactgtta aagaaactcc atgcgtgttt gtcgttattt tttattatga aaaggctatc
    25141 cccacatgac aacttctcat gggtacacaa atggaacaat atgtcaaacg caggtgataa
    25201 tatctatccg cacactgaca atctgtcatc cgaggagcac ataaacttgg tccaagcgcc
    25261 actgccgcca tgggcaaccg aaaacgacag tctccaggaa cgcatcagca tatttatact
    25321 gtgcgttgcc gtggtgctgt ttttttgttt tcgaatccct cagagaatgt ggtggttctt
    25381 tcgttccaga cccgtccgtc attccgggaa ctgctaatcc ctattccgcg aaacgggttt
    25441 gcgtaaggga tagtgtttca gaatgagagc gaggcgtgcc tgccatctga tttcccagaa
    25501 atgcctcctc cccgcgagcg catggcgact atattggccg ccatcgggat aatgttaatt
    25561 tttctattgt ggggcatgcg aatcccccac acctttttcc ggcagtggaa acgtgatccg
    25621 ggggactacc gaatcagcga ccgccaggaa cttggcgatt acagcgtgat gcaatctgat
    25681 ttccgaagca cgctataaaa atattaagtc ccgtagcctg gccgtgattc aagccgctgc
    25741 agcctgatca ccaaacgggg aaaatggagc acgctctgtt cgaccacttc ttcggacgcc
    25801 cccgcgtaag tgtctccagg cactccctgt tgagagccga gaacgagtgt gatgatgatg
    25861 aagaataccc cccgatcccg cgggtaccgc aagtgccgcc acgagtatcg cagacgaccc
    25921 gagcagcctg gaacatcgta gacgtctgcc gcctccttcc attgcatatg agattgatgg
    25981 tagccgaaga agaggagaag atgacgctca caacatctcc aagaacgcac aaaaagaaac
    26041 cccgaaaatt cgttgagatc agtcccagaa tacggcgttt atttacttaa atcgaagaat
    26101 gattgacagg tgaagcggag cgcctttctg agtttataca ataaatccgc ctgattcaat
    26161 catgttggca ttcgtgtgtt ttatttgggt ataattctgg tgtctgaatt agaaaatgag
    26221 tgtgattgta atcgtaaata tgcaatcagc acgctcacgc tatccgacgg ccactcctac
    26281 ctggtctgat ataaatgtaa cgtgaatttc ataatcgctt catatcaccg tgtaacattc
    26341 acacggcatt atcaaattaa ttactaacag aagagctgcg ccacctgccg gtggtttttt
    26401 aaatctacag gcatcatgtc ccagctgcta tacgaatgtt ttaaacgaca gctgcctagg
    26461 aaaccaacaa acagtgtgct tttcctaaac cgcagagcgc tgaccggcaa aacagaaaag
    26521 atgacgtcta tggcaaccag cacacaccga acactgctag ttgttgatca tggtaaactg
    26581 aggctagaaa gacccagcac ctcggagacc acccagacgg ccttggcatt gtcgttgcag
    26641 cgatttgcac tccagtcatc tggggatgat ccggaacagg acgatatgga caacaatgac
    26701 tgattacgga atgcaaacgg caatgcgatg tgccttgtca ctcatgtgcg tcaatggaga
    26761 tttcgaaata ccagagacaa tgacctttaa aaacaaaaca ccgtcaagaa gatgcactgc
    26821 atcaacatgc cgctgaggac cttggccagc tgccttgtgt tcctcacgct gttcgtgtac
    26881 ctgcacagtg attatgtgta cgtatctgtg ttgacccgct cgcatggact aacatggacc
    26941 agcgtaggcg ctgtgaacga gacagatgcc aataatttat ccaattacag ctttactcaa
    27001 accaacgttt cagatagtag taataattca tcaaacggaa atggcagcgt gacagaaatg
    27061 cctgcaaatt gtcttctgcg aagtaatgcg tacgtgtcaa ccatctggat tttcaactgc
    27121 accaacgata cgacaccaac aatgactgaa ttctggtacc tcggacatgg ttacaatcac
    27181 agcaatgaaa gctgtaaatc atctctggtt aattacctga acagcatgtg caccatttgg
    27241 accaattaca gcgatggagc caactcctca cgtaaagatc acctgagcac aaccgaagta
    27301 cgctgtcttc ttcctgaaag ctattctgtg aacaccacca tccatcaata caacgacacc
    27361 aacacggagt cggaaaatca aggttcaaaa tatcatgaga tgttccccat tcaacataca
    27421 tgcagcttgg tggaggcgct ggcctttgac atcgtcgaga gatacgtgta catctcaaga
    27481 ttatgttgga accttgccca gatattcgca ctgctgtgta ttgtgactgt cagccttgtg
    27541 gtttggatac ggttccagta ttgcggtaaa attccttgta tgtgcctact acctcccaac
    27601 gtctcagccg ttcctacgtg tcaagacgtc atcgtggaga gcagtgtcaa tcaacccgaa
    27661 gaagacaaca catctctaaa cagccccgtg gaaccagagt cttcagaaat cactcccatt
    27721 ctatctgctt ctgaaaaaac ctgtgtccag aaaccatctg tgccaccgaa accaccaacc
    27781 gtatcttctc agttcaaggt gatgcatgct ctcaataaac catgcatgtt gccaaaaccg
    27841 ccaccgaagc ctacatcgct ccagtctcca aaaccagacg tgtttacgtt tgacgagcag
    27901 gacattcaaa agcacaaaga agaaatatcc caacaacagg ttaaaccaaa gcgtattcct
    27961 gttttaccac atccaacatc aacactgacc aggactacac acgccccaag attgccgccg
    28021 cctcctcggc aagcaacatt ctcaccacgg gcacctacaa tgattccgtg ggacagaaag
    28081 agtcagatgt caccggtaga gtattcctca tggagacagc aatctgaatc gctgcctgca
    28141 gaactggacc catggaatgt aaacccgcac aggtggctgt gacctgacat gatcggatcc
    28201 gcaaaaaaga ctgacactac aatatattgc aagatagata tagtgtataa ttgtgtaaat
    28261 aaagttatat ttgataatat acaaatttaa gcgtgcgctt cattattggc gtccggcaga
    28321 cgaaacacga atcggggtct gggattgcga ttctccactt gggctcgaat ctcttccatg
    28381 acgaggatca tgggctcccc cataagtggc aggtcatcat ctagatccat aggaatttcc
    28441 accacttcag ccacctcggg aatctgtagc ggttgaatct ggatctgctg tcgttgcaga
    28501 tagttctgaa acagccgtct gcgagcccgg ggagcgtaca tgccgagcgg acgatgagcg
    28561 ggttgattga ctcgcataaa agatactcgt atagagggca taagccctcg tatggcctcc
    28621 gtgaggagcg gatcggtgct gccgcccatg atacgccagc atggcagccc tcagaaacca
    28681 ccgttcctaa atactactct aggtctgacg tcagggtgaa atatcgccaa tttcacctgc
    28741 aaaaccgtac ctatacaaag ctacgccccg tcattggtcc tctgacacaa ggtatttaat
    28801 gggacgagag ccaggaaccg cctcatttga ctccagtcca acagcagcat catgcaggac
    28861 atgaagctga tagcgattct gctggcgatc ggtctggtgg cagtgcacgc cctccccagg
    28921 tgagttactg aaccgtaata cggataggtg ttccagagta caaacatggt ttttcgtgta
    28981 ctatacaagt gacgttttgt ctttttacag atataccaca caagacaaag atggaataac
    29041 ggggacagat gtaggaaatc cagacgtgac ccagggagac gactctggcg tgtctaaaat
    29101 tcccataaca cttgagggtg atgacctccc gtcaggggac gatagtacgg aagaaggcag
    29161 tggagatgaa atccctgcat acgatgtatt cattgaaggt gaaatgaatg atggagacaa
    29221 ctctgaagaa tctgacgaag gttctacaga agactaaccg cagtgctgcc agtttcccct
    29281 tttttgtatg acaaccacct aataaaatgt ctatcgtaat gtctgtgtat gcgtcatgtc
    29341 ccttcatgcg ccggttacct acaaatatga tccgcaagaa gcatttacca tggttacaaa
    29401 caactatgcc tggttcggaa ctcagcagag ctagatcggt gctagctatt atcgcaatta
    29461 taatgttagc aatatgcaat ttttacaggt gagtaaggct gccctagaaa taagaactgt
    29521 tattgaaagt gcaatgttca tactttgctg ttctctattg tgcagctacg gatttccagc
    29581 tactcatcct gacccgccac atgagaggaa cccggaagac attgatgagc cacaaatgga
    29641 atgattataa aaaaataaat ctttattgat tacaagtatg cgtaccgttt tttctttatt
    29701 gcatgaaaat aagggtaaga taggaatctc agaacaagct tgcttatgtg gaaatgtgaa
    29761 cggagctgca gctgatgcgc tgggaacgac gacaaatgct ctttcgatca tagatatgcg
    29821 ttttaccata aggacagact aaattcccgc ttagcttgcg catcttctta tcgccataga
    29881 aaacggtgct ccagcggtat cgaacaagcc cgcgcatggc aaactccatg accgtgtcag
    29941 ccaccacgca cacgctattc tctgtggtag cgtaaatgcg caggtacgaa tccgcaaaga
    30001 tgctgatcag cctgtccgcg atcgctatgc gacccacggg ctccactttg gtagtaccca
    30061 ccatgcgtcg ccagtagtac agatccagtc gactgaaact ggtaggcaga gacacacaca
    30121 acatgttccc gtcacccagt ctcatcaaac tgctggcgtg catattgcgc cactcgcaga
    30181 gatcattgag gttctcacag atgaccagcc gtcgcgtctc tttcttcttc agcacattgg
    30241 cgttaggcac gaccatgaaa ctgcatcttc tgagtccgtg caccagaaag tcctctatgt
    30301 catcggcgat ccacgtgaga gcatcggagt acaccacatc cacatagagg tagacgttac
    30361 ccgactgtcc gacatacaat tcggaaggcg gagtgccttc acgatgcttc aaaaaagcct
    30421 tggtgcagac gctgccgaca aagtgtagtt tttcagggca gcacagatac tgtgacagac
    30481 gctcttcctc cttttcagca tttcgaaccg agcgccaacg acgcagaact accagaacac
    30541 gatctttagg ccacggcagg tgtatgcgtt ggcccgattt ccatttgctt ctgttggcgc
    30601 cgcttcctct gcagcacgta ccccaagtgt accagcaaaa cattgtgacg agccccacag
    30661 agggaaagga tccagctggc atagttgctt tatacaagca cgtcagacgt gttccattgt
    30721 gcaaccagct gacgtatgtc agtcatcgtc gtcgtgctgg cggcctctgg gacactcggg
    30781 cacagtgtcg tgtaattcac gatctccagt gaatcgccga ttattcaaca gctgccgtag
    30841 ccccaagcac atgaatgcgg tcaaatcgtc ggcgagacga atgtagcgga gattgacgag
    30901 gtcgaggcag aacacgcggc cgccatccac caggacaatg ggaactctgg tcacgggcca
    30961 tctcacatag catggagacg agggcacctc gcctttcaga tccacggtac ccaaacagat
    31021 gacctggtca ccaaaatggc tccgaagcga gcgcagcatg aacccgctgg tcgaggtcac
    31081 ttcaaaacac ttgagattgc acaatctcag acaggctccc tcaggataag gcagctgaag
    31141 atagttgccg tgattacgcg ttacataacg cgacacggcc tcgggaccag atttccaagc
    31201 attcctaata cgcctaaaag agcgcttgag ggcggatgag cgtacgtgac gaggacagta
    31261 aaggacatcc acggcccgga gacccacccg ctgaagctcc gagaggttct tggccacata
    31321 gtacagcgag aaatcttctt ccacatagca aaaaacctgt ccctcttctg atactagaat
    31381 gatgagggtg gtctttcgct gtccgtgcac cagcacaggt tctccaacga cacgccccag
    31441 gaacgccaga cgcgtctgac agcagaggta gtagccgaga cgtttgatgt cctcggcagt
    31501 gtagtcatca tcagcttcca gttcctgcag caccaggtac caaccgcgag gccaggggag
    31561 cgcaatcttc tgacccgaat tgagccgcac ataggcctcc acgcaaccca gcccgaactc
    31621 aacactcata gcgagacttt ctatatcgct catgggttgg cacgccatct cgccgcaaga
    31681 ctttacacta tataacgcct cagacgcttg ccacacagca ccctggacgt cgcaatgtac
    31741 accaagcgtg ggcaacagcg tcgctcgcac gagggagccg ggcggcttta tacctttgat
    31801 gatttggagg atgaggtgtt tcttgaccca atcccccgcg ccccagccaa tgaattggac
    31861 gaaatggact tgatggaagc cggtttgtta tcttccagca gtcaatccga taacaaatca
    31921 tctttcgaag tcgtctccga gacagacagc ggctccgaag cggaggcgga gcgcggccgg
    31981 cgcgcgggaa tggccagtcg caataagccc accaagcccc cccgtaggaa taaaacaaca
    32041 caatttccaa cggggcgcgt tgccagcgaa ccagtaatca gtgcagtcag cagcgaagac
    32101 gaggaagcaa tcacgcagag ccaggaagag gaggaggacg acgaagaaga agacgacctt
    32161 gacgagggtc aggagacaac cctagggcaa cgtacggtca ctatatttcg tcagatatac
    32221 tttgaacgtt cactagcgcg taacctgggc ttcgaaccca ccttgatttc ccctccaaac
    32281 accgaattcc tcaagttcct tttgtacgat ttttccgtgc aacacgtcac ccgagtcaat
    32341 caatgcatac ccatgcccgc ctttctgctc acgagtctca ttaaccccat cgcgaaaaca
    32401 acttcagctg gcgaacgcga tctgacgcgc ggaatcgtca cccatgcggt cttggtaaac
    32461 tacttttacc aggccaagac caaagttcga agcatgcaat gctctctgaa cgctaccatc
    32521 catgggcaaa ccatgaataa catagcaacc tatgttacta atttaacacc aggtgggcgc
    32581 gcggccgccc tagctcttca ttttctcatg cctcaaaaag cagttatgac aaaacaatac
    32641 caggcatgcc ttcggcgact aaccgaggaa ctccgcaaac gccgcgtcac ggagtcgccc
    32701 agcaccttag aaatcctaga gaccattcgc gattacaatc taatatttcc catagctcca
    32761 tacactaacc ggggggcact gtacctgtac cgcaacaatt tgcagaaatt atctaacggg
    32821 tacaggaatg tgctaaaatt gctctcgagc gagaaactaa atgaagagca ctttgtgaat
    32881 gacttggcat ttatgattgg ggcccaatta atgcttatcc agtttgaaca aacacttcac
    32941 gtcctccgcg catacatagt gcaccacctc cataacctgg ctactctaat ttacataata
    33001 tatgtacaat ttccttctct tcggggcgac tacattcaag tgaccgaggc catctatcgc
    33061 gccgttacta gtcatagcga tgaacctctg tttcaggtca acacatggct gtttgattat
    33121 ctcagggcag taagaaactt ggaagccgtg gtgtgtccag attacatgat gtgtgccctt
    33181 cgtcagtgga ctacagtcca cgaggacaat ccaatcacag actacatgtt tcatgatccg
    33241 gccatacaag actcacgcat acgttgcggg gacactcaaa ccaaactttt ggttcgcaac
    33301 ttgtgcttta cacgtatgca agggcgcccc acctcccgcc agactcccgt ggagcacgtg
    33361 ctcgtaccca ccgcctccct caacaggcca tacctaagat gtaattccac ggaagagagg
    33421 gaagtaaaca gtcaccgcaa tctgacgttg cgatcgttct tagaaaccaa tggcaatcac
    33481 cccatgagcc agctacaata aaaaatataa caaaatcttt attgattggg catgaataat
    33541 atacacatat gcacacattt tttatgtaga tgacgaggat gaggttccag cccttccgct
    33601 gctttttcgt gcacccgact ccgattgagg aggagaataa tcaagggctg gtgtaaataa
    33661 agatgatgac ataattccac tggcaaacat ctcttgcgtg agttcttctg ggtcctcccc
    33721 ttctaccatc gcgttctgtc gcctcaaaca gggtcgggta accagagagg ccgacacatc
    33781 gctctccgaa cgacttcctc tcctgagtcc tctccgctga gagtgctgca acgctcccgc
    33841 tcgagctcgc cttacgtcat caaagtaacc ttctcgcacg ccttccttga gcaattcgga
    33901 taacgagttg gccgccttca ccacatagtt gtgctcacca atctcataac agaatatgcc
    33961 accgcaccca cctatagcgg ccaccggtcg gtcccaagtg aacatctcat cagtaccaat
    34021 ggtgccaatc acacgcaact gtcccttcat gagcggcaga agcctccagt aactaaagtc
    34081 cctgggagtg agaatagtgt catcctcgtc gcagacgaat agcgtataac ctctagggta
    34141 gggcaagtca aagtgacggc ctctattccg tcgcacataa tcttcgacat taaaaacgca
    34201 cccagcttct cggctggtgg ccatcctgat tgttctggtg ccaatgacat cattctgctt
    34261 ttgattgatt tcatattgca caaccgccca cctcgtgtgg tcgaaaacga cgaacataca
    34321 gccggtggag cttttcaatg tgtccctgat accgcaccgt gaccgtggcg ctggtcggga
    34381 tttcaaaagg cgccttgcgg cgacaacggt tggcgttgtt actgagctcg cagtctgcca
    34441 gaagcgagtc gaaagtcatt aagatacccg gatccaaagt cacgtcacca tgacgaaaat
    34501 aataccaagc cagtttttcg cccttccgcg tctccgcgga tggacactca taaacgcggc
    34561 gcagtctcag cagatgcaac aggactaatt cgcgcttgat ggtcagcgaa atgcactgat
    34621 agtcaggaat cttgttaact atcttaatga aatcacaaaa ggtttctaag aagttggaaa
    34681 cggtgaaatg aatgtgcttc agatcgtgaa tgtgccgcct aaagcgggac agctccatgc
    34741 gctgtgccgc attctgtgct aaccctttgc ggatgatgga cgcctcgtaa cgaaacatcc
    34801 tgataagaaa agcgacatct ttacataaag cacgcacaca agcactatgt tcatggcgaa
    34861 tagtgatata aagcagcctg atgactttta gagccagaac agcattagac atcaagtaca
    34921 tagcatagcc ttcacaggga gtgccgcagg acagccccac cggcaataaa aagtaatcgt
    34981 ctaccagagt atgtgaccag tccgtaaatc cgaggtccct agccacgctc tgctgcacac
    35041 gcagctgctc agcagctgtc aggtgacgaa tagcagggag atggaacttt cccagatgag
    35101 cattgtgaag caaagtgagc tcggcgtcct ccagccgagg ctggggagga gaaggctcat
    35161 cttccgatgg tgttgcttgg gtatcggatg atgctgcgaa caaatcgtgg cagtcaccgc
    35221 acgtgcaaaa gcgcgcgtaa agagtgtgta atgcggcttc ggcacgcaga ccaaatcgag
    35281 aattaaaaaa cacagcattc ttttggacgc ggtaattaac aggaagtttc ttacataggt
    35341 gagagggcaa acacttttga attaaatccc tatcactggc atccaaaaac agacacacgg
    35401 tacccgccag gcgccggaac agttcttcgg taatgacaca aagctggcgc agatagtgag
    35461 ttttattgcc aaaaaccttg tagtttagga gggtagacac agcgtactgt ccagtggcta
    35521 cggctagcgc aatcctcttt ccgctcttgc tgatctctgg cagaaacgga cccgccgcca
    35581 cgagccttcg aaactgcatg aggttcatcc agtgaaagtg tccgggatcg ggtctaagcg
    35641 gcacgccgcg taacagaccc cagacagcta gatcggtttg aagactcaga cctcgaatat
    35701 tgtacttgcc gtgcgccgtg gcaaatttgg agttcaccag aaagctacga cgtatgtaga
    35761 taatgggact ctttttagaa ctctccgcat tctgggccac cagtgtattg cggggccttt
    35821 tggttaaaga agaagagtca acagggaaca agccggcgag agcggcctcg cgcagactgc
    35881 gcaccggcgt gagataggtc cgcacaaaat tgtggcagaa atcatcgtcc ggacagtcag
    35941 cgacaaactc gaaagcggca tgctgatcag agtaaatgtc atccagcggt ggattcgctg
    36001 tcatgcttgc gcgctcgcgg cgtagtgatg aatcttaact atatacccta agtaactggg
    36061 atgtctgcca agctacaaaa aaagcgtttc aaggcgccgc agctacagat tcgtcgtgca
    36121 acagactgcg attcgagtaa acgtattcac tcacgtcgca gaactgtgct ttctgactgc
    36181 tgacgggcat cgacacggag cccagaggag aaaaacagaa gcgacgagag cagcgaaacc
    36241 agaatgagcc ctgtctgata aagccccgga gcgtttcggc caatttcagc atcaccgtgc
    36301 cgtagagcag cacatgcaca cagccattgg tgtccagaaa gacagcctta ttgaccggct
    36361 cgatccagcc aatgacagcg tatttggccc tctcaagaat tccgatcaca aatcggttgg
    36421 cctcgtccgc ctcagctaca ttccaggaac cgaaagtgaa agtgcatgcc ggccgaccac
    36481 ccaagcgaac cttggttcca gcatgcaatt gacagaaacg cacgactgcc ttgcggtcat
    36541 gcaacacttg agacaggtca tacatgctag tgaaattgtg ttcataccaa gcaccctcca
    36601 caatctcgtc cacatattcc cgttcaaagt agctgcagac ggcaaaaagg ccggtctcaa
    36661 agagttcgtg gaacgacacc gccaacacat aaaccttgtc ttccaaaggc atgtagcaga
    36721 acacgtgtcc atgattggaa acccaaacct caggcgactg tgccgcttgg ggtgaacatt
    36781 cataaactgt gatgacaccc aagaaatata acctagaagc ttctcgaaag cagcagaagc
    36841 gttgataggt cttcctatcg cgcgtcaccc caaagtactt gagatcaccc aggagaatgc
    36901 cgtgcagggg gggccaagcg agaggcagcc agcgccccgc attcgcgcgg acgaaacgct
    36961 gaagatgcag accgccgggg cgctctcgag accgtccgcg tgtgttgatc caagcgtccc
    37021 gcagacctcg ccaatacgcg gtgaacctag gctgtcctcg cagatagagc gccgtcagcg
    37081 gctcaaagtg tcccagcacc atcctgtagg ggacaaggaa gcaatacaag atttcaataa
    37141 atttagcaaa aaccacacat cggataggat ttttgtttcc ctgcgagatt tttgttaaaa
    37201 atgaatttta cccatgtatt gtttcttgtc cctaccttcg cttcttgaac ggcagcgtgg
    37261 tgcccggata gagctcgtag agcgtgtgac gacccacggg tccaatgttt tcgtaacgat
    37321 aatcatcaat cagcggacac agtccgatgc gcacaaaggt tttcaggtca cgcgccaagc
    37381 gcgtgaggcg ctcctgaccc accagcgcca catacacaat gccagaatct ccgcagaaaa
    37441 ccttgacccg ctggaaaaat gttttattcc cttccccttc aatgaccccc agaagcaaaa
    37501 tgggttcgcg accatagctg aacctttgca agcgccgtat ggcgataggc gacatttcca
    37561 aatcctgagc attggccacc aacacataat ggttctccgg ccagatgagt gacagcttgg
    37621 cgttacgatg ttcctccaca taccgactcc tatgctcgtt gtcggggcag tccaggagct
    37681 gtctgaaaca cagcaacgag tgcaagtaac gttcgcgcgt gctaatgcga gaacgctcac
    37741 acatttcgac tttttgcgcc gatggcaagg gagaaacatc cggctgcatg cgccggcaga
    37801 tggtctcgtg cacgggatcg catctaatca tacccctgac aaaaaagtca ttgaggtccg
    37861 aagccacctc gtacagacag tcctctttag cgtcataaac aatgacagcc ccacaaggat
    37921 ccagaaacac agggtacttg ttggtgtaat gcgacacggt ccccaggggt tgcagaacac
    37981 gagactcccc gaaaaagtca ttctgacagt gctcgagatc aatgtctgta atggcgtacg
    38041 gcgagtacat gccgccgacc acaaacgcgc actgagcggg ccatcccaac gacacacacg
    38101 agccctcgaa acgcatgaga tagcgtttga ggccttctga gtcacgtctc atacagagtt
    38161 cagacaagct gcgcgaacag aacgtttcgg gcgccgccgc tctcttccgt cgaaccaagc
    38221 gcggtcgact ctcgtcaccc atgatgcaca cgcctttcac ctcggctcgc tcagcgaaaa
    38281 gtgtaaactg caaatgagcg aggatccgcg cgacactagc aacctttata gcccatcatc
    38341 atcccacaga ggcgaaacaa acaacagcac acttgaactt tttcgtctag catttcatct
    38401 ttatttaact ctgcatcaac ctcatgtcga gccgtatccc aaaacacaga ctgatcttcg
    38461 gaagataaag tatcataata ctcgagcatt cgggaagcat ctgccacggc tacgctcccc
    38521 cgcataaaac gcttcaaact ttccatatgc cgctgacgct ccgacatcat ttcaacctcc
    38581 ataacagatg caatcgcgct tcagattctg ccgcgcccgt ctcagctgct gcaaacgtcg
    38641 atgctgtact cctaagtcca cctcccgatt gaaatcgtct tggtcacgaa tagacagagt
    38701 gctataaaat tcgcaaaagg cctcgatacc gtccatatct agctggggtt taagacacca
    38761 tctcactcgc atatcccaga agtacaccca ttgaatgctt cgagcggccg tgctgacagc
    38821 ctttgaacga cgtttacaag tcggaaagct acccgtgatt tggaacctga tcttatatag
    38881 ataacaggat gtccgtccct gtaaatgtcg accccgcaac ccaatcatcg gccgtggagg
    38941 agttacccaa gccctcatca ccatccaccg ttgtcgtttc atcgtcgtca tcatcatctt
    39001 cctcatctcc ttcgcccacc aaaataatac agccgccgcc tcaacaacta ttgccccaag
    39061 caccgcaacc gggaaacatc gtagttgtcc ccgcacctgg cccggatcca gattatagac
    39121 tacccgacct tcgagtggtg cggctatggc tagaaactct caaaaccgca gacagagaca
    39181 actttggtcg ctgcgtgcga catgcgaaaa cgcaccgcac cgcttaccac ttgacagcgt
    39241 acgagccgta cctcatcgcc ctgaccgatc agtacaacgg cacgccttcc gtgacagaga
    39301 aggcttcgta tctgcacggc tgtctgtttc tgtcattccc tgtgatttac aacaacacac
    39361 agggaagcat gtacaagcat gactggagca acgtagcggt tccgcgaacc atgctacgcg
    39421 aactgttttt tctgctgtgt tctaccagcg aaagcccggc catctttcag cctatcatta
    39481 ccaagggagg cacgtgcgcc tccatggtgg tgtatcccga cgagacggcc agtaatttca
    39541 ccaatcccca acacattggt ttcgtataca gcaaactggt catgattccc tttgttccac
    39601 acgcattccc atcgtacggt gttcccttcc tgaccttacc aactcacatg cgttactgct
    39661 ggatcgaaga agcgcctttc ggtcatgcta cgctgacgcg ctacaacgat catatgctgt
    39721 tccacgtaga acacttaacg tggacaagca agaggattac taatcatgga cagaagaaaa
    39781 tgtcacgata cacggctcaa ttcaagggca tgctaccaga cacgtatctt aatgggactc
    39841 atgtttggac atcttccaag aacatccagt atgaattcat gggattgctt tttaccatca
    39901 acatcgacac cttgtgtttg gatctgcatc acgggcaatg catcggatcc atttcgagtt
    39961 cctactgcca ccgtgtggcg gacaaattaa cagccagaaa catgcctcga tcattcgttt
    40021 tttatttact gattgagaat caacaacaat gtactgtaca gttcaatcgt aatccgtatt
    40081 tgtttttcag cggcgacggg tttaacagcc cgctgctgaa cgaacccagt cccttctatc
    40141 taacagttca cgctccctac gacatcaatt ttggacagaa cgctcggcag acggtggaga
    40201 tcgacattcg ctacgcgcac acgggcggac ggtgttttct ggtcgccaac ctgccgtacg
    40261 aagactcctt ctacaccggc atgtgcgtgt ggcaggcgga tgcactgaag ataactctct
    40321 ggtcgcgctt acgtaccacc attattcccc aagggactcc cattgccgtg ttgtatcaaa
    40381 tcaacgagac ggatggcaac ctgtacgcgt ataatcacaa cacggttttc cgtcaagtga
    40441 accacgccga aagcacggcc ttttacctta gcgatctgaa gctccctacg aataacttcc
    40501 taacctcgcc ctaaaatata aaatttattc ctcatttatt ctcgagtctt ctttaatttt
    40561 ttctataata gcttgaacgc tatctggaac gggtatagtg cctgatgagt catctagcaa
    40621 atcttttaac ttagattcct cagtaggttt gggagtgttt ctaggtgagg ttaaaggctc
    40681 cgctttcatt ttttgtgcgc gtccacccgg aacctcagta gaagaggcag tctgtgtttt
    40741 tgttgatgtt gtggtagtta aaccgggcgt gaacgtttga gttggcgttg tcgtcgggac
    40801 cttcacgata gttacatctt tcccggaccc aggcgcagaa aaatttgcag gtttaatgac
    40861 actgccatct aacgtaatag gcgtagcctt aattactttt ctaggtttaa gaacactcgt
    40921 gcttggcgac gtgacagacg taaacggacc caaactaggc ttaggctttg gtacattctt
    40981 cttggttttt ggcttcaaaa ttaaccgacg ttttgccttt ggatctgaca caggaggaac
    41041 gggagtagca ggaggaatag atgccacact aaccaccgat tcggcatcag acaccccttc
    41101 ttcgtcacca tccccagaag caatatcttc atattcactc tcacttattt ctgcttcgct
    41161 tttcacctcg cgtctcttgt taggtgaaaa actactttca cgatcactgt aatctgaacc
    41221 aggtggtgtc tttctctcac gatccgacat attatctata tcggaaacct cttttaacgg
    41281 ggtctcaagt ccaggtattg cttctgatga acccgttgtg aataaaggat tcgaaaactg
    41341 agtagcaaac ggggaattta gtaacggcgt ctgaataaat ttcggaagtt caaacttgta
    41401 tgtagatgta gacggtttat catcatcgtc aagttttagg cttcctaaac ccccatcaaa
    41461 atctactaag gtgtctactt ttacatcgtc agtttcctct tttgtgcgac cctgattttc
    41521 atcgtccgac caaaacgtta cgcgtttact aacagggtga ggggttttag gcttcgtatc
    41581 ccacaattgg gacgatgtta gtttttgagt aggtgacaac aggctaaaag catattgtct
    41641 ttcactcttg tctggcactt tgcgttcttg tttcttggtg gtaaacaact gattatcatc
    41701 gtcatcatct ttagtctgtc gcccttccca accacctctc aaccattttt cccactcgcg
    41761 atgcagttct tcgtcgtcat actctaaaga aaagggatcg ccaaaggtct gactgacaga
    41821 ctgtgggaaa atatcctcgt aaattgcaaa atcctccatc agcatctcca gcaacatatc
    41881 ggccgattca ccgtccgaaa ccttatgttt gataatattg gagcagtaat tagattcaaa
    41941 agacctgcaa gatcgcagct ccttcatcaa tgtcttacat atctccttaa tcttaatgag
    42001 acacttttcg gccaacatgt cccaggaagt tctgacatgg acaatcactt ttccgagata
    42061 gatgagtttg ttagtggcgt ttaccaaaga actattggag tgacgctcca gatgaagctt
    42121 cactggccgt atttcgaaca tattgttaga tatagctagt aaagaatctt ctaaagccat
    42181 gacgtctttc tgacgaagtt gaataaattc tatctcacca gtgcccaaag gctgacactc
    42241 agacaacttt gccaaggccg ttgcacctat catggcattc tgaattacat caacatccgt
    42301 ccgagaatcg tcgccaaaac cggtggcctc caaagttcgc aggtgaggcc gagcctttac
    42361 tggatcccgg aagggataca tgtgtgctcg acgagtgaca gcattagcgt gaacctcaaa
    42421 ctcatctaaa agcgatgata aatcaggaat gtgatatcgt aattccctat agtaggccaa
    42481 ccagaggact aattggttga acagacagct ccgtctgtgc aaaaatcttt cgccgcattt
    42541 tcggaggatt ttaggatgct gctctaaatc tacgttctct ttagtcggca gggtctttaa
    42601 aaagttagtg atggcagtca ctttacgagg cggcagcccg ataaacttta aactcatgat
    42661 tgtcagccac agaaaccgga aattttacga gctacggctg tttcagcgtt ctgctatccg
    42721 tccaggcagg ttatggaaac cattcttcac aaccgaacgg tgagtgatat ttgaggcagt
    42781 ttaatagcca acactcgtaa cgtctcggaa gctgataagt ttcgtttttt cacagacaaa
    42841 caatgaaggt attttgaaca tcaacaccac ctgcaatgtg accgactcgc tgcacgccgc
    42901 caagctaggc gaggccctcg ttaacagcgc gctatcttta ttcggtaccc ccctcaacgc
    42961 catcgtcctt gtcacacagc tattggccaa ccgagttcat ggatactcca ccccgattat
    43021 ctacatgacc aatctctact ctgccaattt tctcaccttg atagtgctac ctttcattgt
    43081 tttaaacaac caacaccttt tgactgccag tgcgataacc tgtaaatttc tctccctctt
    43141 atactactct agttgcagtg taggcttcgc tacagtggca ctgatcgcag ccgaccgata
    43201 ccgagtgatt catcgccgaa ctcaagctcg ccaatcttac cgcaacacat atctgatagt
    43261 aggattaaca tggctaattg gttttatttg cgctacccca gggggagtat acacaaccat
    43321 tgtatcccac cgcgacggag aaaatgatgt ccaagcacat actacttgta tcatgcactt
    43381 tgcatacgat gatgtgtacg tcctcatggt gtggaaactt ttaattgttt tagtatgggg
    43441 cgtagtgcca gttatcatga tgagctggtt ctacgccttc ttctacaaca ctgtacagag
    43501 aacagccaaa aaacaacagc gcacgttgaa attcgtaaaa gtcctacttc tgtcattcat
    43561 catcatccaa actccctatg tatcaatgat gatctttaac acatatgcca ccgtcggatg
    43621 gtcgctggag tgcgaggatc tgactaagcg ccgagtcatc aacacattct ctcgcctcgt
    43681 ccccaatcta cattgcgtgg tcaaccccat cctctacgct ctaatgggaa atgacttcgt
    43741 gaccaaagtg ggccaatgct tccgggggga actcacgaac cgtcgaactt ttctacgttc
    43801 caagcaacaa gcccgtaact cagatgatgt accgacaatt gtcagtcaac aacccgccac
    43861 acctaccatc gtcaataagg ccgaaaaaga cccgcacgta aaacgcggtg tatctttcag
    43921 cgtcagcgca tcttccgaac tcgcagcggc caaaaaagcc aaagccaaag ccaagcggct
    43981 ttccatgtcc caccaaaacc tacgtctgac gtgaattttc ctagaggctg cctccgcgag
    44041 tttacataca tatctcggta cttgctacac ttgatcactt tactgcggac accacggcca
    44101 atcgcatcgg gtaggagtgg cgatacggca ttataacgaa acgccggctg gtgccacacg
    44161 ccactctgat agattgccgt gagtcttttt ctcaaacgtt aggatatccg cattcgagat
    44221 gacgatgaat ataatcatta ctacccgaga cttctccaac gacgaatctg tggtggagac
    44281 ggcggaactc cacaacagcg tcgccaattc catttccaaa gcttacagag gtacgatccg
    44341 cgcagagggc aagaagaaat tgctgattcg caacttgcca gccgcacctg ggtgcactcg
    44401 acgcaacagt aatttattta ttttttgcca cgaccgggac tatcgaaaat ttcaccaggg
    44461 catcgtgcag ttaaagcgca cccgcagcca agtagacccc tccgacatcg tgaacgtgac
    44521 taagaacata aaatgtcgct tacaaccgca caatcaagat ccaccgttat ttgccggaca
    44581 gcttcagaac accatcgcac acgtctgtac cctgttcaac cagctggtgt tcacggccca
    44641 acttcgacat tactgcgaga accacgagcg agtcgtactg tacgcacgag acgagctaac
    44701 ccggcgctgc ggagacaaat ccacgctggg catacacatc tatcaactca tttcactgtt
    44761 ggaccaagac cgtcacagcg aactgtgcca tgtactcgtt ggcttgctgc accaaacgcc
    44821 ccacatgtgg gcccgatcga tccgccttat gggccgatta agaaattacc tgcagcagag
    44881 gtttctgcac attctggtgg aaagcggact ccaggttgat agtattttcg agagttgcta
    44941 ccacagcgag gcataccggc tgctgtttca gatcgacaaa acgaatcaaa cgcctcgctc
    45001 tcttacctat tcagctaacg ttctgcctgt catcgaaaac gaaactgaag ctacacctgt
    45061 cccgccgtgt atttaatgaa ataataaaat gttttctatg aataaataag ttttggtttc
    45121 gtttttgaaa gagctaccat gagtctcccc ccgtcgatcc cagccctgcc cgtagacgct
    45181 agtctaaacc ttcgcccgga cttgttttcc gatgagcacc gccgcttgtt ggtcgatata
    45241 ctgactcagg gttgcggagg ctacgtgggt ctgttgtgtt acggacttcc catgcctagc
    45301 tatgtactag aaactctgat tgactttcaa atcaaaacaa tatataccaa aattaagcag
    45361 attgccaata gcgttatcag aatatgtatc ttggctaatt atctaaaaaa cagccaggat
    45421 ctactggtag atctgcaagc taacctagac gaaataaact caggcgcgaa caaacagaga
    45481 ttatatcgcg gactacacag aatatgtcgc caaacaaaca tgatggatgt gtatcgaaac
    45541 gtaagtcaac tgctagatgc cggggacgta accatgggtg tgtacagaca gggcctggcg
    45601 cagatgcgtg cgctcacaga agcgttggat ctacatcgag aacccaattt acaaccgcta
    45661 tacgaaacgc tcaccagcta caacctcctg taccttcccc cgccgtatct aagcgccgcc
    45721 gctgtagaaa tatacagcga aaatctcggc gatctaacaa aacgcattaa ccggtcgttc
    45781 aacttgcaga cgcagattaa cagatcgaaa cgagccgact atgtggtaaa cgatgtactg
    45841 tttctgctat cggcccgaca tttacaattt cgccatagac tggaactaca gatactggag
    45901 acctggatcg tgaataaatg caactaccta tgtaatgacc tgtatttcgc atacgtccag
    45961 gttccggaat gtcgcagcac gttctgtaac tttgtaagcg gtttacaagt cgtccgcaaa
    46021 gaacgtcatc cgacattccg tcccttacta cacaacctct gtagcctttt gaatacattt
    46081 cacgaagcca acgtgtacct ctgcccccaa tatttacata gcgccatctt tctactgcta
    46141 cggagagtgt ccagagtcag agagggcgac tcttcagact cggattctga aaaccaggaa
    46201 gcagcagaag accgagacac tctgctaaga cgctttcgag agggagacct cgacctcgaa
    46261 gtggatccta cctccacccc tttacaaaac ttttactttg ccaaaaaccc ttttggaaat
    46321 tcggaactct ttcgtattcc agaacaagca agtcgctacc ttcgccgcaa cgcgtggata
    46381 gaccgaagca acttaacata catatcctac aaactccaca acgggacatt atctgaagag
    46441 cctttcccaa tgcgaaactt gtacagcctt attatggaag gcgcttcgcg acaagcgggt
    46501 actaacgcca gacagtttat ggcagctcta caacaagcac ccttaggaca cgatgagccc
    46561 gaagcagcgg atcatagcga tttgtttgcc gatgtggaca ttcgacccgc acaaccgtcc
    46621 tcagggtcct ctgcctcatt gtcaacacct tcaacgtctt ccgccccctc cggccaaccc
    46681 tctcccagca gactcggacc tgaacaaccg cctcgtcaga gacgttatct cagtttgagc
    46741 aacttttcac cctattcagt ggctcgtcat catcatcggc gacggcggcc gcgtcctcct
    46801 cgaggaccgg ctcacacctc gcggcaagga ccagacattg ctgcctcggc ctcagcttct
    46861 ggaggcgagg accccagaga cagtttggca gaagaactgg aacaattgta ggtgtgtgta
    46921 taagcatgca tgaaaacttt acaaacacgt ttgtatgata tgtaataaaa actttatttt
    46981 gtatatattg tcgttatgtg gtgatttatt gctacacatc atcaaacaaa catgttacac
    47041 ataagaaact ctagcacgac ccattccgcg tccggagcga aacaatcgga ggcgccgact
    47101 agacacacac cgcgtgcaca cggtgtcatc aaaaagatat cctcggactg tttcttcgcg
    47161 atctgaatcg ttgtcttccg cgagtccaac aaacgacata tcaaaagctc gcatgtccgc
    47221 aatattgccg agcatttttg atctcacatc ttccatgtcg tagatcagag aaggtagcaa
    47281 aggtgaatcg gaaagggctt caagatgctg aggccagaac ttttgagtga cagacgagtc
    47341 ccgcatcatc atgtccacac cgaatctgat atcggctttt atggcttcat aaatgcccac
    47401 aacgatatcg gcctccgttt tgggcggttt ttcgtcttca ctgtcatcat tgaacatgat
    47461 catgggatca ctgggttctt cgccatgcat acaatacggg accttttcca acctaacgat
    47521 agctgcgcgt tttctatcat gtctgtgatt ccggtaaccc tttcttccca tcatgcaggt
    47581 aaacattcgc atatcctcag ctaggcgata gatggagttt agggcgggat caaagccata
    47641 aattgtaccg aacttgtcaa ctagtacata gagcctaact aggaactcat ttttttcttt
    47701 gcggaagcaa cctagcaccc cgagcaactg attaacacac actatacggg ccacgcaacg
    47761 caccatgatt tcaaaggaac gcagccctga aggtgacatg agactaaaag aagtgtcttg
    47821 aaaattggcc actgcagtgt cactggacca caaggcaaaa tgactatcta cttgttcacc
    47881 caggggatcc ctaatatcgt agacgcggta accgttcttc gcaaccacgt ccgatattct
    47941 gtccacatcc cagttgaaga tcatgagctc cttcataatt tcatcacact caatcacagg
    48001 ttcctgataa agctccattt tttggagata gtcacaacga cgtagcccga gttggatgaa
    48061 ggacttcatg tcaggtgcca gacaatacac gcacttttcg gtttcttcat aacagtagat
    48121 agcaccgctt cgaccgatca gcatgacgag ctggtagaaa cttagcttcg aaagctccac
    48181 cactccaaac ggttccatga gttcgttgca gcacacgtac tttcctgata acagaaaagt
    48241 actgttagtt gtcaattacc atccatccct ttaaccccta ccctccctaa ccaacaatcc
    48301 tcaccttggc agcacacatc gtaatacttg gagctgaatg gtcccatgag agtgcgggga
    48361 cgtagctgga catagccatt gtcgggccaa gcaagatgca atttggttcc acattcctga
    48421 tccacaaatg tgtataagct agcaggatct tgagcgcgca ctgcgatgca gccatatgcc
    48481 atcaaagtat cccgaagatc gtccatgccc gacatcaacc ggtaactcat acgacaaagc
    48541 tgaggttatg tttgttgacg aaccacgttg agttcactga actgtgacca agcgacatct
    48601 ctcactattt atacataatt ctccaactca gtcacaaaaa tctgctgact cattaatgta
    48661 gaaaagttta gatttctgag ccgcgcgaat ctcccgtcgc gcagcatgca tctcctggat
    48721 atcggctcgt atatgccgtt gactgcgtcc caaaaaccca gcaaacagag ccaccaaaat
    48781 gaaagcaccc aacgcgacag aagaaatgct gaataatccc caggcacaca atgtcagttt
    48841 cgaagagaca actttagaag accacagctg catgacttgt gtccacgtgg gccattccaa
    48901 tacgccgtaa gtggcgttat ccgcgtagtc ctgatcagtg atgtttaccg gacttgcttc
    48961 aaacttcttc agacggtata taagacgtat gcagacgtca ctcaaaaaat aacgatcagt
    49021 gtccagatgt ttttccagcc atgtagaaac gtaccctttc acagttgaat tttcagcttc
    49081 tgtagagttc ccctgttgcc acttacagtt agtgtttcgg cgatctgcgc ttgtcgccga
    49141 tagcacatgc tgtccccagg cctgactttg taacacaatt ttgccctgtg tcacgttgcg
    49201 actggaatcg ttgcaaatac attgcaacat tcccgtaaaa gatgtggaca gattgctaag
    49261 catatacagg cgatacataa ttcgcccgcc tagataatat tgaagaccaa tgttcagtat
    49321 catactatgc caaacacgac gtctctttgg aaatgtcatg ttgagtctca gcttatccac
    49381 cgccaaatga caaggtcctt gatagatgag cgtcccattg taagtgcagt tcaattcaca
    49441 tttcatggta tcattcacat cacccccata ctggcattcc agagacaatc ctttgactct
    49501 ccaccacagt gccaggagag cgaggcaaac ctacacgtca aagaatggag tcaataccac
    49561 ataacactct tcacacacgc atattcatgt cacacaaagt gaagattacc tgccaagcgc
    49621 agtaccttcc catcatcact caaaacaatg agacacatga atgcaggtga agaacaaagt
    49681 gctttattac aaatgcagtg cataatgatt gacagcaggc gtgtctacca gccagaaaca
    49741 aactgcgttt tacagagatg cagcgccctc catcgttagg tccacaatag actcatcact
    49801 atcagagtca tcatcaggat gtgcgttaac ctttttcgga tcaggagtag ggagcgaaca
    49861 ctgccgagtc agtgcctttt tactgtccac gcccctctca ggctcttgga cactcggagt
    49921 cggaggagtt acgggaatca cgttggccat caggctatct ctatccacga acggcaccgg
    49981 aatcttgccc tcccggacac gtctttcggc gtccagcagg gctcgcacat atccgcagag
    50041 aaatctggca aacgtccgag gactgttctg attcttctgt ctgcgggctt ccaatacgtc
    50101 tcgctggtgg tacacctggt tgaaaatcac aatgagatcg tccacagatt tggcatactg
    50161 cctaacccgg tgcctgacct ctaagggaaa gatgccattc cagtactcaa aaacgatggg
    50221 agctgtccaa aactcggaca tggtcggtgc catgaagaac aggattccag tatcataggc
    50281 gtaaatgtca tagttatcac tcataaacag caccacctgt ctggagggtc gaggagcagc
    50341 ctcgtcccaa gcctcgataa ctccaaacat agttaaggca tgactcaggg gcggacaatt
    50401 gcgctccagc caaccgattt tacaaaggtt aatccccaga aacgtgtacg tatgatcaca
    50461 tatgcacacg gtaacgccaa attcatgctt aatatgtgca tcacacgcca taagcttctt
    50521 cacttgagcc ctgagcgcgg tcttgcccag cacagaagcc tgaatgagac tacctatgtt
    50581 catctgattc tgttgcatct tctgttcctg atcgtattct gcagaagtag ccataatgat
    50641 gttttcttac cagctacttc gtctgtgatg cgtaactaat cttcactgcg cttcagccga
    50701 ccgagacttc tcttcagcac acaaaatgcc tcccggacca gaccggcgat accgtctgcg
    50761 ggggacagag cagtctcttg ttcttcttct tccaattctc ctcgttgccg cttcacttct
    50821 ctcagatact ccttgaacca gggaggcaga ggaggaccct gatttcgctt gcgctcaatc
    50881 cactggtagc taagaatgcc aaaagccacc ataccaagag cacccgcgca gttcacatac
    50941 tgaataggga tggcaggcat ggtgaaagcc tgtctgagca gtgaacactg ttcatcttat
    51001 atacacacag gtctcgcatc ccggacgtga cggccgctgg tcgcaacaaa gaggcacatg
    51061 acacttgacg gattggaaaa ggtgatgata gaaaataccc tacgtatgaa aaccacacta
    51121 ttgaccgcaa acacgacagt aaatactcgg tttacgtcta tttgtatgca gcaacggtaa
    51181 gtaaagcatg acacacgttt tcaatttctc catttcccca atccgcgttt ataattttgc
    51241 gaataaaaca cagactcatc acaaatgttc agaatcatac ttgttttttt attaacaaaa
    51301 tctggttagc ttatggaatg gttatcattt cagaagtcat cgctttcaag acacccaggt
    51361 acagtgaggc cagtatatac acacacaggg agtcaaagcc cagagacgca gcaggataaa
    51421 gtcccaaata gcgaataaag tccaccagtc tggagtttgc ttcacaagaa agcaagttga
    51481 tgcccccctt gcatgtagtc cgaggaacat gtccgtttgc atgccgcaca ctgctgacga
    51541 tggcactgga cagcgaccca ttctgacagc ggtcttcgtt tcgcgcagtg tagttggtga
    51601 ccgaagattc caaggtaatt cccgataagc agtagagtcc tgtcagaggc acattgagta
    51661 cacggggttc attcactccg ggtatgtaca gcgatccaaa gtacgccggc atacagtctg
    51721 tatatccgta tttatttatc ggctgcgata cccccaaagc caccgtaaac agcagactta
    51781 ggcatcccac caccagaagc agagtcctag gagccatcac catcaccacg gtgagcagca
    51841 tagcgcgctg tgagtgaagg gtgccaagta tgagcgctta aaaagtcttg ttccaaaagg
    51901 ttgcacaata gtaatgattc agaactcaat gtccttagta ctaagcggct tcttttccca
    51961 cactatgtcc tcttcttcct catccgtggt tagtaaatgc tgatattttt tccgagacca
    52021 cacggtcttc atgagacagg caaatatcaa aagaaagagc cccaagacga aacaccccac
    52081 ccccaccagc caaggacacg gtagaaaata gttctgtcgg agctcagtga aactggcatt
    52141 acaccacaaa agcatcatgt tgaagagtgt cacgatgacc tcagccttcg cattccccag
    52201 tgacaaaaga cacagagaca gtttgtagtg acagttatag tattattgac gcaacaggca
    52261 agcacagtcc ggtttgattt ttcaatagct caacccttat ttttgttcaa aaccaaaata
    52321 acggagacca aaacggtcaa caggatgatc cctaatagag agaccacaaa gaccactata
    52381 gtacatttcc atccatcatc gtagtacgct tccaccgggg ggtgcatgtt agctggaaac
    52441 tctgtcatgt ccatacgaaa attatcagga cgcggaggga cttccccgac gaccgcatga
    52501 tacggaggag gggggctgtc agggggtgca gctgttgttg tgagtcctat tctatcgcgg
    52561 cgcggctgag taggtaaatc acgaggacga ggcggcgagc ccacgatttc atcataagcg
    52621 ggaggtctaa catcttcact gtcgttacgg ggcgatgatt cattcgtcgc tgacatgttt
    52681 tgaaccggga cagaaaaatc ttcccttctg cttttggctg cgagtttgct tgcggcaaaa
    52741 aggttcccga gggcacgtgt tgcacaggta agctggcggg atgttgcaat gcttcttgtg
    52801 gcgaacgcac tggcgacaga agtattgctg atttcccagt cgcagaacgc cgaccctgaa
    52861 gaacgccggg agactgctgg ctaagtactc aacgcgcttg gtgtctggat tgaccgcaaa
    52921 aactctgagc tgctcgttga ccacaatggg aatgtcgatc aatttctggc gccagagcat
    52981 ggagagcacg aaaatgtgca gcacgttgac tgagccagta tcttttatcc actcctggtg
    53041 cgccggattt tcgtaggtac gctctccctc caccacctca gcgaggtaga tgttctcggt
    53101 gcacgtccag gaaaattcct ttcccgcgtt tctctggcag agtcgccaga cgcccatcag
    53161 atcagtagga atttcaaact caagggccag cgaatcacca aaactgtaac ggacgggtcc
    53221 cagtttttcc ctcagaggag gatatttcat gagaccctcc gtgagaagag aatgaaaacc
    53281 ggtgcgcgaa atcagttgca cgctgtcaca atttttatcg tgcacataca cgcgcccccc
    53341 ctcgctgagc aaaagaatga aaacattgcc agaggttaaa gcctcctcgc cattgctcac
    53401 cgtgcccaca ggtatcaaaa acttatcgca gcataggtac ttcttttcca aatctttaat
    53461 attgagacgt ccaaaagttc cctggcgcag gaaattccta taggtgaaga tccatcccct
    53521 gggccagcgg ataggaaagg tggtcccgct catctgtcga acatgctcaa tcagtcgctt
    53581 ggccggtttc tggctgctca cagaacatat gaaggtgtga cggacgagaa catcggcacg
    53641 ctccatctca gagagaatca tgttgttgac aaacaaacac cgttggacag agtcaggaat
    53701 ggcaaaatgc ccaggaaaaa tatacctgtg ccaaaatgac gcgccgacca caaaatctgc
    53761 atgtgcgtca tgtgttgttc tatgtacatt tctgcttttt gctgctaggt acgaattcga
    53821 aactcacgga atcctcgcta tcgctttctt ctttggcatc attaaagtaa ttagagtttc
    53881 tttctccaga gttggcggct cctttggttg tcaggtagct ggtgatcttg tgttgctcgt
    53941 acttttcctt ggaattgtga tcgtgctcat tggatttccg aggcggcatg cgttcatgct
    54001 tacgactgac aggctcggac atcatctcgg aatccagtcc cgagccgcag ccgtcgtcat
    54061 gcatggcgct tgaattggtg accgccaccg ccctctgctg tttgaaattt ttatcaaagc
    54121 tgagatcgct gcgctgaaaa ggctcctctg tgagaaagtt ttccaccgta aaaagaccgt
    54181 tatggctgga aacgtgcacc accgtgtcat gctcggtgac gattcgcacc gtgcacggca
    54241 gcttggtcac cgcacagttc atgagcgttt ggtagaggtt cttgagctgc acgtgaacgc
    54301 gcatgttttt tacaccatga aaactgacgc gcgtgttagc cgtgaattcc aactcactcc
    54361 cgctgttgag aatgaatttg atagccgggg gagcagaatg taccagaatc tgaaccgtac
    54421 cggtgggaca aggggccttt ttgagattgc gcttgacccg cgtgtggggg gaaatccact
    54481 taatgagctc gctgaccaca gtgtggtcca aatccacatg cacggccgag ctgtcgctct
    54541 cgcgcatcaa atcctggccg tgtacgcacg gagagctaaa ctccatgtta aaatcgggcg
    54601 cgcacatgtg tatttttgcg gacaggtcag agatgtcttg cacatagaac ttggttaagt
    54661 ccttactcga ggtcaggtac atgaaattgc ccaacatggg agtggagttg ttgattgttt
    54721 tggcttgaaa cgacttgtca gtaatgtaca ggcaggagct gttgaacgtg atttttgaaa
    54781 cgaactgatt gcgcacggtt tgcagaacca acgcgggtgt gggcaagaaa gtgacggtgg
    54841 tattctcttt gagggtgcgg atgaccgagc ggagctgctg aatggccgac ttatagggct
    54901 tgagccgcaa agccagcgtc gggggctcgg gcaaacgcgc tttcctctcc atatctgtta
    54961 accgcacggg aacccgcagc cttgcaagat actcactgct agctcccaga tgcgtcctcg
    55021 tccgtgccca acagtcaaat aagctgaaag gcgttaaata attgactttt atagaggaca
    55081 cacggcaaca caaaaagcgc acgctgaaag tagagccaca gtcgcacaca gcgaggttgt
    55141 atcacgttta atacagctct gcgaatctcg agaccagcat tacaagtccc atctaggagg
    55201 cacaatactt atatactcca accttacacc gcaagtggta ccatttcaac atcctcttca
    55261 ttaaaagatc tggagtcatt gaagactcgt aatagaaagg cagggggaca cactgatcca
    55321 caaacatact gacattaaca ctggccattt ccacgtctgc ctgcagttca gccgcccgct
    55381 gaaagacaca gctgggcacg tccgcgcgct gaacggtgcc ctgagttatg cttttggcct
    55441 tgacctcatc gtgatgctca atccaagcgt aattaatgat gggaactttc aggtgcttct
    55501 gcatcacagt tgggaaataa cattcatcgc tgggggggct gacgggcaac agggtctctt
    55561 cgtcgaagat gcgatcccgg gcggcccaga tagatggcgt tacattccac aggaaagcag
    55621 tctcctcatc ggcggcaatg gataacaact gagcgttacg caccccgtac tcctgcatct
    55681 cagttcggag agtctcccac tgcgccaccg ggagcgacag gtgaggcttg cgatacagtt
    55741 caaatatgaa cttgccctcc ttgtaaatgg tgcggtcaaa ccactcacac ggcggcagtc
    55801 cagatttaca caagtccacg ctggtacgca acgccgcata atacatattt tcaaaaattc
    55861 tctcaatgag gtcccaggac gcaaagtatg taaagcccaa cctcattaac accgtgtgca
    55921 gtcccgtcac cccgatattc aggctccgca ttttgcagat agccgactcc aagggccagt
    55981 caccggaacg aatcaaggcg tctaggcggg cattagccca aacaacagcc tcggcgacca
    56041 gggtgcgaag cacccgcata tcaaagtaac gtctcgtgtt ccccaaaacc acattgtccc
    56101 gacacagcgc gtcctcgtcg gtgcgcgtga acaaacaccg tgtaaggttg attgacagcc
    56161 gctgtaaagg caggtcagat tctccaaaat ggcacgatgc catgtctgga ctcaaacacg
    56221 gtggcaaggg aatattgccc gtcaatacag aatacttgac aatgtgatgc acaaacacca
    56281 gggcacattt tcccttcaag gcacaaaaca acatgttgcg catgaattcg ctggccttca
    56341 ccgtgacttt cggtaccgtc gtctcatatc gaacatattc tttttcaaat gcaaattcat
    56401 taccacactc tgataattta cgagacacgg tgcgcccaaa caaggagtaa tggctatcct
    56461 gagagcgata gcgtttcatg agtacagaag ggatattgaa agcataatgt atcccaataa
    56521 tgtccgtctc ttttaacaca aagttcagaa ctcggatagc cgccacgtcc cacagatcca
    56581 caaagatgcg caccatgggc cgatgaacct ccttttcgcg gatcatgtca caaaagccac
    56641 caatgcatcg aatgacacta atggcttcca cgttgaatcg ggtgacattg attgacagag
    56701 acactccccg ggttaaattc tcatacagcc acttgtgtag agccaaccag tccacctcac
    56761 gagaatacaa atcacatgaa atgaggtagt catactgggg cagctccaca aatccaatat
    56821 tggacatgga aaatggggtc aatgacaact gtccatcacg acaccgcttc actacactct
    56881 ccagaacctc acattcgtgc ctacaatcca tgtgaaaacg atacactcga gcacacgggc
    56941 tgctgactat ggccaacgtg attgccatag agattctgag aaaaattccc cccagggatt
    57001 catcctgacc gtagatctgc cgagacacct tatctgtcaa cacaatggcg ccataaaatc
    57061 cccaacagcc agccaggtct agatatcgag tgatatctgc cagaatttta ggtaggtctt
    57121 cggaatggcg catcacaaaa tcgcgtagcg gcccctcgca catagatgag gtatagttca
    57181 gggcatttcg gctttcccgt aaccagttga ccttgagata gaaacggccg atgagaaggt
    57241 cagaacgggg aatttgtcta atgagtgcgg gaccgtatct cataagcatc tggaaaagac
    57301 gatatgcgcc tctgatcccg gactgtcgag aagccgaatc gatatcgcgc cacaaggtag
    57361 cacgatcctc tacatgtttc acaggatccg gcactccaca aaagcgaaat ttgccccaac
    57421 gaccgtggca atggcacttt ttgcccataa gcagctgcac agtgttcatg gccggcatgt
    57481 gttgcaccag agaagacgat gcatctggcc tgcatgatgc ggcggtaccc tgatcggcaa
    57541 gcgaccaaca tgcatgaaca ccgacttgag gttgttgttg tggctgctgc tgtggttgtt
    57601 gctgttctgc atcaggcgac gatgtagcca cttccatggc ctccacacca ttctcctccg
    57661 taccaccatc accaccctcg gatccctcct gcatgaccgc ctcgagcccg ccggcgccgg
    57721 tgttcctcaa agacgcctga gccataacga cattcacccg ctactagaca aactctatga
    57781 actctccgag ttccacgttg aagtgttcca aacgcaccgt ggataattta acctcttggt
    57841 gggttaaaac ggaggtgtga atgtcatcag caagacacca ccccagtttt tgaatgaccc
    57901 cagtacataa agagatttgt cgtggcctgg tgattctttt atttacaaaa ctgcaccgct
    57961 ccgcaatgaa tttatggcgc accaagtccg ttagggtgtg ccgattagat atactcgacg
    58021 tggccacata aatcgccacc ttagtttcca aaacctcgta gtcgtacacc atgattaaat
    58081 acacattttg cagtcttccc tgagtttcct ccaaagtcat atacatgtcc ttcggaatcc
    58141 ataacgaaaa gatctctgtc tttagcgtgt tataaaggta gccgctgagc acgcaagtga
    58201 gtaacgacgt aatgcccaat gacaccgact ttacacagcc aatggtgcgc aggcgacgat
    58261 gcagaacctt actgcccatg tccaaccagg ccaaagcggc ctttgcaggt cccgaagtgt
    58321 agattccctc cagctgacac ttggcagcca tagacacgtt ggtagctttg atggccatga
    58381 gatagaggct aatgtagaga tagcgcggcg attcggcgcc cgtctccatg cgaaacatga
    58441 gcgaaccggg atgaacctcg aattccacga gtccttcggg cacgaaaaag cgagacgtaa
    58501 tggcctgatg atccgcctca tacatgtaac gcaccgctag tgtatttact tcccgcttca
    58561 gcttgacagc gaggacgagt tcgttatctt cgtcatttgg atcccgcggt cgcttggcga
    58621 tctcccgcgc gtccatgatg cgaaaacgca cagtcgactt tcaggtgatt ctcaatgagc
    58681 taaaacagaa atcaacggag attcagggcg tgttaaatac cttaagccaa atagagatcg
    58741 gcgcactgga tgtggagaca gtgaatgcaa ctaaaataca acagtttctg cagcttatac
    58801 cgcaagaagg ataccatttc acgtttattc agcaaaatgt ggtttactac atactgagtc
    58861 acagcacgtt gcaaacgtcc cgcgattccc tcagctccgc tcaagaatta ctcaaagagt
    58921 tgcagaaaca tcatcaacgc catgccataa ccagtccgtg cgaataccta aacaaccaaa
    58981 ccacgctcac ccacctgcaa acttttatgg ataaaatgca agatcttcaa aagctctttg
    59041 ataccaatca atttctagca gccaccgtcc cagaccgcaa aaatcaaaaa ccacgagata
    59101 tcagtgataa cggaacccaa tatctcatac gaagcgtgtt tacacagatc gaagaagcca
    59161 cagaacatat acgacctttc agtaactgcc gcctagtggc agaacttata gacctgcttt
    59221 atcacaacac actccgatgg gccatgggac tcatgcaata ccacgctttt atagaaaagc
    59281 acgatcagga actagatatc attctgaaaa tgcatttctt ctacaaatac tacaaaggtg
    59341 tcaacagcga gctaaacacc gaattccaga cattcatcac tagcgacaag cgaaatctcg
    59401 gacccttcat ggtgtctgat gcagatggag atcagcaagc tggagcagaa cacattagag
    59461 atctaagctt caaggtattc aacgccaacc taaatgaccg cgacacgaca ggactagcat
    59521 tccccatatt gctaaccaca ttatcggttc tgaaccacat ggcggtactt aatctattct
    59581 atcatccagg attagttttt aggcttctca gcgaggagtc aacaccaagt gctagtgaaa
    59641 tgcaacgtct agatctcata gcacaaatgt gtaatcaggt tagcaacgag ttttttcgca
    59701 caattactaa aaaacctgtc aaactccgag acctaatgat acgtatacga aaatttacat
    59761 ccttgggatt gaatcgccaa acctccagga catacgccca aatggcactg cttcaaccta
    59821 gccgaacgac acctaaaaaa ggcagcgaga tgtggttcga aattcgacaa caacttatcg
    59881 ttgcgattta caatacctat gtatttttta tgtgtttgtg ggtttacagc ccaacgtttc
    59941 tcttcatcca tcgacggaag atcattctcg aacaacaaag atccacactc gtaggatcgc
    60001 gccgcgaact tcaatttatc tgggacaacg taactaacaa cattcaacac gatttttatg
    60061 taatgttcac tgaagacgaa ttcaacgtta ctaccaaagg ggccacggag ctggaaaagg
    60121 attaccttta tcgcgaccta ctgaacaagt ggggtgacat tctcttcgta atgaagccca
    60181 aactcacgcc cgacgctcaa tccccttcac tagataacgt aaccaccgca gacgtaatta
    60241 aacgttgcgc catgattaat ttatccgaag ttaatgtacc ttacgagacc ctgctacctc
    60301 tcactcatca ccccagcttc cttgacacat ttgttaattt agttatcgtg cctgaatttt
    60361 cgcaaattct tacagtccct cataaccagt tcctcactat gggatctccc cgtttgttac
    60421 gtttggctca ggcctgccgc cttttggcac cagaccagat tgcattgtat aataaattag
    60481 tttcccttta taacttaact accttcgttt cagaaattga cgccggagta tttcgcacca
    60541 tctataatct aacactggaa actgccgctt tactggaaaa cctttgcggc gaaccagtga
    60601 gtccagaact ggatctactg gtcgaactaa tggcacaatc gctgtcccac aacttacaaa
    60661 ccacagtgaa ccccctcatc gaagaagtga tccaaaacaa cagcaccagc gttgccagat
    60721 atctagaaca cactaattta tgttactcat ttgcacatac cataggccaa ctctctacag
    60781 acatgagtac tgtcgagctc actcttcagt ccaaaacact tgcaaaactc agcatcactc
    60841 aatttctaaa aatggtacaa gccctcatcc aaaaagatca acaactgtca gacaactttc
    60901 acaggatcca cgatcgacta cagcagatta aacagcggat gaaacaaatt acagaagatg
    60961 ttatccaatt gaatgagtat tcaaagaatc accccctggc ggtcgacgtt gtaaagtgtc
    61021 tacgaaaggc cgcacggcag ctgaagagtt tagaggagcg gttgatttta attatggaac
    61081 agactcaaaa atccaacaaa ctcatcatta actctctgaa acgcatcgag aaaacctgta
    61141 tggtgctgag tagcaagaat atcgaggaac acggcatacg atactgtatc gcagaatctc
    61201 ggggcctgct gcgcacgcat cggtccgtat ccgccatacc cccttcggcc gtggattacc
    61261 tgccagacaa cgcggagtcg cagttacgcg cctttctgaa ggggttccgg gaagccggcg
    61321 tggaacacag tccgcttcag atgagcggca acacggatat acagcaacaa atccccattc
    61381 ccgaagtctt tacaaaccgt tatgaaccat ccaaccaaac aaatgaccta ttaaactggt
    61441 atattacgtc aaaagatcag gcggaaaacg acatcttgac ttcaatctac ccagaggccc
    61501 ggcatgagta attatccaac gagtgtgaat catgaaaatc tatccagcgc gcttcgatca
    61561 aacccacagc cgattcgggc cacgggcggg gagccaatgt gtttccaact gttttatgta
    61621 tctacacgcc ctgcatctgc acggtgcgca cacgacgctc agtaaggaca ccttggactt
    61681 gatattgacg gagggcgctc agctggacag cttggtggaa accatcttac agcaaaagcg
    61741 cccgggtgag aaactccctg cctttcgtct aggtgaagag attcccaaca tcatcaccag
    61801 cagctttgga aagaccgccc atgctctctc acgaccgttc aacgggaccg cggagacccg
    61861 ggacctcgat ggctacactt gcctcggcat tttcgacttt ctcatgtacg cgtatcaaaa
    61921 gaccaggccc gtgtacatcc tagtgactgt gaacgctcta gcccgcgcgg tgattcttct
    61981 cgatcacgac attttcgtgt ttgaccctca cgcgtctgaa cggtctcgct atgccgcggt
    62041 gtaccagtgc gactccctct atgatgtggt catgctcctc acctacttcg gcgcgcgcct
    62101 gggagatttt tattatgacg cgttgtttgt gtacatgctt gacctgtcca tccacccggt
    62161 accagaagcg gacattaacg gcgtcattat ctcgtcgttt cgagacccag acatcgcgtt
    62221 gcccgcgtcc agcgcaccac caggatctcc cgttcagacg atcccgagtc taccgcctcc
    62281 agaatccaca cccaagaaaa caccagaaaa aagaaaatcc agctccagcg cttcccacgg
    62341 cggcaaaaag aaggccgcgg agttcaaaga cccgggttcc tcctcgtctc gtgtgtctac
    62401 gaccgcccct tataattgtt tagaagcctt acccgccctg acccgctacg aacgtctaat
    62461 taaacaagcc gaaaaggaaa tccaaaatat cactatcaag gccccaccaa cagctggatg
    62521 gatattgttt tctagttctg gaatgccgtt tgacgaagcg ttccttacag accggatgga
    62581 acaacttgtc atgtccagca tcgaacacgc ctcttgtctc cacacccgat ggcgtccaac
    62641 aactcctatg tatcaacaag tgcggcaact tcgaggattt tcggagacta ttgatcgatt
    62701 cttgactctt tggctgcaaa atgaccttca cttactggac atgtacgaag ccctcaaaaa
    62761 tgtgaatacg tcgtctctaa ccgtgttaca gagagccatg ctagacaaac tgcgagccgt
    62821 gttcgctcaa tacagctcca gccaaggtcc aaaagtggtc cagtgggtta aggatattct
    62881 aaaggctaca gagaaagtca actatactca ccttcccatt cggttaatgg aatatgttga
    62941 agaacacccg ctcgacatcg acgaaacctt cgtgtgcctg aagcaacaag atttttcgac
    63001 aattgtgaac gccgtcaaca gccgccgaca gatcaccact caacagcaag aacaggtcca
    63061 gcaggcgctg caaaaactgt cagccgctat ctacggaata gatagtcgtt atctggacag
    63121 agtttcgttc gacgacaagg aaacaaaaga cactctatcg aaactcgaca atcaatcacg
    63181 cacaacgcta ttgcaaaggg gtaacaccaa aatgaatgag ctgaaagacg atctaaagcg
    63241 tcaaattagc gacctgttgg agcgcaagca caaccagatc atcagcggca cgttgcctgt
    63301 gcaagacatg caagctctgc agcggcgact ggaacaagct gtcaacttgg cacaagaaat
    63361 gtcggagcta cgtctctgcg atgtaaattt tacgatacct ttcagagaac tttccaatca
    63421 actggattac ctaatcacgg gacaagcgtc ctcgtcgcac gctatgtcct tctccgatga
    63481 gctgatgcag ctaagatcgc aatttaccta cgccacccag actaaagaag ataccgaaag
    63541 taaaattcat gacctgatgg ttcacataga agataccgtg caaaacctca cgagccgcag
    63601 ctccaacatc accatggcca tgatccagga acaactgagc gagctacagc aactcggagg
    63661 cggcaacatg ccggacatag caaaacgtct ggaaaaggtg caaaagacat tacatgggct
    63721 gtatcaagag gaacaagcga ccagaatttt tgtccatggc ctgaaatacg aaaacttacc
    63781 gaacgatcag acgatgaagc gatacacccg tctctcggag ttgctacgcg acgatgacaa
    63841 cttgcacgaa gtgttcattg agaagatcct ggacattttc aacaccatac tggagcggtt
    63901 atttgacaag acgttcccta aagcacaagc atttgacatg atcaacgcac tcattaatca
    63961 gattccccat gcatctacca tcattaaaga cctccatacc gctaatgcgg caatcagcca
    64021 actttccaaa cagctagagg ccctaagcaa agtccctccg gacaaacgcc taaatgcact
    64081 caccgagctc gtacagtact ttgtctcgaa cggcaaagtt tttagtcacc tgatgagcat
    64141 gcaagtaggc aaaaacaccc tgccgacact gtatgagaat ttgaagatgg aactggaaga
    64201 caagcataaa caacaagcag aaaacaagtg gctgcaagat gcgaaaaaac tgaccgtgac
    64261 gtcggccgaa atggttcacc aattcatgca gacggccccc agcgccacgg ccgccgagct
    64321 agcccggccc gaactgagcg ccaaactgca ggcgttccta gaacaggaag cgaagaaaca
    64381 agaagaagaa cgcaaaaatg ttttcaaaga acgacagggg atggtgacct ctgaactcgc
    64441 tcgtatcacc gatgcgatca aggcccaaac cctatcgatc atacccaacc tgaaactgga
    64501 aagtcttcaa gacgtgatcg cctcattggg ctcgggagcc cgagacatct tggagaagtt
    64561 tgaccgcagt ctgctggcta cactttccaa tctggtgaaa ctgatggacg aacgcgtctc
    64621 cttatgtatc caagacgtct taacaggtca ggatacgcac tatcaacaat atcaggaaga
    64681 cgccagggca atgcgccaag gactgacgta cgtagggact atgatgagga gccagctgtc
    64741 tcaagaaacc ctaagaacat tatccaatct ggttctacaa tccatgtttg tagaaaagtg
    64801 ccaactgcgc gatgctatga cggtgttttc caacagcgac tatctcgaag actaccaacg
    64861 ctaccgggcc ggacagcggc agctggaact gcaggtccaa gaagccagga tggagttgca
    64921 ccgtcaggcc accacggcag aacgagcgat acaccaacct aacgcgcgcg tggatgccaa
    64981 gaatctaacg gttggcaaag acttggcaga gaagttggac ctcgaatccg cgggcccttt
    65041 ccagcgatcc gtgtttgcca ctgtgctgac tcagcaactt gaaacgcaca aaaaaaccct
    65101 gaaggacgaa acggagctta tgaacactaa gctcaagtct gaaaatgaat tgaggcaagc
    65161 caagatgacg tccctatcgg aacaatggag tgacttggta acgcggcaga agatggacgc
    65221 tatggaggtc gccactccag acgccaaaca tctgatcctg aaccccgtgg ccgccttaac
    65281 cgagctcttg gccaaagcct ccacgcagat gtcgtatctg gacgccgaaa agacgttcgc
    65341 gtgggccttg ctgtttttac acgaagctaa aaatcaaatt gaaaatcatc ccggacaccc
    65401 ttgttacgcg caactccaga attttcccgt tcttatccaa caagcccagg gcagactgga
    65461 cacggtgcgc gttcacgtga ataacaacgc gtcatgcgaa aactttgtag cgcagcatga
    65521 atctggaggc gcgatcacgg acagggagac cattataacg gtagagactg tgtgggctac
    65581 cctcgaaccc aaacgtatcg ccggaggaga agctcggtac cacaaagtcc aagaattgct
    65641 gctccgtatg aaacaatcgc tctcagatgt agaactgcag gacaccctag ccacagaata
    65701 ctatcaactc ttgagctcta tccaaacatt tggctacagc ctggacttta atgtgcaatt
    65761 acaaaagatt agagacttaa aagcacgttt taatgaatta atcaaacaac agcacctgaa
    65821 tacgtctgaa gaagtgcctt tccccatgcc tccgattcca gggaacgaca ttaccgtagc
    65881 ttcacctctg tctttcgcaa aaggcttagc cgccctggaa agatatgtgc tagccgggta
    65941 tcagtaccta acggagtgca tcaaccgcca accgcttatc tgtcagcgaa tagacgacat
    66001 tccggctgtc ttgccaccca ctgacatcga tcacaaaaaa gcggcgttag accgcttgaa
    66061 acgtctgaac tttagtaaaa agaatgacac gtactacgaa gtgattgatg cgttcggcct
    66121 ccatcagctc atgtcacgaa caggcacccc cttgcactac ctgttaagct atggcaacgt
    66181 gttgttcaag tatctggccc tgcatcatga cgaaaaacac ttggcgaaaa aatttgccca
    66241 agcgaaaaat gtagtcacag gcagatacaa agtggtcact gtgaatgtag ccgtagccca
    66301 gaccatcaaa tctttctgga cccagatatc ccaatatgac ctaaaacccc tgttatcggg
    66361 ccaaccgtta ctgggtttag gagaaacaaa cagtcttgtg aatttgaaaa tttttattta
    66421 catcgttgtt tcagcgtgga acttgcagct cgacgtgtca caagatatca gcgggccagt
    66481 cgttcgtatt cccattcagg acctctgcat caccatcacc accttttatc cagaatacat
    66541 ctatggcatt gtgaaacacc ccatccaaaa caccctatcc tcccttgtgc gtgccctaaa
    66601 gaaggatatc gttcaagagg ccattaacaa tgtgatccaa atgccaccaa cgtataacgc
    66661 tgacgaaatc aaaggatttt gcgtgaatcc caaaatttgg tcatcggtga atttaagccg
    66721 cgtcttgtgg gaccacaacc tggtacgaca gatttgtgcg gtgggccccc gcaaaaacgg
    66781 caacggaaaa ctttggcagt atgcggtagc tatccttatc ttcccgcaag atctgttaca
    66841 atgcctctgg ctagaattga ggcctaaatt tgcggaagag tttgcgacca tgtttgattt
    66901 tttccaaacc ctgtttatgc tttttactca cgagtacgac atcgcccgtg agtctaacac
    66961 caacacacat ctgaacactg gagaacccat tatgcagacc attagcatcc gacacaaaga
    67021 atacacagaa aagagtttgt tagacatttt tattgagact gaaaccgccc tggattacgc
    67081 gttgggatcc tgggtgttcg gcgttccggt gtgctgcgcc atccacgtag cagacattct
    67141 aggcggcaat cgattactgt tggcacgtca tctagaatat acgagtcgcg atccagattt
    67201 tctccacgtt cagagagcta aagatctgaa tctgaattac ctggtaagcc aaacgtggac
    67261 aaacaccccg ctggaacaat gttggttcca agctcaaatt caacgcattc gagagcacct
    67321 cagaacccca ttacaactcg attttattcc cctgataatc tacaatgccc atgacagaac
    67381 catccactct attctccgtc ccccgaccac cgccgagcga gacgtgtctc gcattatagt
    67441 agaaaacccc ttccccaccg tacccttgat agacgtaccc gagtccgact tgatatcttt
    67501 tacccgtgtt cccattaata cggactttct ccgagaagac ccgcctcccg tatcccgtcc
    67561 ccgaagtcac cgcagcaccg ctagcggcgt cagtagaggc agcaaaagca aaccatctaa
    67621 agttacacaa ggcggcgctg cagcctcaaa gttgccgtca tcgtcgtcgt cgtcctcttc
    67681 tgaaagagct cgagtgcaca ctgtaggttc atccgtagac gtccccgaag tagtatccga
    67741 aggcgaaaca acatcgggtg atgaaacaga gggagaagac tttacccatt taccttcaga
    67801 ggaagaacag caatcgctac cctccacacg aacctttgtg gagccggtgt tccgtcagag
    67861 acctctgcaa accatcgttc gcagggaaga tgtgaccacc gtgtccccta gcgccgccag
    67921 ttctagtttt aacaatcccc ccatcaccac actcacacag aatgttatta gtgccattca
    67981 aatcttgtca tcggtacgcg tcgacctgag atcaatggca cgctcagtga atgaaaccat
    68041 caaccgacta cggttccttt atttattata aacagggccc aagtaggatg agaaggcaaa
    68101 aacaaaatga aaaagaaaac agcaacatat acaaaaacca cggctaacga cgagttctgg
    68161 ctaccgccaa catgcgcaac aggtccagtt tgaacgcata tttgtctgtg aaatagctgg
    68221 acatgcgaac gtatttagcc agcatggtgt tcgtcacggg gtgttccatg ctctcctgcg
    68281 gcaaatccag cacgttggtg cacacgtgcc gccgcttgtc ttcatctctt ttcacggtgg
    68341 gaccggtgcc gctcgagcta gacatgactg ccgtgacagg ccgtctgttt caccaaggtg
    68401 caaccccgac agagcgtggc gcagttctcg agctccaggc agctgtctcg atactctccg
    68461 gactggcagc gcgagcacaa gagtccgtgc ccgtgccacg tgagccgcag caaccgtggg
    68521 atgttgacgg agcgcaccac cacggtggag tcgcacgtcc gcgccgagca gggcaagata
    68581 atgtcaaacg tcacgacgtg atcgtacacc gcacacgcgg cgttgaggcc caacaccgcc
    68641 ttccagccga cccgcaggca gcgatgccca taaatggtct cagacaccac ctcgtaaaca
    68701 cgttctttaa tgacacgctg acttccgcaa agagagcagt gcacgagttc ggcgttggta
    68761 ttgaaaatga cactcttttc ctggcggtct ctataataga acatggagtt caagggaaag
    68821 ttctgctcac actgcagctt ctctttgccc aggttgagac agtgtccgca ttgacgacac
    68881 accacggcaa tcagcgacct ggagtctaga tggcgctcac acttcaggcg acataagcac
    68941 cagagcggga gctcgatgac actgccgatc aagcctccac gcagcgccac cgccagtccg
    69001 tgcatgacaa tcttggtagg ttctagcggt cgcgattgtt tgtgagcgcg aacctcgtca
    69061 ttgagcccca gagctcgcag cggtaccagg taccgcggac aggtgtcaca gaaagattgt
    69121 atggcctgtc gagccatgac gtatagtggg ttgccgcaag gcacgggtcc ggagtggcgg
    69181 cgcagcgctg ccacgagcgc ttcgagctgc gccgagcgcg acttgcgatg ccgcgcccac
    69241 tcattacgat ggtacacagc caaatcggcg cggccgtcga accttttggc acgcaacagg
    69301 gaaagacagg gagaactggt ttggttgagc acaggaagcc gcaggtccac cccgaagaga
    69361 aagcgatgaa aatcccctaa ggtagatgag gtcatcccat ccagcaaggc gctgagcttt
    69421 tcagcgggat actgttgcaa acgaatgtac acatagtccg catcgtagcg ttcgaaacgc
    69481 aagaaagcga cagtcctcga aacgccgtga aaacaattca tgctgtacac gtaggccagg
    69541 aacataaagt agggcttagt catcaccatg cgctgaaaga acatggtgac cgcctctcgc
    69601 tccgcaggtg cacatgccag ccattcgtgc ataaagcgct ggtagaagcg atccccgagc
    69661 tcgcggttta gaaatcgctt gtcggtgaca aagagttgca gggcgcaaat ttgctcctca
    69721 gtctgccagg cgccacggcc tatgaccatc tgcacgtgaa aatggtcatc gtgcgcacac
    69781 agaggagcaa aaagcctcca gagcgcgcga tgaaagtcac gagacatatc ggtagatgag
    69841 aaacagcagg actcccatca ccactccaat ggtgaggtag cgtaggtcca cacgaaacga
    69901 ggaggcccac cgcatgtgcg ccagcgagcg caccccttgc gccgcactga tacgcggctc
    69961 ctcctcttgc ccgctgccac ggccgccact acagcagcta ggtcccgccg tcctgcagcg
    70021 acatatgcca tagaagccac ctggcggagg cggaggaggt gtgggcggtg gaaagggcgg
    70081 cggagcgatc gtcattcgcg gcgagtgcag ccgcttgcgg ctgttgctgt tgctgtggtg
    70141 gtgtcgcaac gccgccagac gggatcgaat gacggccccg ttggccgccg cctttttggc
    70201 acagagttcc tttagaagat tctcgtattc ggcctcgttc tcgggtccga aagcgatgag
    70261 ttcgatattg aagacagaag gagagttaga cttgcgcacc acgcacttgg tgagcacccc
    70321 gtaggccgag ggcttgatct cctcaatgtc cttgagagtc acaatgagcg agtcgttgac
    70381 cttgagcacg ttgaactcgc cgacgtgcct agacgagacg agtttcaacg gcgctcggac
    70441 aaaacagcag agagacacgg cacagccggt gtttttaaaa atgaagcacg gcacgtgatc
    70501 tgtgcgactt tcccaatagc tcagcagata ctcaacgcaa taaaccgtat cggtctttaa
    70561 catagcatca cacacagagt aattggggtt tttgcagatg agccctgcgt cagtcacacg
    70621 caactcggtg ggtcccagtt tcaaaatccg gcgcgtggcc gaaacgagat cgtgatgaag
    70681 ccccttactg atttccatgg cgcgcgcgtt gtgtacatgc gttttattta cccgctgatt
    70741 cctcttttcc ctccaatatc ccgttaatgt ccatgagctt gttgacgata gccgttaata
    70801 gtttcgtctt ttcgttcaga atctgcgcat gattacaaga ggaacactcc ccgtgcacgt
    70861 acttgagaaa cgccgcgtac ttttggcccg cgttgatgaa atttaacctc gcgtccagtg
    70921 agggcaacat cagttcatac acgcgcggca gcatcggctc gaaggaaacc tccagctcgt
    70981 cctctgggtc cagagtccca tcctcgtcat catcgggatc ctccccgtgt accacccgcg
    71041 ccgagcgaaa cgacgccata gatagatcgc tagcccccta gcctcccttc gtcaacatga
    71101 atcaccaccc cgcttcccgc aattacgctt acaccggctg ggaattagat ctgacacagc
    71161 cgctcaacga aattacgaat gaactgttat ggcacgcgca ccctcgccaa gtacctgaag
    71221 ccgccgctgt agcagcggca gcagctgctg ctaccgctaa cgttgctgct ggcacgtcgc
    71281 aaactggatc gatcacagct ggtagcggag gaggggaccg tgctagcaac aatcccttcc
    71341 tcttcaccca gtcccaatgt accgaccagt tgttcggcgg cctcggcagc ggccagttct
    71401 gcgacctaga ctcggaactg gccacttttg aattctccga cacagaacga ctcaagaagc
    71461 tatgtacccc gctaaatatc gacacgcgat gcaacctctg cgccatcatc accatctgcc
    71521 tgaagcaaga ccccgatcaa gcgtggttgc tcgattacag tctactgtgc tttaaatgca
    71581 gttcggctcc acgcaccgcc ctcagcctac tgatcgtcat gtccgaactg acccatttgt
    71641 tgcgtcaaca cttcccggac ctgcacattg accaactttt tcgacaacac gtgttaacgg
    71701 tgtttgattt tcatctgcac ttcttcatca accgctgttt cgagaagcag cttggtgatg
    71761 cagtagaaaa tgaaaacata actttgagtc acgtggccgt ggtgaaagcc ttagtcatgg
    71821 gcgacgagat ggtgccgtac gccaaacacc gctgtttcag ccaccacaag cagaagattg
    71881 tagtcaaaat ccccgaggcc cccaaacaat tgttgcaaac attcacagaa cacagcacac
    71941 cgactcccga acgcttcacc tacctattgt tttatatgtg ggcgggtacc ggagtcatgg
    72001 caaccacggg actttcagag ctcacgcaga gcaagcatca cttgctcgat agcgtggcgg
    72061 acgctgatga tccagagatt aacaaagacg tcggccccat ctacctctcc cccgtccccg
    72121 tgtttcagac gaaaaaccag accaacaccg tgtgtttgct gtgcgaactc atggcttgtt
    72181 cacactacga caatctggtg ctgcgcaacc tgtacgaccg catcaccctg tactgcgaaa
    72241 acaacgtgaa aatggtggat cggattcaac tagcgctggc agacatgatg cgggagtgtg
    72301 cggtgcccat gcattcccag ttcgaggaca tatcgcgcta cgcccgtctc ccaccccctg
    72361 caaactatct ctccgaatac cccgtgcgcc cagatcccat cgtttgcatt attttgcgac
    72421 aggcaggtgt aaccggcatc tacaagcatt ttttctgcga tccgcaatgc gcaggcaata
    72481 tccgcatcac ccgcgaagag gttctgttcg gaagactcca tctggaacac ttgactgaag
    72541 tgaaactcgc gatttgccac gacaattact atataagcca gctgcccaga cgcgtgtggc
    72601 tctacattac catttttaaa gccttccaga ttacaaaacg gagctacaaa tccaaaaccc
    72661 agctgtcaga ttttatgcgc gaattcacgc agctcctgga agcttgcgaa ataaaactag
    72721 tagatccagc ctttgtggtc gacaaatatg tttaatggcg tgcgatccac ggagcggcgg
    72781 tccgctctac ggtcgctgac tcgcaagcgg cggccgcgac gcggcagtct tctgtccccc
    72841 cctaatcaga aaacaacagc ctcatcgccc tcgggaatcg caacaccccg accacggctg
    72901 acgctgcacg agttacacga cattttccaa gaacaccccg acctcgaaat aaagtaccta
    72961 aacatgatga aaatggccat cacgggcaaa gaatccattt gcctgccctt taattttcat
    73021 tcccaccggc aacacacgtg cttggacatt tcgccctacg gtaacgagca aatctccaag
    73081 attgcctgta catcgtgtag cgaaaaccaa gtgttcccca ccgcttcaga cgctatggtc
    73141 gcattcatta accagacttc aaacattatg aagaatagaa atttttatta tgggttctgt
    73201 aaaagcagcg aactgctgcg aatgtctacg aaccagccgg ccattttcca aatctattac
    73261 atcatccacg cctcgaacca cgacatcgtt ccgttcatgt ctaccgaccg cgatcggctg
    73321 cacatgcaca tcattttcga gaaccccgac gtccacattc cgtgcgaatg cgtgtcgcag
    73381 atgctgctgg cggcgcgcga cgattaccac atcaccctcg acatcgtcaa aggccacgtg
    73441 gtcatcagcg tgctgtgcca aaccctgacc ctcagcagcg tgaagatcga tgtgaccgtt
    73501 ctgcaacgca agatcgatga aatggacatc ccgaacgacg tcagcgagtc tttcgagcgc
    73561 tacaaggacc tcctgaacga actctgccat gtcaacaata ctcgctcgcc ttaacgcaat
    73621 atggcaggaa ggagggctcc agatagatgc gatgcggtaa aatgcctagc aaaaacttgt
    73681 cctttcttag tgtctgggga ggaaacacgg gggagagaac attggttaca gatttaatga
    73741 cctgatcgaa atacttatcg gcatgaatcg gcaccccgtg ctcgcgcacg taggtgggat
    73801 cctccgcgat ctcgtaattg cgcaccccgc tactgcgacc gtcagcgggc gctgtgagca
    73861 cgtaaaacac acggtcaccc accaccggca gttcctccga gcgggccgct aatcgcttaa
    73921 tgaccgcgat gtgtggcaag ttggattgct tgtacagcga aacgtctttc gacaagacag
    73981 aggaaagaac tagctcttca actcgcgctc gagacgtata aagctcgtcc cgagcctggg
    74041 acaggcgctg tataacgcgc ccaaatcccg gaggcacgcc ctgcagcttg agctcgtcta
    74101 aagtcaagcg cgagagctga accgccgccc gagaaacttc cggatcatca aaaaggagct
    74161 ggataatgtc acgtgtgaca ttcttaacga attcgcacga cgttttccgc accagatcca
    74221 ctcccttcat gctgagctcc gtctccccca ctatcttacc aatatatcgt tttttgcaaa
    74281 tcatcatgag ggacccaaac actttttcga actctaactt gatgggatcc acaaagagac
    74341 actgggtgat ataatgggcc aaactgggac cgcggtcgat tagagccgcg gccgtgacac
    74401 cgcgatagca cacgaagacg ctatcggtgt ctccatatat caccttcact gccaccggat
    74461 cccccgaata atcctcccta ttaaaaaaat tgtgtaaaaa gcacggctcc gcaaaatttt
    74521 cttccacaaa ctgcgatgtg cgcattagca tatcgcgacc tatgcgggtg atactggcgg
    74581 caatgggcag acagggcatc atgccgttca ccacaccggt gaagccgtag aaagcgttgc
    74641 aggtgacctt gagcgccagc tgctccttat ccagcagcat gcgcttcacg ggatcgtgac
    74701 agctcttcat ggtctcgcga accgctcgcc gctgcgaaac ccattttgtc agcagctcgg
    74761 acagcacaga gttgcgcacg gtgttcttga caaagcggta cgacagcccg ctctccagct
    74821 ccaccgtgag cacatcgctc tccggcggag actcgccccc aggtgccaca aacgtggagt
    74881 agcagagatt atgtgccatg ataattgacg gatataggct ggcaaagtca aacaccacca
    74941 cgggatcgct gtaatacccc acctcgggct caaacaccgt ggcaccttga taggaaacat
    75001 cagtgggctc cgaagaattg tctgccccct tgtgattggg cattacaaaa tcccgacagg
    75061 cacactcatc tagcagagac gtataaatgc gaatctgctg tccatcaaaa ataacacggc
    75121 gcatagggat tctcgccaac cgcgcgatgg cccccgcctc gtagtgaaaa ttgatggtgt
    75181 tgaacaagtc cttgacaagt acagcgtcct gcacacaata cttgcccacc tgcgcccgtc
    75241 cctcgcaccc agaaatgaat ttgacgggaa tgtccttgta cgacatgtct tctttttgtt
    75301 gtttcagata caactcggcc atggtgttga gcttgtaatt gggcgagctg gtcttggcca
    75361 tgcacacggg atacatgtca atcaccacag accccgagat aaacacttta gtggtggtgg
    75421 tagtgacgaa cttcttaaga ggagagtaca tgctgaaacg gccctgtgca ggcaacttgc
    75481 tgtacggacc tggactcagc ttgtacacaa actccagccg tgtcaaaatg tacttgaaat
    75541 caaaagagtt gatgttgtat ccagtgacaa aacacggtga atagcgctga aaaaagatca
    75601 gaaagcccaa aagcatctca tattcagagg gaaactcgta gacatcaacc cctgctaacg
    75661 gtgcacagct acctatggtg aacagatgca atcccgaagt cccaaacacc gtgttctcct
    75721 cgcacccagt gccccccgtg ttatagcaaa cacatgaaat ctggatgata atatcatccg
    75781 tttgctcggc cgcggggaat cccccactgg cactcatgca ctcaatatca aaggatagac
    75841 agcgatagac cggccacgac gtgtcgtcgg acacagccat aatatctgcg acgtcgcagt
    75901 ctatctcgaa atcacaagtg gatgatttat gggtgcgcca ctcatagcgg tgcacgcagc
    75961 accatccaaa cgttgtcatc ttcttatcga tgacaagccg cgtcaaggga tccacacgaa
    76021 tctcgtagac ggggatccca ttttccaaaa ggtactcgcc gattttcttg gccatgctcc
    76081 aattactgag cgacacccga aacaaattgg gtataggtga cgtcccgtaa ccgtagatgg
    76141 acatcttttg caccggggta atcgtcagag cataggccat gcgaggttct gataccaagt
    76201 ctgagacact ggccagaagg tcccgaagca ggtcaccatc tgcatattca caataaaaat
    76261 agcttctctg tccgaacaca ttcacgcaga tgctgtaccc ttgttcagta gcaccaaaaa
    76321 atcgcaagac gttccctgat ggtgtgatgt gatgacggta gcgaggagac aaacattcct
    76381 gtgtgtcgtg agtcaaaacc ccatcgacct gatcataagt gtgaaacttg agcggtccca
    76441 tcaaacgcct agcgaatgcc tcgatggatg gcggtggcgc aggtaaagga cacggccagg
    76501 ccatgtcatt ttcaagtaca tgtttaatgt cccgataaaa cataattgcc ccacgcccag
    76561 tcttatgttt aatgagcccc gattgtccat cgtacatcgc cccacgaggc acaatctcca
    76621 gaaacgtctt cgccacggag cgcttggcga ccagattcgg aggttttcga gcaccactca
    76681 ggtaaggatt gaagaacatg tttgcagcgg ctgtcaatca gacctcgtac tcgttctgaa
    76741 tcttttggta gccccctcgc cgcctgtagc gcaagcggtc caagaagccg gcggattgac
    76801 cgttcgatgc gaaatcttcg tcatccgctt ctgcttgtct gcgtttttct tgatccagtt
    76861 tttgcaaagc caaaagcatc tgataggcct cctctaaact gaattccttg gttgcggagg
    76921 ctgctttctc ttttatgttt tcatactggc tttgttcata cgaaggcgga gcttccttca
    76981 ccgtggttgg tggaacgaca tacgggaaaa agtgctcgaa gggcttctcg tacgcgcgct
    77041 tttgccgcat gtagatcaag taaataacac ccagtaccgc aagcaaaaag agaatgacag
    77101 tgaaagaacc gaagggattc ttgatgaaac cgacgacgcc ttccacaaaa gaagccacag
    77161 caccacctac agctccgatg gccacaccca aagccttccc tgcagaacct aggccgctca
    77221 tcatgtcatc caggccacga agatatgcag gcacgttgtc gaacaccttt ccttccacgt
    77281 ggaccatgcg ctgtttgtac gtattgaact ctcgcattat gtcttctaga tcaaaaacat
    77341 tgctagaacg caactcgtct cgagagtaca attccaaagc tctgaaatcg gtgttttcca
    77401 acggatcaat gtccagagaa atcatggtgt ccacggtgga aatactgtcc agaggaatca
    77461 ttcttttgta cagatagtcc acgtattcat atgaagaatt accggcaata aaaattttca
    77521 gactgggaga ttcacaagct tctgtacgat accgaccgag caaaatttca ttatcttcac
    77581 ccagctgacc atactggaca tgggaactgt ttacaaaagt gtacaaaact acaggccgag
    77641 agtagcaaag acctttctcc tttgtatgca tatcacgcag tacctgaaca ctattttgat
    77701 ccacctccac acacttagcc aagctgataa catccccaac aaaacgtgca gcaatgggtt
    77761 tatcgtaaat ggcagataac atagcactgg gattgatttt gctaagttct ttcaacactt
    77821 ccaatgttct cttttgatcc ttgcaccatg cttcagcaat ttgcctgaga gcacgattaa
    77881 tgtaatttct caacgtatca taggtaaact gtaattgagc atagacaacg ctctgaagca
    77941 cctctttggt agagtttcct gaatttgtag aacgttttct acgacgagta gcatttgtat
    78001 tgttggcatg ttcagtggcc agtttctgca tttcccaaat ggccttttct tttacaggca
    78061 accaaaacac aattaatcca ccactagttt catatacaga tacattgcct gacttcacat
    78121 atgtttcatt gtacgtagtg ttaaaaattt tctccaatcg ctcattagct tcatctctaa
    78181 tacaatcaaa atcagaatca gactcgttca attccttctt taacgttaaa aaagtggcgg
    78241 tcatactgtg agacgtaaaa tgaaaagtct catcagcctc tgatctaatt gtacgttccg
    78301 attgctccca aaacgtgtac tcgcatgtgt tgttggcttc atccacaatg tcccacgaca
    78361 taagcatatc tggcctttca aagaaagcca ccagttcatg agcaaccaat ggagcgttat
    78421 cttttccata tgattcaacc atagaataat ttcttctgat aaaaaatttg tccctatttt
    78481 ctccaaagtg ttcgttatta gatccattgt aaaaaggaga aatgtccaca acttcaccac
    78541 cagatgtcac aaagaaatca tagggatact tagatctagc tgtagttacg gttaccatgc
    78601 aatttacatt gcagcttgtt gtatacaacc aagtactgcc ggctttgtgc caaagttcct
    78661 ttacagttac gtaacgggca ctgtgtgtgt tggagtaatc atcttcaatc agatgcatag
    78721 tttcattaac ataactgtct ttatgataat ttacataagt aacacctgcc acatttctaa
    78781 ccacagaatt gtaacaccta tttaatctat taatataact aacttcccac attggtacag
    78841 ctaggcgttc ttgactgaat cccagcaggt gattttccct gataaaagag taactctggc
    78901 gaaatgtcaa aatcttctgg tagatgtgca ccttgaacgt atatggctta atatcacgct
    78961 tgtagaccac catgatgcct tcatcaaaat cttcctttgt aggtttgaaa ctatcacatc
    79021 gaatgttctg ttcgaaacga agaagatccg ttccctgagc catcgagcac acacgatatg
    79081 gaaattttga catgttaacc ctgaagactt catgagttct caatgttgta ttagcgatta
    79141 tctcgcccgt ggtgttttca gtaggcgcag gtgttacagc actagcggta ccggtactgc
    79201 tagatgcaat tgcaacatac acaaccaata cgctagcaca gagaagcggg aaccaattct
    79261 tgctcatctt gatcccgtac caagtcaaac agaacagaag cgtcccgagg ccgtttcctg
    79321 gaagctcgcg ctcgccgagg aacagtcaca ggcacgctca cactgtctgg ctcgcgaaac
    79381 acgttgttct gctcatccgg cctggccagg tgcctataga ggaggagata caggtccttt
    79441 gatttataaa gtgtgccttc gtgacgcaaa atgagaggcc actctttgtt atacgtcaga
    79501 actaaatcgt gatcggtggc aaagtcgtca cgcaaacacg caatcgtgag ctgttttcca
    79561 aaggtttcgt tatatagtgc gaccgagaga acgagttctc ggacatgttt ccacatctcc
    79621 ttttgcaaca tattcaagtc cccacaagaa ctgaaatcaa agaatccttg atacttgacc
    79681 accatccact cactaggata cacggtgccc tccgcacatt ttaccaagtc atctttgatg
    79741 tgaggtaata ccccagcgtt atcacaagca taagccatgt ccacattatg agacaggggg
    79801 tagcgatccg tacaatgtgt gaacagggga ccgttacaca attggtagat ctgctgacct
    79861 aacagaggaa gggactcgac agggagactt ttgtgaatta tgttgtttac tacgtatagg
    79921 tgttcgtcat agctgagcac ttgcgagacg tccaccacat cggggttgtc tctgtatcga
    79981 gtgcggtaaa tgaacccatt catgagtctg gagataaagt ccagacagac ggtgccgatg
    80041 aggttaacat caatgagctt gctggtcaat cgctcctgcg actttatgca gcggatgacc
    80101 ttggcgtagc ccacctctga cactttttgc aagtacgcgc gcttgcggat gttaacctcc
    80161 cgagtaacgt tgtgaatccg cgtacgcgcg tccatgtagt ccagaaactc gttgtcttcg
    80221 tcggggggcc cgccgttact ggacgtactc tgggggtcct gcccacgaat ggccgcgccc
    80281 accccctctg ccgccgcccc cccatctggc acggggcgcc tgatctcgtc caggaggcat
    80341 ttgattttgg tatacatttc gttgctttcg tggagcttgt tgaaaaccgg gttgtcctcg
    80401 aaagcttgaa tgctgaggga tgtaattagg tcgatgatcc tgctgggggc ggcaaagacc
    80461 gaccccacga aaagacgctg ctcgcgggaa agcagctttt ccccgagcac gaaaatgtcc
    80521 tccacgtcct ccccgtacag gtacctgctg aggacgttca tgaggactct gcacaggtga
    80581 tgatagacat ttagttgctg catgcttatc cccacccgct tgactataac ctccgaggta
    80641 cgggaccagt aggtaaaatc cgacaaggaa tatattcgtg ccggtatatc cgtaaacagg
    80701 ttgtactccc tcagcgcctc ctccgcctcc tggatatagc tgtggtagac cgaagaagaa
    80761 gagaacaggt ttttgagggc cgtgaggacc ccagaaaggc tggggatgcg ctgcgtcagc
    80821 tccgtgaggt cctgctccac cgtttggata ttcacatcgc actggctcga cggccggtgg
    80881 accacaatat ggttgcagag caagccctgc aggcgcttgt tcagcgagcg cccctggttg
    80941 gggatgatgg tcagctcctc gtagcattgg gcgcacgttg ttccctccac gtacgcctct
    81001 tggcaggcta ccggcgacac tccgcacagg cgacgcagca gctggaggag ttgcgagcag
    81061 acctccagcc cgctctccgg ggacaggatc gcgtatacgt agttcatctt gcacaggaag
    81121 cgctcgatgt cgttgagcgt tgctagcgtg acgctgaact ttacgttgtc cgtgaacgta
    81181 agctccaccg tgtggtgccg atcgcaccga tctaaacgaa ggactgtacg gtagtactcc
    81241 gcccggtcct gcctcctgga gtacgccttg agagcgcggt cgagcagctc cgtatcctcg
    81301 tacagagcct tcaaaatcat ctccatgtac agactcaaca gcgaagtctg tgtacggttc
    81361 tggcgcacca gctccgggta gatcctgcgg tacagatagg cgatagccag tgcgttcttc
    81421 ttgaacggac ttgactccgc cagtaacacg ctcggatcgc aatactttag acactccagt
    81481 tccatggcgt attcgttgca tttggaacac actacgcaca gtttctgcaa caaattcatc
    81541 tcccgcgccc tgctcgtccg cgtaacagac ggcgtcctcc gttatctgct cggagagaga
    81601 catagggacg gcacacaaat aactcgctca gtccacagtc tgccggaacg ccgacgttaa
    81661 tatataacgg cgttcacggc gtttattaca gacggcctct cttggccggc agtagaccac
    81721 agtcgtcgtc aaaggcatgc tctcccccgc ccgcattcac acccaccgag ttggccgccg
    81781 cctccccgac agcgggggcc gtaaacagcg cagacaggtc gtgcacctca cccccgccgc
    81841 caggttccag gcgactgtct aacacctgct ggagattagg cagggaaaag tccgccaccc
    81901 ccatctcccg cagccgggaa aacttctcca tcagagagtc tgccaccacc tggcaaccgt
    81961 ccacaaaaaa taacacgtcg tcccgctcgg ggatctcctc ccgagtactg agaatctcgt
    82021 acatagccat aagctcggga tcaacatcca ggttgtcaga gtccaaagcc gccatgactc
    82081 tgttctttat gatgtcctca tcgaaaagca cgttctcgcg ccgcgagcgc ttgatgagaa
    82141 catcagacag cttggtggcc aaaatacagc gctgtctcat gaatttgtaa tcttgccctc
    82201 ccatagagtt cgtgttgagg ctccgctcca ccccgttacc cgaaaagtac ccaatctgcc
    82261 cgaactgata gatgtccttg ttactgttga ccccagcgta cttctccacc gagaagctca
    82321 cagtaatcag agatctctgt tcaaagatgg ttcgcatcag agactctcgc gtgactgtgg
    82381 ccgctaacgg tgcgatgacg ccggccgcct tgagatcctt caggcgcagg gcgaaatcag
    82441 ccggtgacgc gaaattgggt gtctccccca gcaaataagg aaattgggcg tgattttggt
    82501 acgtgagtct ggtagttagg ccgtgtaagg tacctatgta gtccttaaag ccatagaaac
    82561 aaaggaattt gttgtggaac cgatgctcga gatagttgag catgcaatcc ggtgccacgt
    82621 caatgagatc gtgctcattg taatcggcgg tgaccgaaat gacaaacttc acgaagttgt
    82681 taaactcccc catgtccccg atactcacat tcttgggcaa tgcgttggca cagacctttt
    82741 gccagaactg taagcatgag aagccacaat cagggaacaa cttatcgtga tacttgtaca
    82801 gcaggaagcc gagacagccc ttcaccgggt tctttttggg cacatgttca cggcgaaaaa
    82861 acacgtgagc cgtggtacct ttactggctt tggagatggg cctattctta actctgaaca
    82921 tgagaagtgc aggcacagag agcctagaga gcttaatctc catggggatg accgagtacg
    82981 tcccacgggc ataaagttta aagtccggca agcggtcgtg atccacattt ttagaggatt
    83041 tcacgttcct aataaacaaa aaacccttcc tagaggaagt ggtggaaaaa gccccgtgaa
    83101 tggactggaa gtgttgtgta acccaacggg aaaccagact cgtggtaagg gggttgtcta
    83161 caatgtatga ggtggccgtg atgagagcca cattttggat tatagccaaa atgacacggt
    83221 aatactcata ggacaggatg gggttgaaag caacggcata gggactgagg tcaaggttaa
    83281 aagcctgcgt ggccccggac acttcgtccc gactgctttt catgcggacc tcagagacaa
    83341 agctcatggc ctcatcatct acaaacttgt tgagcgatga aaccaagtta ataaagtctg
    83401 ccctgccgtt gatagtcatg gtatcctctc ccgtcactga gtctatgagt ctcattttct
    83461 tacaatagtc cagaatacgg ttaagtcgat gcgtgcggtc cacgctcgaa ctggcactgc
    83521 gattggacgt cggcgctgaa ccctcgtccg ccttggtgtc caggttcgtc tcctttgact
    83581 ccgcactgta ccgacgccca aacgtaccca gtgtgtccac atcgttcaaa aagcgagact
    83641 gcataaccac cacacagggc tcttttttag gcagcctagg aatttgggga aggcgggttt
    83701 gaacccgtac aaaggcggta ttgtaacacg tatggcaaca tgtcccgccg caagccccgc
    83761 acagactaga tgagcaaccg attaaatgat tactcagagt ggatgaaccc gttaacccgg
    83821 tattgtaaac agaaactcga ttgaggtacc agactaaagc ggaaaagagt tgggggcacg
    83881 taccgcagat gagggccagg tgatgaggcg catagcgctc gtccttcaca accgtaccgg
    83941 aagatttgat aagtttccta gcatcgttgt aggtgtcctc acacaacccc gtgagcccgt
    84001 tggcaaaatg aatggacttg agcagcgcct cttgactagc cccggtacca ctagcatttt
    84061 tgttggatgt caggtagact aacctatttt gatagagaat agagttacag ctgaatagta
    84121 acgcactaat gtgagttgag aggtgcagct tgagctccgt gagcgccttg atgagctcgc
    84181 gatggtccgc ggcgttcatc accacgggcc actcggagta caccatagag tctgaagctc
    84241 cgtaggctga atccagaaac accgaagcga aactgaaacc cagctcacag atgaccgcat
    84301 cacttagcat aagttggtcc ttctccaaac tgctgagctt ctgactcgtg tacccaaagt
    84361 atttcttgtg aggcgccagc ttcaccgatt gctgactatc gtgcacgaat tgcttcaaag
    84421 ctgcttcaat gagtaccttg gtttccgaaa aacgtagtgc ctgacaccac gaagtgtaaa
    84481 cataatagaa cagggcttcg ctcacagcag gtacatacag accccgagac tccacaaagg
    84541 aattacgttt atctagagac acctcatcag aatcggcatc tgcctgcaga gagccaaaga
    84601 gcgttggagg gtacagcggt acacgtacgg cgtcacagtc attgagtcga gtcggcacgg
    84661 cctcctcgaa acacgggatt aactgccccg catagagaaa ttccttgagg ccgttaccca
    84721 ccaccacgtg aactaccact tcttggggat cacaaccagc cgccgtgcac agtgccgcca
    84781 gatcggtggg cgctcggccc tcctcaggta cgtaggtctc caaagagtat ttctgccgtg
    84841 tttcgtcaca taatcgctgc acctccccgt gtggctccga aaaatgtatt atttcttgcg
    84901 tgttatggaa atacatgacg aaagggcaga aggacgtcac cttagtaagc accccaccgt
    84961 cataacacac aaccggcgtt cgcaccgagg tgcaaaaatc ttgatccacc gtgagcccca
    85021 tcaagagcgg cgcaatcacc actggcgtcg aacggtcaca cagcgacaac gtcgctaaaa
    85081 cttcattcgt ctccgggttg gtttttgtga aatacaggta ggcggccggc cccacgggag
    85141 caatagcgct aagttcctcg ttgctcatgg tggtcatgta acggtctgta ctcctaccaa
    85201 gtgaacttta tactcaggag gacttaagac gtcacggttg acgcattacg tagaccacca
    85261 gcacggaaat gtgcaccgtg cgcctggcgc gccgccccct tcgacggtta ttcgaccgct
    85321 ttccgaccca aacaggctcc gcgccaccct ccgccaggcc ggcgaactgt tattgatagg
    85381 cgccttcgaa aatagcgtga tggttcgcgg ccatccatgc gccacctggt gtccgagaaa
    85441 aacaacgtgt ctgcatcggc gcacaagcag ctgtcaatca acatgattga cagatttcat
    85501 taaaaacggc gttttatttt aaaaatgccg ttccgaacgc tgttttataa gtaaagcgcc
    85561 gttgtgctcg gctgagcatc taaaaagcac gcgcgacagt ttatgaatgt ataacagcgt
    85621 gaataaagtt atcccctcgc aacggtattt tgtgtgttct gtttgtgttt ccacggcgtt
    85681 tacagtcaca ttccgcggtg agcaccccat aatcaccgtc gaaactgcac ccgacggcac
    85741 ggtgaatctc acgtgcgcat gtgccgtgaa aacagcgtgt ttcgaaccag ccgaacgctg
    85801 cgatcgacac gctgaaagtg gccgtcgaaa cggcgtttgt accacgtgac cgcaaaaaca
    85861 ccgtctcgcg cgcgcgttat gaataatgat aatcagctat gatgctcaaa tttgaatatg
    85921 tattaggggg tgggtgcgtc ggtaccgtat atgcgcatgt agctgtactg atatgacgtc
    85981 atcatacagc tgtatctaat caagctaggt atatacggca aatctgataa cgaggaatac
    86041 ggtaaggctc attagaatgc gataccttat aaggcttaat taacatccgg taattatatt
    86101 cgtatgtaaa cacatgctaa ttaatattcg gatatacgga ataattacgt atactttccc
    86161 cgcccagttt cataagcttt caggtatcgg gggtcaaaaa gggggcgtat ccggtagtag
    86221 aaaatacaca cccccttgat ttacatgcat ggtcacaccc acattcaata tggcgatctg
    86281 aaaccacacc ccttttataa tgacgtaggt acctacgtca ttgaggaaag ccatgatctc
    86341 agacctagtc aatgcagacg tttcatcgac agtgcatata taaaagataa aagattaaaa
    86401 acctaataac gataatctag aacccctcac cccccaaacc cccctctccc cagtgtgggg
    86461 gggatccggt tttgcgcgca tgcgcacttc gttatttgag gtcatgtgag gcgggttccg
    86521 gaagatgggc accgcacagt gcgcatgcgg tgcccttact ttaatgtagt tgaatgggac
    86581 gttgttttcg gtgcccagcc cccacttttt gggtttttgc gggtctgggg tctcttttcc
    86641 catcccccat tgtaaggacc cctgacccaa ttctcggagt ggtctgcatg cccagccccc
    86701 cacctcgcat gctgtgctgt gggagtgccc ctcccccacc tgcctgggtc atcggggctg
    86761 cattggttcc ctatgatggg tgcccttccc cctcgcattt tacccagcat gcattgcttt
    86821 acggtttgca aaacgctcag aaaatcgctg acgctgcggt tttgacagga aaggggcgga
    86881 gttagaacct tcgagaactt ccgatttcgt ctttaaaagc cggcctgccc ggagctcggt
    86941 ggcgcagtcc gcggcgccgt ccgggcaatc gccagtggcg acctgggcat agccgtggct
    87001 tgcgcgctct ccagggagcg gccgcgcagc cctggcggga ggcggagcgt gcgctcggct
    87061 gggcggcacg gaagcctggc tgcgaccagg gaaccgcgcc cctgcacccc agctgggcct
    87121 cgcgacgccc ccacctgcga gctgtgcggt ccccgggttg gccgggtatg ctccctgcgg
    87181 tgcgcggacg gccgcgctgg gcctgccgcg gttccggctc cacgtcgtcc gggccgccct
    87241 ggcgctccga cgtcgggtag gcagccggct tgccccgacg agccctggac gcagtgctgg
    87301 atcgggacag gcggctgcac tacacggccc ggatgctgcc gaaaaccccc ccgttcccgg
    87361 atgccggctc cagcgatcgc caaagcgatt gcggttcgca gccgcccggg acgaggaggc
    87421 caccagcgcc atagctactg ccgtttctgc tactactgcc gctgcagcag ctgctgctcc
    87481 taccacaatc gccgtcgttc tcagcgctgc tactgccacc accgtggacg ttggacggcg
    87541 tttcggattt cgtccgtggt ggcggccgac gtcgccgtcg catagccggc ggcctggagg
    87601 cgacctggat gcgggtcgcg gctccaggtt agacgtcggt ttagatttca aatcgcgttt
    87661 cgggtgtcat atattttgtg ttgtgtaaaa gcgttaacct aagcgaaacc taaacaaaag
    87721 caacaaaacc agcgccgttg ttttccgttc tacgttcggg acactaatta attatgattg
    87781 actgcactga tttattggac tcgtataaac tgtttacact acacatctag gatagaagct
    87841 ttattaaaaa acacgtcaga gatctagctt acgtcagaac gcgtacctac attatttgtt
    87901 cgacgattct gtcggactgt ctgtccgtcc tccatttggc cggattgaat cggctcctta
    87961 tgaaagcgaa ataataataa aaaacaaaaa acagacttgt agtttgtaac cgcccaaaaa
    88021 agaaaaaaaa aagaactgga actgtttgac gatatatttg tagcaatgtg tctgcaccag
    88081 tgaaatgtct acgaaccttt aaaagccctt tcacaggaag gccggcttct cgggatgcca
    88141 ggagtgtctc tctatattgt cttggtcctg ggtgccagtc tatttagcaa aaaacattca
    88201 cttcatctag agaaaacatc acgactcaat aattaaatga taaaagaaaa taaagctaaa
    88261 caaaagaatt aataaaaagc cgcggggccg agcccgcacg tccatcatac agatattact
    88321 acgatatgtt agtttgctcg ttgttcttgt gtattcttcg ttagatcact gccacagccg
    88381 tcgacgatcg gtcgcggtgc gctctctctt gggcgtgaat caggcgctag gttgcagacg
    88441 ccgtgtgtga ctgtgggcgg gccaacctag cgcctctttc acggcgcgga gaaagagaaa
    88501 aacgactata gctctctacc gcaatgatgc aatccccact agcatgtgct ttaactgtgt
    88561 gaacaaatcg tctgtcttac aaaaatatcg ggccaaagcc agtgagtatt tttgatcttt
    88621 gtatacaaga catgatagta ttttgtttct aaaatccgca tcgtcatggc caccaatcat
    88681 gataatagca atctatgata attgtacaac caaccagtcg tctcgccatc gtgttgccct
    88741 tttgtgcgat ggcagcgctg cttcttagat gacatgttga aatataagtg tgttgttgcc
    88801 tgtgttgttt ccgccttttc tctaaatggt cttggattat gtgcctcatc tgccattcga
    88861 gatcttcgaa acatttgagt catttgtgta gtcattttcc tgaatactat atttactcag
    88921 atatattcaa gtgtaagttc atcttcatcc ttgtgttatc gacctatttg tttaaaagtg
    88981 tgctgtgaaa gaaactcact cgactctcgc cccctgcctc tctttccccc catgtgcgca
    89041 gtcacctatt ttaacctgtc actcacacaa cactcagttt ctcactcatc cagaatagca
    89101 gtaacaagac aaaataaaaa ccaagctcgt tcacattcca atagtcgtct ctgacgtctt
    89161 tttattcttg ggctcactca catacaagat acaacagcgc cacctgcagc aacgctccta
    89221 caaatatccc tcttcatcgt cgtcatcatc ctcatcgcta taacacatgt cctcgtactc
    89281 tggtgtctgg cagcgcagcg cggccgagtc tgcaaacagt tcaatggccg ttgtcgccgc
    89341 tgctggcgcc atctgtggtt gctgctgttg ctgctgcgcc cccgaagggc acggagaaga
    89401 gtcagacaga gtgctcaggg cggagatggc cgcgacccag tcgggctctc ctgagggttc
    89461 aatgtgagca cacatcatgc tgtcggcgcc accggtgtca atcaccggag agctggtaga
    89521 gaagggcgtg ggccacacaa cgggttgctg cggaggctgc tgttgcgaca tttcctggga
    89581 tggtgcaaag ttaatctcat gtccagcaca catcaccgcg ggcgccgcag gagccatgtc
    89641 cgtactcgta ccgagaattg cctgctgctg tgcttggggc gaagcggcct ggggtgcggc
    89701 ggtcacaaca gcctgaatat ttccatgact ctcactgtta ttctcgaaaa ctgtgcggtc
    89761 ccggttgagc ggagacacac cagaggcggg gcgaggaggg gtggcgatat gggtagttgc
    89821 cacaacaaca gggttgggaa caacgggttc ctggtatgag gcaggagaaa aggcgacgac
    89881 tgccgtttcg ctgtgctgcg gtgtcgacac tgccatcatc gaaggaatcg gtgtatcctg
    89941 ggggtcatcg tctttctgaa acaccgtgag gtcgaccaaa cacttggtgt caaacgggca
    90001 ataggccaac ataaactggt aggcctgcag cgctttttga atgcgcagtt cacagagttc
    90061 attctgacac tggtgttggt gcagggcgtt caggatcagt tcagccacca taccgcagcg
    90121 gtaggaacat atggcgccgt tgtcgtcgta ctggtccaga aagtgcggcg tgttctgaat
    90181 ctgtctgctt cgccgtcgca gcgccaggat ggctcttgaa aaagagcaca catacgccaa
    90241 ggcgcggtgg atggggttct caaacacctc gggcggccgt ttctggagct ccagagcggt
    90301 gtcgcgcgtg cactcgtcaa tcatctggtt gggtttcctg accaaattct tgagcgtctg
    90361 gcagttgttc gaccattctt ggccgttatc caggatgcag gccaagtcaa ggttgttgag
    90421 tttgttaaac atgagctgcc gcagcccggc tacggtggcc atgtacgggt cgtacgggtt
    90481 gacaggcagg ccgtgcacaa agtggtattt catgtagctc agggtctcgt ccaccatggc
    90541 cagcagcgcg tgcatgctgg gagcgttgaa gatggagaag gatttctcaa tcaccagacg
    90601 gcgtagcagg gacgcgggca accagtcgaa ctgctggcgg atgtttagca gataatcagt
    90661 gttcatgagt tcatcgtgcg acatcagcag acgtcccggc tgctccttgt cctgtgggaa
    90721 agccgtgggt tttttgagat cgtcagggta gggagtaaga tgcaagctct cggccgtgta
    90781 cctttgcaag tcgtacactg gcgaggtggt agagctgggt tgcgaggagt cgtctcctct
    90841 tacctcgctg cccttcagtc tctggcgctc ctctttcttt ttctcaatca ttcggctcag
    90901 ctgacgcagc tggttctcgt ccatgctatc aagctcctgg ttgatgagcg ccatcatgtg
    90961 tcgattgctg ctcgtggccg gcgacacggt caccgcctcc tcgccgccgt gacggtgttt
    91021 ctgatgatga tgctgccgaa tgtgagcgcc cctggagttg ctggaggcgg ggtgctggcg
    91081 gtggtgggag tggtgatgat gatggtgtcg catcaccacc gtggtctgag gtcggcgtcc
    91141 cgagtcgggg cctggcggtg gggattcggg cgagtcgcgc accggcggcg agttctgctt
    91201 cggttggtga tggtgcggcg tgcacgccgc ctcgtacctg gatcgcttga acgggggcgt
    91261 gtgctcgctc tcgtggtcca ggcagaagcg ccgtgcccgc tgagcacggc gttcgcggtc
    91321 gctgagctgc gagagcgcgg gcccgccgcg gtatctcttg tgcagatcca tgtcttgcca
    91381 gggatgactg gcaacgtggt gtctgttcgg ggtttccgcc acggtgtata tatgcgaagg
    91441 agccggggcc ctgtgacgtg tgccttcggg gtgtgtggct actggtcgct cgtgggcggt
    91501 ctgagtttca cggaaatgtg cacgttcttc gcgttcgaat gacatttttt tgtaaaacag
    91561 cggctccaaa ggctggccca cagcgcgtaa ctatgttcgg tgcgtaggtc gatgaacacc
    91621 tgcacagttt cctgcgggtt gcggtgggta tagttcaggc agcggaagtc tttggtgcgt
    91681 gagccttcca gccgcttgac ggaaacgcag tgggggccat ggggcttgaa tgttagcgta
    91741 tgtggcggga cgaactgctc gctcaccttg ggctcgtagt gttgagtcag attttccagt
    91801 agcaagggcc acacgcgcgt cactactagc ctctggaggt cgttaaggtc acttgcggga
    91861 tcggagtcgg ggcgtccaga tacctcgcca cgtaaatggt atccgatcac gtcagacagg
    91921 gtgcgctttt cgtaacgtgt cacatttacc gaccgcgttt ccataaagtt aatatctggg
    91981 gaaggacaca acttgtcacg cacaccgagt atgatgcggg tgcatgagaa cggcaaggag
    92041 gggtggtcgt caggggacaa agaggaggaa gaagaatacg acactggcgg tctcggtgac
    92101 cccggtggat aatgcggtgc gtgatggtgc aacaggttgc gaatgtctag ctgagcacgc
    92161 acgaatccca agggatgttc cctaaacccc tcaggtacga taaaaatcgg gaggagacgg
    92221 cggtacatga agtaaccgtc ctcctgatcc atcttgtaca taaacggcag gcggaccgag
    92281 cgtccgtggt gataaatgcc cgtatctaaa ctactttcag ggtgagaaat gggatctagg
    92341 tgctggtgta acaaggtatc taggcatatg gcatggttca gcacctgtgc aatggaccgc
    92401 agcaccgagg gtcgaataac taaggtgcgc tccggaaagg gacagatgat acgaagcccc
    92461 aatttctctg aacatttaca ataatctgtt cgggtttcgt aggaaggtgg cgggttatcg
    92521 tcgtcataga agtcaggggt gaggtttttg caggcacttt tgaaaaagta cactgggtgg
    92581 tagtcgggat tcgtgtgttc gaacagactt tgccagaccg ttacccacac acgacggagg
    92641 ccgcgacaga tttcaaaaag aacctcctta gacaacccag tcaccccatc ccgtagtcgc
    92701 agatcaaaat ctgcaataaa gttatatgtg ggcaggcgtt cattaaaaat ttcatgccgc
    92761 gtgtaataaa attgagtctc ggcattagag ctagccacat catcgtcatg gagccagatc
    92821 atgtccgtca gggcttcgtc agtgaactcc gtatcgggga cgtgtttcaa gagatcgcta
    92881 ggaaacaggt tctggtgcca gttttcgcat gtaattgcac aaaagacatg gtgatcattg
    92941 ggtaattgca cacgaaacag gggaatggga ccgtcaaagc gagtttcttt gggtatcaga
    93001 aactggcgtt gcgagtactg ggcgagggag ccggtggcgt aggtgttggc ggttttcagg
    93061 gacgcgcaca gacgtagcag tccggacagg gatctctcga gtacagggaa cacggagtcg
    93121 gacatgctat tgatggtgtc caatttgcgc ataacttggg acgaagtgcc aaaaaatcct
    93181 gtgagagtgg gtccggtggt ctggtggctg tatcccgaga gtcggagatc gtagttttcg
    93241 gtagatagaa tgtgtgtctc gatgtagtct tgcaagaagt tgggcaggga gaagtacttg
    93301 tccatgacgc tcaataaatc atccgcgaga tggcggccca ggaacaatgg ttgttgtctg
    93361 cactgttcct cgcgcgcgcc ctcgtcgtaa gccaccactt cgcggtattt tatcaggcgg
    93421 gacctggaaa gtgccgttct gtaggccaga tagatgtaat gcacgcagac agtgtcgggt
    93481 aggcgggcct gctcgcgaaa agtgttaatc tgcctgtcaa cgtgcaccag ctcatcgtag
    93541 tctcgctggt tgcgcgccat ggcgtattgc acgaattgcg ggatgcggga ccgaaagggg
    93601 gatccgagca gcatgcgggt gaattcagtc atggtggcgt gagtgggaat gatcgcgccc
    93661 agatctctgg agaagctgcg tacgtattcc tcgacggtgg gaatcgtgct gtactggcgc
    93721 tccagcagat agtaggacat ggtcaacagc acctgacctt cggtgtgccc gaaaacgctg
    93781 atgaaccatg atggggaagt gggacagaga aagatgaggt tcaggtaacg cacgatggcc
    93841 gagtggtgga aatagaccag gtgcttgaat tcgcgcacct cgccgccgtg ttcgggcgag
    93901 atgacagtgc gaaacaggtg gttgtagatg ggtttggtct cctcctcatt gagactgtct
    93961 accagagccg acagcgggat gggctggtga gtgtgtaggt agtgcgcgag gttcaggacg
    94021 tcgttattga ccacgaacac cggcgccacg cgctgagagt cagtgcactt ttgggtctgt
    94081 aaacagaagt aaactaggtt ggaggcgtgg tgtttgacca gtaaggggaa cacacagtgc
    94141 tcagacacag attttgaaag cacgttagcg actatatgag cagaatcata ctctgtcgcg
    94201 aacagaacca gcgtcattgt cagtgaagga tggacctggc ccggcgcctt tggggttttc
    94261 tcagctgcca gcggcgagct tcagctggag cagactatgt gctgctacgg cccagcgaag
    94321 atgtgaacat gcaggagatg cagtcctttt ttgaggagaa ctttgggacg ctggggatca
    94381 cgcccgagga tttgaaggcg tttgctaatg acgatgaagt gacgaagcac ttactcaagc
    94441 ttattccttt gtatcggcac tgtcaggtca agtgtcgaat gctgcaagac tacctcgcgg
    94501 atagttgtca gccgcatacg cggcctgccg ccgaagtaga gaatcaaaaa tcgcagcgta
    94561 ttatgcaggc tttagacgtg atgattttaa agttggtggt gggcgagttc tccatgtcgg
    94621 aggacgatac tttggaggtc ttgctcaata agttttctac agatcaggtg gcactctgtg
    94681 aggttcagaa ggttatgggc ctggtggaca tggattgtga tcagagtacc tcaattttgg
    94741 atgcggctgc agcagcggct gccgccaacg cagaaaactg ttctgcggca gctgaaggcg
    94801 gcatcgatga aagcgttttg gcaatgattc cgcacccgcc tcaggaagaa ctgcctgttg
    94861 tggaagaggt gtgcccccct acaccaatac cgcctccctc aaaacctaag cgaaaaaagt
    94921 ctactgcagt gcatatgtca gtttgattga cagatgtgaa tgtgtcgcaa tataaataaa
    94981 aacacgagaa acataattgt gcgtttgtgt catttattcg ttttcgcacg caaggagttg
    95041 ttgtaggatg tggtgttcgg gcatgtgggt gaatccggtg tctggggtcg gtggcactaa
    95101 gagttggccg atggggtgat tatggactaa aagatacacg aaacggcggg tggtgaacac
    95161 aactttagcg acagatgtag tgcctgatat atagacggct gaaccggagg tattgaccag
    95221 tgtgactgtg gctacggttc ccggtaacca gatgacgggt cgaatgataa tccccagttg
    95281 attcatctgg cgagtgccca ctatcagggc gcaagtgctg ggcgcgtgga taaaagcagc
    95341 gtccagatac accgtttggg tgtggcccgg ttgaattatt atgcgttgat gcaaacgtag
    95401 agcaaaaaag tagttttcgt tagggggcga tatgttcatg acttgccaag gttctggaca
    95461 gaaacaaggg aagatacaga gatcgccctc gatggtgccc ggcgtgatgg cttggaacgt
    95521 gtagttcaag ttaatcacgt ccatgctgag attctggagg ccgggttcga tgagttccgg
    95581 catgcagacg aattgagagt ccaggcattt gtagaatgtg attccaaagt atccgatagg
    95641 gacgtagaga ttgatgccca gtggagtgga tgtattgggc tgttcggaga gccagataat
    95701 gtgtttgttg taaaaggcca attgcatatg ctgctgtcga acgatgaagc tggaaggaat
    95761 ccatttgtaa ggaacgtttc tgcgtgggga atagatgttg gattccggat gtcgaaacac
    95821 attttggaag ttgaggttgc tagcgaacag tagacagtag cggagattta cgctgtgttc
    95881 gtcttgcggc tcttgacgtt cgccattctt tattaaagat gctcttctcc acaagcgttg
    95941 gaagcgggat ttgtgttgtt taacgaggct cagttgctga tctagcctgt ccgagagcac
    96001 gttgagcatt gtgctctggg atagcgtggc ggagcagtca tgcattgcaa gacgatgtta
    96061 agactgtttt tatgggcgtg cttgattgta atatgtgtgg ccaacaatac atctacagcg
    96121 tcaccgacga gtaaacctac tactgtgaca accttaaaac ctataagaaa gcatgcggaa
    96181 gatgattttt atactgcgca ttgtacttcg catatgtatc aagtttcttt gagatcattt
    96241 gcttctattt ggatttgtat gaacgtggtc attttgataa tttcattttt tgttgtttta
    96301 cgccattgtt gttttcaaaa ttttactaca actacggtgg caggatactg agagacaaat
    96361 tggtaggtcg aaggcgtgtt tctatgctgg tattacgtct aatttcttct ttaaaagcta
    96421 gactatcaat atggtcccat aaaggatcta taaataaact gttattaatt tgggtggtgt
    96481 tgctataggg tggtgttatt tcatacaaag tagtgagatt cacgataccg tgaatgctcc
    96541 agacagtatc gttatataat atttgccgtg tatggttagc ccaggctgat tgacgctctc
    96601 tgtttctaga tttatcgcaa aatggttctt gattatatct tatggtagtg tataaccagg
    96661 ttaccatgtc ttggagttgt gtaacaaaaa ttggtagtgt ataattttct gatgtgtcta
    96721 caattacact ttcctgactg ttgttgtaca atttagttgt tactgtaggc ataatagttg
    96781 tagtggtgtt gtttgcggat cttcgagatc ttttttgtgt gttattcttt tttggttttc
    96841 gtcggcggtg caaacgtctc attccttgtt ttaatttcca aagtgtaatg tgagggaatt
    96901 taaaaaggtt acggctcatg gcgttagtta ggtaaaaact tttggaacag ttgtatctaa
    96961 gtaagtttcg gaatataact tcactaagtc ctaaaaagta aatggattga ctatcgagga
    97021 caacgatgtt ttttccaaca taaattcttg tggtccatcg tggaacgtta tataacattg
    97081 gattatatgt ggtattgaca tcacatgctt gttctcctgt gttgttgtgt aatgatatat
    97141 taatcatttc agataaacaa ttcatggacg gaatggaacc gcatgggggt ggtaccagga
    97201 gcatagacga gttagtatgg ttgaatttgc acataatata gttactgggt tggcgatgtt
    97261 gaagagcgtt gaaatcatac cagaagtatg taatactctg gttgttaata ggaccagcaa
    97321 gtattctgta tttgtctgga aattttggca ttggaattgt gtatgcgtaa ctacgaaaag
    97381 tgggattttt aagtgcttgt agcatttccg gactgtatgt cgtggttttt gcttttttct
    97441 tactgcaggt aagataactg cagctaataa taacaactaa ccagatacac cacattttta
    97501 tttcagaacc catgacgtct ctgacaactg gtatactggt gtgttttgtc tatgccttgc
    97561 tgttaacgac gcttctaatg gttagttatc gctgcctcat cggttttcaa gatgacatcg
    97621 tgactcgatc ctggatggtg ttcaaagcgt gccgacaagg cctgtataat acgtctcgtt
    97681 gaataaatat cattacacca caatgtatat tgtcagtgtc tttatttaat tacattagtt
    97741 ttacaatgcg gtacaaaagg tagagtccaa caatagctgc caaaatataa attacaatca
    97801 gtgcgatatg cgtgtccgtt tggtcaacca ctgcttccgt gacttcaaac actgtaccgt
    97861 ttttgaggaa catgaggtaa tgagtttttg gagattttgc tatgacatgg ttatcataat
    97921 tcagtgcaaa gagcaggtca tctgtgtcgt agatgtacat ggcatttact ataccttcag
    97981 aatcgtcata ctccaccagt gtgctttggc agaattcaca gtgttctaaa gtgatgtttc
    98041 gaatcattac aatgggtaat gtatcgtgtt tgctggaact gggtgaacac gtgctgttgg
    98101 caggaatgta agttatgatt atgctgcgac cgactacggt tgttagcact gggaaagagg
    98161 ttccttttgc aatgtactcg gtagatacta aatatgtcgt tgcatgtgaa actgtaaagg
    98221 ctgcaaaaga tttggtagtt gatacgcagc tgatttctgg aaaggttgcc agtgtttgtg
    98281 gtcgaagagt ttctagaaca gatagagctg tttttatggt tcgggagttg gttgctctgg
    98341 ggaacatttt ttgaagatgt tccagggcgt ggtctctgcg gccgctgccg gcacatggac
    98401 tgtaaagatc gcttacatga ttgtgttctt cgctgccgat taattgtgac caatgtgaca
    98461 attcagctag agagcacagt cctgtttcga atgcaaatat ggctcgtctt tctgtagaat
    98521 ggtgtaacat tgaatgaata ataccgctgg cgaggtagag ttcttgtcga gcaaatcggg
    98581 ataagaacga cgatatatgc gttttgtgta ggagtagaat gagattacgg atttgttcca
    98641 tgtcgtgttt gctgacaagg tcttggtggt gctgtttcac caagatataa attaatcttg
    98701 aaattgtaag gacgcttgag atgtgtcccg tagttctcag agtggagttt gctagttgta
    98761 ctgcgttagg atacatgaga agcgtggtgc gtggttgtat ttttgacatg caactggaga
    98821 tgaagtcctc agccaggaga atagaagatt gttgatctat ggccagtgcg atggatgttg
    98881 gtgttgttgg agacgtagat gctatgtaaa gaaggattcc gtagcctagg gccgtttcca
    98941 ctgttgcctt tgttgtgcta cgacactgtc cattttgaag cacgtttacc gcgtgcctgt
    99001 tccaagtgga aaggagaaca tctagatcca tatagttttt tgaaagtaga ctatctgcaa
    99061 aatctgtggc cttgatatat gtgtgataat gtatatgatc ttttttaacc aaaacaatta
    99121 gttgatgatg tttcgtttgt tttaaaataa agttttctcg tctgtagggg gctttgaaca
    99181 ttatccgttt agtgtctccg aaaataagaa gcagtggtgt ttctctaata accacagtta
    99241 agacgacaaa agattctgtt aatgttattg tcatatagtc gtgttcagtg acgtaaaaag
    99301 actggtataa gcatgattct cgagtggtga aaagcagttc atggtctttg aagagataac
    99361 atgtgccgtt gaaggctggt gcatgtattt tagatgcatt tacagtagtt ggtttaccat
    99421 atgaggttgt agtttggagg cggaggtttt ccggaggagg tactgtggat gcttgttctt
    99481 ttagattatt ctggtaactc aagttttgtc catagtattt gtactgaata ttgtcttgag
    99541 aaactgtagc gtatgtgttt agagtactgg catattgttg aaatgttttt gatagatcca
    99601 cttggttcag taggttgtcg gcaaattcac cagtgaaaag gcatcgaggt aattgaaata
    99661 ctgtgtaatg gtttgcactt tcataaaaat taaaagtaat ggcattctct ctgactaaag
    99721 taaggtttcg tcttgtgccg ttgttgttgc attttgtgct attttgtcgc aaaaactgaa
    99781 tgggtctgcc ggtgagttcc aaggttagat gtgaataagc gttagatgat gtctcggcgt
    99841 ggcatgccag cagccacgct gccaggacac acagtgccag gcctcggcgc atcgcgggtc
    99901 tcggcgttcg atggacaaat aaaaccagga cgggtcttaa agtcgcgacc tggcctattt
    99961 aatacgacgt aatttgcggg cacgtcgcgt cgacgagctc ttgtcctgca atgaaagacg
   100021 cgtcatgtcg ttaggaagcg gggcgatcac ctctctgggt gacttaccca actttcgcaa
   100081 gcgaaacgga cagaaaaagc atttagatat ttatcgccgc attgtgcggg cctttccgtc
   100141 ctttgtggcg tttaaccggc ttctgggggg gcttttcccc acttactgca aaaactatcg
   100201 tcggtggctt tttttcgagg tccgcttgac acagcggatt ccagactgtg tggtgctctt
   100261 tgtgtcacca gaggctccca gacgggtctt atgctacgtc atcgagttta agaccacttg
   100321 ctcggacgct gatgggcagt ccgtgcggca gcacgtcacg cacaacttgc agtatgtgca
   100381 gggcctcaag cagctcaagg gtgctctgac ggactttgag gctctcaagg tgcctcgagg
   100441 ggattcatgg tccgtcatcc ccaccatcat ctttttccag cagcaagcca cgcagccctc
   100501 tctcgctcgg gctttccgct ccgcaccctt tactctccga acagattcgg tcattgacta
   100561 cctcaaacgg cggcaggatg agtctgttgc aaccctacta tcggctaccc atcgttctgt
   100621 tcgagcctca tgccgaaaac attctcaggt gtcctcctca cgtgctacaa aggctagtgg
   100681 acgactccgt cgcggggctg cgcaaggagg aagtggtggc caaccaggta agaaagcgtt
   100741 acctgcgcga agagctcagc gatctcaacc aaagaatcca gacgtactgc gaagacctgg
   100801 aaagtcgcgt gtccgaggcg gaggcgctgc tcaaacaaca gtgcgaagtc gatccgccgc
   100861 cgtgtcagga cgtcgccgcc gcggcaaccg ccgcaaagga gatttatagt tctggcggtg
   100921 ggcccgaagc gccgcctcag aaggtcacgc gttcggaccg cgctcaagcc gcaacctggg
   100981 tggcgcaatg ctctgatcaa gaaaaagagg ttctcttttt tggaatcacc aaaaacgacc
   101041 cctttatccg gtttcatact gattttcggg gggagctcat taacaccatg ttcgaaaacg
   101101 catccacctg gacatttact ttcggggtct ggtactatcg cttgaagcgc agtctgtata
   101161 cacaaccgcg atggaaaaaa gcattccgcc tggtgcagat ggaaaacttc tccatctccc
   101221 aggagttgct ggtgggggcg gtgaacgctt tggaaaacgt aaccgtgtac cccatctacg
   101281 attgcgtgct ctccgatctc gaggccgcga tgtgcctttt agccgcttat ggacagaatc
   101341 actgggacgg acgtgatctt ccgacctcta tccaaggggt ccttacggaa ctacctcact
   101401 tattgaataa actctcggat gaggtgggtc gtgagatcac cacttgggac ggtacggcca
   101461 ccgcgaatta ctatgcctat caagactccc ctgatctcaa gtactacatg cctctgagta
   101521 gcgggcgtca ctattccccg ggaacgttcg atcgtcatgt gttggtacgc gtgtttcacc
   101581 ggagacaggt catccagagc ctgccaggat atggggcgca aactgcggca gtggtgcaag
   101641 agcgcatgtc gggacaggtg cgggatgacg gtctttccgt gtggtgtagg cgcctactgg
   101701 cgggcaaggt gggtcgtgat gtacctattt tcgtgcacga acaacaatac cttcgttctg
   101761 ggttgacgtg catcagcgct ctgctgctca tctggaaggt tgtcaactcc gagagcgtct
   101821 ttgcgcctcg ggccggcaag tttacgctcg ctgatatctt gggtaacgac gccctcccgc
   101881 ggacgagctc ggaggatgac agctacagtt acgggcatag ggtcaggaac tttgagttcc
   101941 tccttgagca ttacatcgtg ccgtggtata ctcgggatcc cactgtcacg atttctcaat
   102001 tatttcccgg aatcatgctc ttggccatca ccgagagcgt gcgcagtggt tgggatcctg
   102061 cgcgacgcaa tgatggacag gccggtgacg gcagcgggac cgtgctgatg caaatcagta
   102121 aggtcaatcc ggtggccgat ttcatgttcg cacaaagttc caagcagtac ggggaactga
   102181 agcgtttgga actgcatgac gcattgctgt ttcattgtga acacggtttg ggacgtcttt
   102241 tgtcggtggc tttgcctcgt catcgtgttt tcgcactggg atcgtcatta ttcaacgtca
   102301 acgatattta cgaatgcata tactttagtg tcttaggttt tcttccggct gtcgtagtga
   102361 tgtaagtgct tgtggtttct gggcagcata aaggaccgtt gtcctgcagg tgcgggctag
   102421 aaaccacatc agaacacctt ctgaacgggt cgttgtgagg tgctgccgct gcttcacatt
   102481 catctgaaac catgattacg gagcgcgtcc tcgcgggcat cctcgcgggc atgacggccg
   102541 cggggagttt ggtcattctc ctcgcggttg ttatgtggtt gaacatgtta gatcgcgctg
   102601 gcatgccgat ggccgttgga cactacacag ggaacctggt gcttgctcag gtcctctgta
   102661 tcttctccat gctggcgtcg aaaattgttg ccatgacgag tgcggccggc atgggcttct
   102721 gcggcatcgt ggtctttgtg gaagactctg gcctctatgt cacctcgctg ctcttcatgt
   102781 tcatgatcct ggatcgcatg gcggcttttc tcaacgggcg tcttttctgg aggcagcaga
   102841 cgacgaagca gaatcagagt acaagcgtgt acattattct gttttgctgg gtgctgggaa
   102901 tggccgcggc tgttcccagc gcggctgtgg ctgcacccaa ttccagatgg gaacgctgcg
   102961 aagttccagt gtcatatgcc acaattgaca tgatcgtgaa gctctggttt gtgctgttgg
   103021 cacccttcgt gctgaccatg gctgtgatca ttcaatcttc ctatcatcgt gaccgggaga
   103081 ggatctggta ctatgccaga cgcgtgttca tgttctacac ggcctgcttt gtcatgatgg
   103141 tgccttatta cttcgtcaga gtcatgcaga gcgactttgc tttggttgat ataaaagcaa
   103201 aaacaaaagc ggcgggcaac ggcggttgtg actcgacatt tcttgattat ctggacatgt
   103261 tcactcaagt gcttaacagt tttaagttgg tggtgtttgc tttattcatt gtcctgtttt
   103321 gctccataaa cccacttgaa acgctgggag aatgcttgga gagggccgat gctgagaggc
   103381 aaagtcggtc agaagcatcc cagggtgaaa gaaggcggcc aatcaacaca tgctgtgtca
   103441 agttggttga atcgataaaa cattatgtga gcactctctc taaagctacg agggaaaatt
   103501 ctgacgagag ggccaattta ccaaataatg ctgaagatat tggaacaaca ggcagtgatc
   103561 agctaccaac tgaggtcacg gtgaccccaa gttcatcggc tgtgtttagc actggaggaa
   103621 cggtgtctcc agtctaacgt gctcttgtgc tgcgtgtgtg actgactgac agatctggtg
   103681 gatgatttat gactctgtat atcggacggc gaatctgtgt acatgtatat cactgtggtt
   103741 acatgtcacc gcatgccgtg ggtgtgtgca gggctttggc tgaggccacg gcctcgggat
   103801 tcagtgtcat tcgcggggtc aatgataatg tgcccgcaaa agctttgtaa tcttcaataa
   103861 taaaagtgaa aatgcccatc tcgtgtcgac tcctttgaat ttcgaacgcc tcgctgctga
   103921 ttgtcatttt gcctgtgctg atcaaataaa agtaccacat tttctgacag atgatgcgaa
   103981 tcaggggctc atacgtggct gtgccccagt gacgggtgaa aaaagcggcc agacggaaca
   104041 atctgtgtcc gtacagtgtg cccagagaga acaacagatt gccgttgcgg gccagatctt
   104101 cgggaaagga aatcagcagc cccgtgtggc gctgcacgaa gcggcttagt aacgctgtgc
   104161 tcagatgagg ctggctcagt ttctgactca gttgggcggc ctgttcctca tggaaaataa
   104221 cgtggaagtc gagctgaggg aacgtgcgtc gcagttcctg gtacagatgg ggccagtacg
   104281 aggtcggcgt tttgcggctc agaacggcgt tatcggacac gcctaggttg ttggtggttt
   104341 cgcggagtag caacgtctcc aggccgcggt taaacagtaa cacgcagata agcctcagaa
   104401 tcttgagttc ctctagccgc agagtgttca gcggctggcc ccgtgacatc ttttcgctaa
   104461 tctgtaatat tagatgattg gcacacgtaa aagagaattt gccagttcgc actcgagcct
   104521 catccgtcgg gctggacatg gcagctcccg tctatgtggg aggttttttg gtgcgctacg
   104581 acgaggctcc cgaggaggcc gagctggttt tgccttccga cgtggttgac agatggctgc
   104641 gcgagtcacg cggcccgctg ccgctaaatg tcaatcacga tgagtcggct accgtgggtc
   104701 atgtggccgg gctcaagaat gtgcgagctg gtttgttctg tttgggtcgt gtcacgtcgc
   104761 ctaaattttt ggacattgtc caaaaggcct ccgagaagtc tgagttggtg tcgcgcggac
   104821 ctccatctca gtcttctctg cagcccgacg gcgtgctaga gtttctcagt ggcagttatt
   104881 ccgggctgtc actctccagt cgccgggata taaacgctgc agatggcgcc tcgggcgatg
   104941 caaaaacagc gtctttcaag catgtggcca tttgtagcgt ggggcggaga cggggtacat
   105001 tggccgttta tggccgcgag ccagattggg tcatggaacg cttcccggat ctcacggagg
   105061 ccgataggga agcgttgctg gctcagctga caacaacagc cgcggtcgcg gggggagagg
   105121 aggaggacga cgttgtaagg aaaaagaaca acaataagtc ccaggggccc gacgcggatc
   105181 catttcagtc cgatccgtac ggcctgttgg gcaacagcgt cgatgcgctc tacattcagg
   105241 agcgccttcc caagctgcgc tacgacaagc gcttggtagg ggttaccgct cgggagtcgt
   105301 acgtgaaagc cagtgtttca cctgccgagc aggaggcgtg cgatattaaa gtggagaagg
   105361 agcggccgaa cgagtcacag cacagccgag cacccggcga gtccatgtct caccccatga
   105421 gctctgtggc cactccagcg gcctcgagcg tcgcgccctc tcaagcgtcc ttggcactgg
   105481 cccatgacgg cgtttattta cctaaagacg cttttttctc gctcatcggg gccagtcggc
   105541 acgcgaccga ctcggcggga gcgcgttccg tgtatccggc tgcacctccg caccatgcgt
   105601 atccggtgat gaattatgag gacccctccc gtagttttga ctacactgcc tggttgcgga
   105661 gggcggggta cgacgcggga catccccaat accctcctgt cccttttcat catctgccgc
   105721 cgtatcgtcg acgtgatttt cccatgatgg atgacagtga tcgcatggct tgggagcgcg
   105781 ggtacgcgca tccttccaac tatgactctt atggcaataa tggtggtaat tcgtggtcgc
   105841 gcggccgaaa cggcggtact ggctcgcaca acaacggcaa caagaggcgg agggaccgag
   105901 atttatcttc ctctgacgag gaggacatga gttttccagg ggaagccgag cacggtaaag
   105961 ctcggaagcg gttgaaggct caccatacgc gaggtggagg gggagatcac tcctccgacg
   106021 ccaagggtga tcaccgctac gatgaaatca gagaagcttt gcaggaactt agacgcgaga
   106081 tgatggccgt gcggcagatt gcgccgccgg cgcttctcgg gcctgctcaa ctgacggtcc
   106141 caacgtcgtc acccacaacg acgtctcacc cgtctgatgt ggtgactagt gaaccgcctc
   106201 aaacatcgtc gtcgccaccg tcggctcaca gtagcaagtc agctgatcgc ggggtggtga
   106261 acgcatcgtg cggtgtgtct gtacaaccac aagatggcgg tccaacaccg cccgtgaagg
   106321 acattgtgga cttgaaccgc cgtttgtttg tggccgcctt gaataagatg gaataaatca
   106381 cacatacaca gtgatgtttc tttgttcata aagctctttt ttttattatg tacaacaaaa
   106441 tattattaca tggtacgcaa tttattgtct gtctcttttc gtttttttaa tttaaattcg
   106501 gggtcgttga ggtcggccgc tgggggagcg acggccgggg atttgtgcta gggcttgaag
   106561 ggtggttttg aggtcggcgg cggtgcaaat atctccgtcc agttcacttc ggagatacga
   106621 agtatttttc accgcctcct cggctattcg ggcggtcagg ggcagtagca gatctgggtg
   106681 aatatacaga ttccatgaag gtacaactag cagcatggcc gttttgggta atctctcacg
   106741 atgagtcatc ggaggcgtgg tgccttctcg tttggctttt tgggtttctc ttcgcagtct
   106801 gtccatggtg gtttgcggct cgtcgtcttc gtcctcggat gagtcttcgg tttggaaggg
   106861 gtcaaagatg gcctccgtga taataggagg agtaattgga gggccttctt cctcctcgtc
   106921 ttcgctggaa gacgaattgt tggattgctg ggcgaattcg gagatgccgc gtaaaatgga
   106981 gtctctggga actaagcctg ctcgaagacg gatctgagag catctcgggg tttcggtctt
   107041 gttgggcaat acgccgaccg agcctcggcg aaataagtgg ataaatccaa gcatttgcat
   107101 gtgagccaag gttatcgcgt tagctgtcaa attctgcacg ttaacggtaa tttttgtgcg
   107161 gttgggcagg ggacccgcgt ccatgctaat tcccgggagc tccaggggaa agaacacggc
   107221 gagacaggta tcctgagttt ctagcgcgtt gttgaattgc accacgtacg tttgatgagg
   107281 ggggatagtc acgttcaggg ggcatttcat gagaaagccg ttttctgagt gtctctcgaa
   107341 gaacgggttg gggttgtggc gccacatcac ttcagcgcgg tgagcgtaca cagataattg
   107401 taaaaacacc tctgtaggtg ggtggaggga gaaatggacg agcgacacta gaatcacatt
   107461 ctcttcgcct atggtctcgg ctttctgaac atatgtttca ccgttggaac aggccagctg
   107521 gtcgatggcg tctactaagg tgagaggtat gaggcccgtg aggaaggtaa agtcggtcgt
   107581 aaacgtgtaa ccgccttcaa cgtactggtc tcgtttacga gtccacgtga tagcgctcac
   107641 attcaccttc acagtccagg tatactgggc tcgacggatg gtggtgcggg cgttggctct
   107701 cggcggtcga ttctggctgt ttcctcggcc gcggaacagg tggatgcctg tcacggggac
   107761 gcgtaccaca gggagcgcga aaaccagcat agccgacgtc tgcgagccgg gtgagaggcg
   107821 ccggttggca tagttgcacg cgtccgtgcg cagcgagtct cggaacgtag aactgcagtg
   107881 ccccttgaga tttaggtccg taagctgcaa cgcgtcgcga gaggacttca tttcttgaaa
   107941 agcgcagatg acggcccgat tggccacctc cactgaggtg tgccagttca tcgtctgcac
   108001 ggcatcgatt tccagcgggc tgtgttgcgt gcagacgaga cgcaggattt ggcaggtgag
   108061 gcgttcgaag gtgacggccg gggcgagggc tcgagaggta gacggcctgg gctcttcttc
   108121 ttcctcggga gggcgatcca tgatgcggag aatgcgagag ctggctggag gccggtgtca
   108181 atgacgtgat ccgcaaatac agcacccact gcttacctaa gaaatatgtg tgcggtatcg
   108241 ggggattggg gtttttatat agttatgggc ttattcacag ggccttttgc taaccgactc
   108301 gccactggta gacggtagct gctcggaagg tgagtagtgg cgacgtttgg gggtttgata
   108361 catgtgccaa gaacccgaga ggcctgagaa gatccggagg tcgtcgtcgc cttcccagga
   108421 gaattcttgg tgaggtagtt ggtcgccgca gacgctggcg atcatgggag ttaattcgct
   108481 agctcggaca ccaaattgcc atactcccca gaacaaagtg ggaaaaaagt cgtcattgtc
   108541 gtcgtcggag ctgcttttcc ttgctccgtc atcttcggta aaacgtttgc gctggacgag
   108601 cggtttgtaa agtttctcgc gctttttaga tgcggaggat gatgatgttc cggcgtgtgg
   108661 tgtggtggat gcgacctcga agacgtccat gtcctccgat tcggaggagc tggaatcatc
   108721 gtcttcgctg gagtcttgga cgataggaac gcctttgcct tgatgatatt caaaactggt
   108781 cgtgatacgg tattgatctc taaaaatgga atgatcagtt tttttatacg taaaaaacaa
   108841 gctgcgatcg aaaaaatgga gcgaggctat ggcctggaac gcctcgatgt acacactgtc
   108901 gtgtaggctt ctgatttcta taaagataca ctgtgtagac ataatcgggt tgcatgatat
   108961 actgcatccg ggaacgctat tggggcaaat aaagccaata tatttgtcag attcgaagta
   109021 tgtatcaatc atgacgttgg cgtgttctct gggtttcagg tggagccttt tgggatttag
   109081 aatagtgtag ccgttccttt gttgcggcgt aaggaagggt ttggggttgc ggttcatagt
   109141 gataataccg ctgctttgtt cccaggcgag atgaataaac actttgtcgt ctggggtttc
   109201 ttcttggaaa gattccaaga atattcgtac cagtcctttc actttatcga cgagttggac
   109261 ttttctaacg tgtgtattgc gcagagagca caccagttca tttgcgacgt ttatgctcca
   109321 cagcggcatg gggcttgtat tgacataaaa tgatgcggtg tggtgcacgc cgtgtggcat
   109381 ccagcggttg tatctttggg tccattggag gtgatacgcg ttgaaacggg tatgataccc
   109441 ttgggcaaac gcttggacag cggcatcgta agtgggtaac tcgggattat acgttccgcc
   109501 tggatggagt gttaggtcgg cgggtacgag gtgtctgagc ggcagggcat aaaggaaaaa
   109561 ggacatcggt tcgtccgcag gcgtaatggg tttgtcagta ggattgtgca catgcaaata
   109621 aacatctttc aattcttggt cttcaaacgt cgtgtgttta atttgaaggg tgttgtgctc
   109681 gtagcgagga tcgggtttca gatttcgagc gaactgtgtg agaaagatga tggacggccg
   109741 atggacctgg acgcggaggc ctgttttgac aatcttggtt tcgtgcggtt tgacgggttc
   109801 acgggcttca tcaaacacgc tttggatgac tttgccggcg atgggcccca attcggatac
   109861 ataatcgagc cggtaacgtt gcgatagagc catgtggact gttgtcgggt gcttttgcga
   109921 ctgacagctg cctgcggggt ccacatgacg tcattcataa cctaactacg gtgcttttta
   109981 gtaaccgaga ccgtgcacga ctctggaatg gcttctaagc gtgtgtggcg acggcgtctt
   110041 tgtgtttgat agggctggag atcgatttct atacccgaaa aggtgcgata gtcatcgcct
   110101 tctccccagg gaaaatcttg gtagggtagt ctgtcgccgt gggcgctagc cacaatggga
   110161 accaagctcg tagatttgat gccgcattgc cagtttggcc acgaaaaaac gagtgtttcg
   110221 cggtcgtcat cgtcttcttc tgactcgtcg ctcgtttcgg ccttggtgac gcggtgtttg
   110281 ctgcgcgtcg tcatggtgga cgatgccgcc gccgacgatg atggttttct gctgctgctg
   110341 gatggcggct gagatggtcg tcgcgcagaa ctaccactgg gcggatggcg gaaaacctcc
   110401 atgtcagagt ctgaggcgga ggagccgctt tcatcgtcgg cctggtcgcc gtacacgtga
   110461 tggtattcca gcttggccat taggcggtgc tggtcgacca aacgcgcctg ggtaggttct
   110521 gcggcggtac ccttggtgag aatcattttg cgatcgaaaa agtacaacca gccaagttct
   110581 tcgtactgtt cgatgtacag gctctcgtga acagctttaa tctccataaa caagttttgt
   110641 agcggcaaca gtgggttaca cgacatgctg atccccggga tggttctggg acagatgatg
   110701 gcaacatact tgtcggactc gaaacaaacg tcgaacatga ggtgtgaggt ttttcccggc
   110761 ttcaaatgaa gtgtctgcgg acacagaatg gtgaagccgt ttctgtcatg tgccctcaga
   110821 tacggtttgg ggttgcgatt catcacgatg tcatgattgc cgttctccca agcgagatga
   110881 acgaagcatt ttgtttcggg agtatcttcc tgaaggcatt ccagataaac cttaacttca
   110941 tccttgctta ttttccgaat attcgtcacg tgggtgtgcg gtatcgagca aacgagctcg
   111001 ctggctgtat tcatagagcc cagcggcatc tgctgactat tgaaaataaa cgatgtcgtg
   111061 tgataaacgc tgttggctgt gtatcgactc tgatttcggc tccacaccag gcgagaggca
   111121 gtaaggcggg tgtgccattt tttgtcatca atctgttgta ccacggcgtc ggcaaccgtg
   111181 gtgcgacgct tgtgactttc tccctggcgt aggatgagct cgggaggggt gacaggatct
   111241 agcggcaagg catatacgta catagacagc ggttcggtgg tggttggaat gggtcggtcg
   111301 gttgggttgt gtacatgtac gacaagcggt tccaaacttc gaggctcaaa ggccgtatgt
   111361 ttgatctgaa ggtttgtgtc atagcgctga caaggctgcg actcgggcgt aaactgtgtg
   111421 gccatgatga ctgacggctg attgactgtg acattgaggt gtgtatccgc gatgtaggtg
   111481 gtgtgcggat tcaagtgttc tttgttggca ttgaaaatga gttttacgag gtggcccgac
   111541 gttgggccga gatcggttac caaatcggga aaccgaggcg gtcgcgaggc catgttgtct
   111601 gactttggtg acaccgccaa ctgagctgcg caacttggct catagagcta tttagatgtt
   111661 atggcgccag aaaaaaagga gatacaacgt cattatgtac aaacggtttt attacggggg
   111721 ggatgcggaa ttttgtggct gttgctgctg cggttgtcgc tgattacaaa ccatggcgat
   111781 agtgaccggt ttgttgttgt tggtcggcga ctgttgttgt tgtgtcgttt ctggactggg
   111841 gttagagagg cgcatggggg ctaggtcctg taggctgaac gaggcgccta agagggaaac
   111901 ctggtgcggc gtgccgtgca gcgacgactt gacctggttg gccaaggcgg aaagccggcc
   111961 gcgattgagg ctgtgtttgg aggagataaa gtacagttgc cctagcacgg tgtttttggg
   112021 gatgtgtgtg ttgtcgccga tgacgctgat ttccagccaa gtccgtggga gccagatggt
   112081 gactggcatg ttcagttctt ggcggttgtg tgggatgaag agtcccagga acggcccgta
   112141 aaagcggcgg tagattcgga tcaggtggga cgttttgagg gaaaggtcgt acggcaggca
   112201 tacgtcgaga cctccgccgg gctgctttct ggggagaaag tagggcagcg gcgtgtcgga
   112261 gaagaagggg cgcgtcacgg tctgctgtcg gaggcgcagt ttgaacgaga cgatggggtt
   112321 cgatggcagt tggtgctgcg cgctgcggaa ggtcacgttg aatcgcaaga tgttatcctg
   112381 atacaggatc agcgacgaaa ggatcaggtc cggacagtcg gtgtctgtgt acagctgtcc
   112441 gaaagtggcg gggcccatgt tttggatggt ggcgtccgac agtcggacgg agatgcggct
   112501 ggcgaggccc cgcggtcccg aaatgcctcc ctctgcggtg tgccagcaga gggcggactt
   112561 gaccggtatc gtcagctcgg aggtgttgct aatcttgtcg ttgacaaagg ttaaatccgg
   112621 caggtgtaac gatacgcagt cgtgcagcgc actgtgctga gtgactttcc gccgcagcgg
   112681 cagctggtgc ctcaggggcg gcatggtttt cagggcgaag atgttgagcg acagtctcac
   112741 gatagacatt tgggtcagtt gttcttcgat aatggctcga atgatattgc aactcccggc
   112801 ctgagcggga aacgggctga ggatagggaa gatgtctgag tcggggttgg cgacggcgca
   112861 tagcaagcct tgttcttcgg ggtcgcggtg cgggctgagc ggctcgagct gcagcagagt
   112921 cgaaagcagg atctggaacg ggtgctggag gtcgctgggc tgaaagtcca cgtgcagctg
   112981 aatgagacga tatgtgccct ggcgcggcag cggtcgcttc acatggtgct gatctgtcaa
   113041 ggtcaggatc gtctcgtcca gcagcaggga aggtggagtc tttcgagggc ggccccgagg
   113101 cccattccgt agtgttttgt cggcgcgcgg catggtttga gactgatggc agctgtggga
   113161 cggctcagcc tttaaatatg caggtagcgg atttgttatc gggtgacacg tcacagaccg
   113221 tgaacatgac ctgttcgtgg atgatatcat cgagttgtct cagcatgaca aagagtgccg
   113281 agagtcgaga aatctcctcg tcgggcgaga catggctcgg ccgtcctcgg aggagtctgt
   113341 tgctgttgtt accgccggta ccgtcgtcgt cgcggttcag tcgcattaag agttcttggc
   113401 acttggtcag cagcatagag ctgtcctcca gggccagctt gcggacgtag ttcacggtga
   113461 gatcggaagc gaggttggcg accatggaca tagacagaca agcggttttc atgtccagta
   113521 gtaggtggtt ctcaatgacg gggtcgggaa tggtgaaggt cgcgtcacga aacgtcacgt
   113581 gttgcagttg attaacggcg gccttcactt cttcgtacga gcggtccagc gagtagagcg
   113641 ccatgattag gatcctttgg ttgatttcca cggcgagcgg ggctggcagc agccacggga
   113701 ggacgagatt ccagttaccc acggagaccg ggtgctcgcg cacgagcggt cccgaaaaga
   113761 gcgggggtag ttggcagagc gcatcgccct tttcccagag cacaggcccg gtattaagaa
   113821 cggtataaag atgtccgtgg gtgggcactt gcatggccag ttggttgccc tcgattcgcc
   113881 gcaagatggt cggcgtcatg tttcgtaaca gactgcgaag gcgcgcatag ccgcgggtgc
   113941 tgtcgatgta ctggtgcaag cccagatgat ggtgtttgat gaggtgatgt cgctgcggga
   114001 tagggataat ggctccggtg agcttggcga gtttgcccac gtccgtgagg ctaagttttt
   114061 gctcgaaggt acaaaaaatg gtgctgtcca tggcgccggt ggttcgtccg gccccgacta
   114121 gcgtgctctg tcaaatagtc ggatgcgatc tttacgagtt aaataacatg tgttggtgca
   114181 gtgggatggt ttcgcctatg atgtagtttc caaagtgggt ttccgacgtc gcaagtgagc
   114241 ccgacgggtt tttgagcttg ctctccatga gggcctgcgt ggtcgtggaa agaatgggca
   114301 gcgcctcctg catcaaccgg caggggcact ctatcagctg ttcggtgccc tccacgcaga
   114361 tgtattgagt gtcagtgtcc ccccggatac agtctttggc tcggaggagg tactcgtcga
   114421 tggtcttaaa caacgtcttg ttggcgttga ttatctcttc tgtattgaag aactgtgcgc
   114481 acgggctgta gaactgcgag ttgtagccta aacgctcgcg gtttttaatg ttgtacatga
   114541 tgtcggcgag cgagccgcgg ttggacgccc aggggttgtg ggtggaggca aacgtctgcg
   114601 cgtcgggctc cgtgtggtcg tacaaagttt tgatggccgc gtcggtatcg tacggatcca
   114661 cacccagcat gcaggaggtg cgaccgcgcg ggttgtttgg gatcttgaag taattaatgt
   114721 ccgtgctgac gggtgtgatg atgagttcac acgctgcctt ttgtccgtgt agattggcca
   114781 ccgagttttt ctcagacatg ctgccgaaag tcaacatgga gatggtctcg gtgtcgagga
   114841 attgcggcct atccacgccg gccgcgtggc ggatccaacg atctacttcg tcgtgtcgat
   114901 gtacgtgcat gggaaagacg cggaataggt tctgtacgcg cacgcccatg tcgctgcgtg
   114961 aacggttgag atacgccacg caagtagccg aggtgtatcc gaggcccatg tctacggtgt
   115021 tgatgttttg agtgacatgg taggtcgtgt tgatgtctcg ctcttctttg gtcacttgcg
   115081 ggttgttgat gatgagcgac gtgcaggatt tgccgctgta gagcagcatg tcgacctcaa
   115141 acgtgtcagt ccgcacggct gtcagcccga aacctggatg aacgccagat ttggccatca
   115201 gggcgataga cacgggggaa atcttgtaga gcatacaggc cagggtaagg acggattgca
   115261 aggtgttggg acagccggcc gtgtaacgcg agaagggcga ccgcagccag ttccagtact
   115321 cgtgtgcgaa ggcggtagcc agcggaaaac cgccatcgtg ccggtggtag tgcggaaagt
   115381 cagtcacgaa acgcttgata tcgtcgttga gcgcagcgca gatcgtggga tctgagtaga
   115441 aacggtggaa agggacgacg atgcagtact cggcgaggat cttgggtgcc gtgatggcgc
   115501 agcagccgtt gtacagaacg tgctgcaagg atgtgaaatc ggtcgccccg tggcgttggg
   115561 ccgggtccag ttgagcgcgc acttccaaga ccttggcgtg ctcgggcacg aactgcagaa
   115621 ctaggaagag ctctcggcag gcctcaaata ggttgacgtc ttcgttggtg gcgatctcgt
   115681 cgaccagctg ggttaacatt tctccaactg attctggttc ggtgggcata gtgaaggcgg
   115741 ggcgatagaa aagatcgact attagagttt tcaggttcag tccgatgccg caggcccggt
   115801 tgttggtcat ggcgggaaga aggcataggt agaaaatctt ctgcagcgtc cactcgtcgt
   115861 cggtggcctg atagtcgtcg acgaacaggg gttcgtcggc gtccatggcc gccatgcggg
   115921 gcacgtccga aactccatga tggcgagact cgatgttggc ggtgttgagc ggctgccggt
   115981 cggcgatgat ctgcacgcct tcgcggttcc gaggcaggtg acacacgaat ggcggccaga
   116041 gacgatggtc gtggagcgcg ttggcgtagg ctgacagggg ttcttcgact aactggccgt
   116101 tgttgaggcc cggcagggaa gacacgcggg tgacgagccg caggatagcc ataatagtac
   116161 ggtagtgggt atggatctgg gaggagagga ggccgtcgcc aagatgttcg acgatcatag
   116221 cgatcatagt atagctgtgg gcgaaagcca gcatttggcg gttctggaac gcgctgacga
   116281 tacatctggc gatgaacggt cggataacta agaaggcgtc gacgttgccg tgcaccagca
   116341 agtcgactag gtaaaagagt tcgggatagt tggggcatgt cacggtgctt ttgaacaact
   116401 gcaaggtggc ctcgtagtcg ggaggcggtc tgagtcggac catttcggct atgtgcgagg
   116461 cgcgtagttc ttgaaaggcg ctgggcgcca atccgtccgg gatgttgccg gtcacgattc
   116521 ggggggtgca cagggtggca gtctcgccat tctcctggtg gtgcgcaaag tcaaagaagg
   116581 ggtggagttc ggtataaaga gacaagtttc ctatcttgta aaagtcagaa ggtgtgtagt
   116641 cctgcttcat ttcgttaggg gtgcgcggca cttctcgacg cacgcggtaa aagtgtgtga
   116701 ggcgtctggc tatcccggcc atgctctcct gttgaaagcg gcattcggtg agtctggcca
   116761 cggccgggtc ggttggcacg cctcgctccg tgaagacctg caggcagggc gtcgcttcgt
   116821 gaacgaccgg gtggcacaga cattgcagcg cgtccacaaa gtcgagccgc tcgagcccgc
   116881 ggtcgcggtt gagaagatac acggaggtgg gcagcgcatt gtctttggtc tctgtgagtt
   116941 tgattttatt ttccaccgtg gtgtaagccc tgctctctgg gatgtagagc cctaccggga
   117001 agaagaaagt aagatcgatg ttgcgttcta gggggttttt ggtgtcggtg tttttgtaca
   117061 cgtgcctgtg gtgttccagg gctacggcgt gctctcccag ctgcagaatg tccatgggca
   117121 gagacgtttg gctgttctgg ccagctttct ctagcgagga gccggtaaga tcggggttac
   117181 ctgaggtaag gtgagctgtg taggagttga aatcggccag aatggagtgg tgggcgatgg
   117241 cggtaacggc gttttcggga ctgaggacaa agttaccgta cgtggccggg gcggagacgc
   117301 cttgtttact gatgttgctt tttaggagcg tcatgagagt ttggatcacc tgagcggtgc
   117361 tgaccatgac acctcgcagc tgctgcccgg aggccgtgac atacgtggcg gggttttcga
   117421 ggatactgtt ggtggtggat tccaccattt tggtcaacag tttgaggatg tagtcgcggt
   117481 ccgacgtgcg attcagcaga aagatagtgc tgatcatctt tgttttgaaa ctctgtagga
   117541 tgttgctgcg ctggatgcgg ttcaaggcct gtcgacagag cgtggcgttc tccaccagcg
   117601 tctgcaccac gaagtaagga ggcgctttgc gcagcagcac ctggatgaag cagtggatga
   117661 ggccgcgttc catggcgtcg gcggtgtttt tgaggacccg cagtacggtg tgaatagcct
   117721 cgacattgag gattttgtcg aggatggtgt tttcaaaggt ttctcgcagg tgcgtgaggc
   117781 acgccgcgct cagctcgaag gggatggtga tggggctttt ttcactgtat ttagtgacca
   117841 tgatggtggt ttggcgtgag gtgggcattc cggcgccgct ggccacgcgc ggcacctgga
   117901 tgtgaaagag catcttcccc gtggttagtt tgtttaggtc gtcgaacttg atggcgtgcg
   117961 cggccgaggc cagggccgtc tgaaggaagt acacccattc cagacggttg cagaaggtgc
   118021 cgaagatggc ctcgaagtgg atgttgtagc gttccgggtc gtccccgaag taaatgcgca
   118081 ggctgtcgaa catttcttcc ccggcgctgg ttttgacgtg cgtgaggaag tcggcgggga
   118141 tcccgacctt gggaagaagc tcgacggccg accagttttc catgacggcg tgtgacgatg
   118201 gcttcgtcgc caaccgtctt tcagtgtcgc gcggctcagg acgctctaat agtggagtcg
   118261 accgcggaac cccaggtcgt caatgtcccc gtacacgtga attcgtacaa tctcacccag
   118321 gagctgtcgt ccgtcgagga cgctcgcttc tgccagacgc agccggtgga cgcggagcgc
   118381 gttcgcggcg tctttggcgc gctctaccgc gctgcggccc cgcacctgcg agaggagagt
   118441 gaccgcatca aactgatcct gggacgcctg ttactgggac ccgtcgccgt gccctgctac
   118501 tgcgacgaat gggaagcgaa tgagtatatg gtcgatgcgc ctcagttttg cggaggccct
   118561 ctgctgtatg tgcaccgtcg ctgtcactgt ccgatcgtgg ggcgcgcgct ggctttcacc
   118621 gtcatggaag gacacatcgc cacgcacgta tttcgaggac tgttgtcgct cagcgagtgg
   118681 aaccaacact tgccggacat gttttgtccg tgcggttcgc tggacagacg ggaccgctac
   118741 agcatggctt gtctgccgcg agacctcacg ttgtacatta atgattaccc ctatttcatg
   118801 atggagatag ggcgcgtgct cactgtcagc gaggtggacg actacgtgag tttaatgatt
   118861 aactacctgg gtgaggccgt aacgcctcgt ctgcaagtac attacaagct gttgttcgga
   118921 gttaacgtga ggcccgtggc gccattagcc ctgatttcga cgtgtgagtt ttttgtgctg
   118981 gaactacaga agatgtggct cggggtggaa tatcacaacg aagtaacggc ggattttttc
   119041 ggccgcgtgt tttcgcagct acatcgtgat cggggacgcg taatgatggc cctacggctg
   119101 cccgagcaga ctgtgtgcca cctcagccat tttacccttg gccgctttaa gcgccaggtg
   119161 ttgtacttta agctgtcaat cacgtacggc aagtacaaag cgggggtagc gaaaaacgtg
   119221 ttgtgttaca ggcgtctgag cctggcgttc ggggaacacg atactgtgtg gagaaatctt
   119281 ttttacgtat attacgaaat cggtcggatc ggaacagtga actcctctga atcccgctca
   119341 tcacccccac caccaccgtc gtctacccga cctgtcaatc attcacagcc tcctcccgct
   119401 cgctggtcat cggcgtcgtc tcgcggccca gctacaacgg ccggcgtgac gacccaccga
   119461 gattcgagcg gtgaccgctt gaaacgttac gtgtgcatta tctctcggct catgtttgta
   119521 cggtacggac agacataccg cagggagaaa cacgatcacg tgtttgattt tactggtcgc
   119581 accctacgag aagccgcgca gcagcagcgc aggcaaaaac agctggcggc gcagcggcac
   119641 gccactagtc ggcgaaagtt catcgggggt atggagtttt cagagattac gggtgtcagt
   119701 ctcgatcgaa tcgccgtcaa cgcatttaac accaataggg tgattaatat gaaagccgcc
   119761 ttgtctggac gtgtaggttg tcgtgtcaat cgattgccaa aaaatatgac tcatagtttc
   119821 gtgatgtaca aacatacttt caaagaaccc gcctgcactg tcagcacttt tgtgtcgaac
   119881 gatgctgtgt acactaattc tctaaacgtc aatattcgcg gctcctaccc cgaattcctt
   119941 tattcgctgg gcgtgtaccg tctacatgtc aatatcgatc atttctttct ccctgcggtg
   120001 gtgtgtaaca gcaattcgtc tttggacgtg cacggtcttg aagaccagac tgtcattcgc
   120061 tcagaacgca gtaaagtgta ctggacaaca aactttccct gcatgatttc acataccaac
   120121 aatgttaatg tgggatggtt caaggccgct acggccattg tgcctcgcgt atcgggctgt
   120181 gacctggaag ctatcttgct ccaggagctg tcgtgcatta aaaacatgcg agacgtgtgt
   120241 atcgattacg ggttgcatcg tgtgtttacc aagatggaat tgcgaaactc ttatcagatt
   120301 ccctttttgt ctaaacaatt gattcttttt attcgcgcat gcttgctaaa actacacggt
   120361 cgcgataaaa ggctgtattt ggatcgacta gtatttgagg ctgtgcaacg gggtgtgttc
   120421 gattatagta agaacattac ggcgcacacg aaaatcaaac acacttgtgc tttaattggc
   120481 agccgtttgg ccaataacgt tccgaaaatc ttaacgagga acaaaaagat taagttagat
   120541 catttggggc ggaatgctaa tgtcgtaact gtgtgtcgtc atttggaagc caacaaaata
   120601 tcccgtgccc gtctcaaagt gttggtggac gtgttggcca ctcttcaggg tttgagcgag
   120661 acgactcata cacagaacgt gatccgccag actctgttgc gtctctgtgg cgcggtcccg
   120721 tcatccgcat cttcctcctc ttctgtttaa taaaaattgt tatggataac gataaaaaca
   120781 aagctggtgt ctccgtctct tccgacgagg aattacccgg acctgggtgg cgtgatgccg
   120841 ctctgattat gcataacgga atggttcgcg aacatatgtt ttaccatccc gatgtggcag
   120901 agattgtacg gagaatgatt ccgccgccgc ccgatgcgga agagggatgt gtgttcgctt
   120961 cggagctcgc tttctacacc agtggtcgtt gcaatcgcgc ttcgtcggtc ttttccatat
   121021 attggcagaa caacagtgag atagtgtacg cgctgactgg catcactcat tgtatcaaaa
   121081 tcgtggttga gtgcggccag gttggctcgg actccgtcga aagacagttt tacgacaccc
   121141 ctggaattta tctgatccgt gtttcggacg gcacagtggt gccacgaaac gtggtgtggc
   121201 cgggaaccag cgttcgatgg tcgaaagaag tgggtattcg ggtcgttcag cggcgcgtca
   121261 ccgtggctcg ggcatttgtc agtctgttca gaaactatct tttttggacg aagcaaccgt
   121321 tttccgagga cctgtgccct tgcccgcaag atgtggaaga tcggctgttt cctctactaa
   121381 atctgtcgcg tggcgacatt gaggtttttg acaagagggt ttgctgtgcc tataaacggt
   121441 tacagaaaaa cgatcttccg cgagcgggac ggcgtttatt agatcattgt gtgaatctgg
   121501 ccgcctccaa gaagatttta ttactagatc tacctcgatt ggaaaacttt tttttagcgc
   121561 aggtatgttt gtatgaactg gatgaggacg aggtgggcga ggagctgctg ggcatgttat
   121621 gcggaaaatc taccgaatcg gactctacgt ttctgttaca tcggaaaacc atgaaggtgg
   121681 cagcgtgtat agcctttatt ttgaactgtt tttacaaaca tcaggagcgg ttaccagaag
   121741 tcaatcagcg ggtggatgaa tgtgacttgg cggtgatcgc tctgcgacgc tactaccggc
   121801 atcatgccgg catacagacg cgcgctatag ctatggcgca aaaatttttg actgattatt
   121861 ccgagtcgtt ttctccgttc aaaagctttt ctcgcatgga ggtccaggta cctctggacg
   121921 cggccgtcac tcgaaaacag ttagtatctg tgctacgctc ctaactggcc ttgaatcgag
   121981 cggtgtatat gtcatcgcag aggtatgtgg ccataataac tgcaaccacc aggtcgtccg
   122041 agtacttatg gtgccttttg gcgctgtaag tggtattgcc ctctgccagg gtaattcgat
   122101 gtaaattctg aatttgttct aagagatatt ctatggggtc atgattaagc tttattgtat
   122161 atgaaacaat ttcttgtgaa gctttaatgt accctgagtt gaatcgagaa ataaactgtt
   122221 caacggctag gcgtttgtcg cgccccatga ggtagaaagg ctgttcgatg ttgttctgat
   122281 cgggcgtgtg gtaaaacaac acggggatca gactgttgca ttgcacattt tgacggatca
   122341 gacaagcgat acgcacggcg gcggcctggt tggagttgcc ttccaccgct atgcgcagct
   122401 cgttgatgta aggatggagg ttgatgaccg acgtcagcat gtgtgctgcg cattcggcta
   122461 tagcggtctc tgagctttct gacaagtcac gcagaaagta gtgttcgaga ccgtaaatga
   122521 tgaattggtg gcgatacaga cccaccgcag caatccccgt gccagaagcc ttgcggttgg
   122581 tggtgaaggc cggatcgagg tacacgtaga ttgtttttcc aaaatgttcc tgcgcattta
   122641 cattcagggt gctgtagcgc agaatgtcaa actcgtcacg gctctggtcc gtgatcagca
   122701 cgttactttc ggtgatcttg ttggtgccgc ctatgatttc gtccatgaac gaacctggca
   122761 taaacatgtt ggcggtcttc ctcacctgag agttgagact gataaaagtg ggtttatgca
   122821 ggcgatagca gggacacgcc gtggcgtcgc ccttctccgt aaaggtgtgc aggtgttcct
   122881 cgcacacgta agaaaccacg ttgagcatgt cgaacggggc attgttgagg cgggtgagga
   122941 agcaggtggc gtcactagtt gtgttggtcg acgaaatgaa gatgatcttg gtggtgtttt
   123001 gcgccagaaa acccaggatg gtgttgaagg cctccttctt gatgaagtgc gcctcgtcga
   123061 ccagcaggag gtggaaattc tgtccgcgaa tgctctgagg gatagagaaa taaacaaggc
   123121 ggggttagca ggggtggaac cgaggcctat gacgctcggc aacgcccgcg tcaggtgtct
   123181 acataaaagg tgaggtggct tccgcctggc acgagaacgc ggccatgaac gcgctgttgg
   123241 cggaactaaa tcggctgggc gtgtcgcatg taaccacgga agatgtgttt acttttgccg
   123301 aaaacgtgtt tcacaatttc ggttttcttt tccagaccga agagtcgggt cctcggaaga
   123361 ttgatttagt gtcgtcgctt tttgagcacc tcacggtgga gtgtgtcaac gatatcctcg
   123421 atgcatgcag tcatgaatca cccgacggga acgggacctc cgcggcacca ccgcatgcac
   123481 aaaaagagca aggtggcggc agcagcggcg gcgggcgcac tggacatgtg tgatgtgtct
   123541 gggacttgtg acatgaggca cgtgcagaac gtgtttacag aggagattca gctccactcc
   123601 ctgtacgtgt gcacacggtg tttcaggact cacctgtgcg accttgggag cgggtgtgcc
   123661 cttgtgtcta ccctcgaggg gtcggtgtgc gtgaaaactg gactggtgta tgaggctctg
   123721 tacccggtgg ctcgggagca cttgctcgag cccatcgaag agacgtcgct ggacgacgtc
   123781 aatgtcattg gagctgtgct ggctgaggtg tatcggtatc tcatgagcca cgcggctcgc
   123841 tatgccgatg tcattcagga ggtggtggaa cgggatcggc tcaaaaagca ggtggaggag
   123901 aatatctatt tcactttcaa taaagtcttc cgttctatgc agaacgtgaa ccggatctct
   123961 gtgcctgtca ttagtcaatt gtttacccag cttattatcg gtatctattc caagcagacc
   124021 aagtacgatt cctgtgtcat caaagtgagt cgcaaaaagc gggaggacgc gctgctcaag
   124081 cagatgcgtt ccgaatatgg aaacgcacct gttttcggac ttggcgtttg agcaggtctt
   124141 tgaggaggac ccgcagttac ccctgcatgt ggttttggac cctgtagacc tctcctttgc
   124201 agaggcagag accgtgcggt acgtgtacta ccgcagcgac ccggatcccg tagggagatg
   124261 gcggcgcgcc gcgtttcgcg tctttctgcg gccgttcgag ctgctcacct atctgcgcga
   124321 cgccggcctg acggtcgcgc cgaccgctcg ggtactttgc catcacgctt tattcaccac
   124381 cctgggaatc cgttgtgcgg aacagaggct atcgggggct cagatgctat acctgcgtct
   124441 ggtctggaac gaggagcgtt ttcgcgattg ggagtttttg gcacgcgatc tgctacgaga
   124501 agagatgagc gtgtgtcaat cgaccgagcc ggcagatcgg cccgatccct cgttgctcat
   124561 gacggatgcg atgcttgagc tggccaaaag cagctcaaca accgctccgt tttttgagat
   124621 gccgtcttct ggcacaggga acaacaacgc atcatcagcc tccgctgctg acgagagcag
   124681 ccaggtagag cgtcgcgtga tacagtttct ccgcggtgat tccgagttaa cttatcatgc
   124741 gggacctttg gaaccgcctt cgaaaatccg agggcatgaa attgtgcaac ctcgcataga
   124801 agtgaaccct gatgtaatct acgcctcggg cccgcacgaa gacgaccgca cgtctaaaac
   124861 ggacgagtgg cagaagggtg gtgtggtgcg actcggctcc gtctgggatg tgcggcaacg
   124921 tctgcgcctt cacgttctct ggtacgcaca atctttttgg aggtcgcgtg gcctcaagta
   124981 cgaagaccgc gaggaggatt tgcggctgac tctggactcg tatttcgatc gactctctgt
   125041 ggagtaccaa ttacttcgcg aggtgtatcg cgaaatcaaa gctgtgctca ggtcggatcg
   125101 catggtggct cagaaattct cctgtcatct gtctatagaa acttcctggc ttttaatttg
   125161 ggaactgttt gaccgggcgt tagaactttg gagggatcag gcggatgtca acagctgcat
   125221 tattaaggca ctagctcaca agctgcgcag taaagcacga tcgagccacg ggaacagtgt
   125281 ttcggcaggc aaaacgaacc ctacagagac ctggtacgcc gatgtggtgc gctgtgtgcg
   125341 agctgaggtg aacctcggct tagaagtgca ggtggagacg tgcagtcaga gcggcctgtg
   125401 gctcgttcgc ggtcgcgatg gacagctgag aaagtggatc actcagccgc agacgtacgt
   125461 gctgtacgcc actccgggcc tggtttttca ctgggttctg cctggcggct ttgccatttc
   125521 gtctcgagtg tgcctagatg gcgtcgggag ggatcacttc gaacgattcc agatgtctgc
   125581 gccagttctt acaaaaagaa tgttgctgga gacaggttgg acgaggacag aagcatcggg
   125641 aattccaagc tgtggcctgt agatcggcta ttttttcccc acccgggggc gatgccagtt
   125701 gtttggcatg tcagctgttg ctgttcaagc gaggaggaga aaatctgatc tgcttttctt
   125761 gtaatggcaa ttacatgggg acattttgct gtcctcgaat acagagagtg cgacaagatc
   125821 tcgtaggttt acacacaacg tacaaattgg tgtttttggg acagctaggg ccggcacgtg
   125881 ttgattttgt gccggccttt tctcctatga cgagcgtggt gcctcgatgt tccattactc
   125941 cctccctcct ttacgaggtg tgtactctgg tgcctccaga agaagctgag aagattcgag
   126001 tgaaaggatg ctcgggttct tacgaacctg gaatggaaaa ggccatcagc ctcggtggag
   126061 ccggggcctg gctggtgaac aacagcagcg gctacacgtt gtatttttac atactgtgtt
   126121 atgatctttt cactgtatgc ggcaacgatc aggaaacgcc ttccatggcc agactgatgg
   126181 ccttagcgac cgcttgcgga caagtgggtt gcacctactg taaggatcat ggaggacacg
   126241 tggatcctac cggttgttac ataggccctg tgccagacaa ggggaattgc ttgtgctaca
   126301 cgttatgtaa ttctcctacc atgaacccga tcactaatga gaaccctgta gcatttttct
   126361 gcgatgtgga gagagcgacc tatctgtgcg ccgtgggctc aaaaaccaag agcaaagtta
   126421 cgctagcaga tagcctggac tatcatatcg gtgccaagaa tgaaaccgga gactggctgc
   126481 cgctaaatgc gagtgcctgg cagttggtga gggtggaaga acccgtttct cggatgattg
   126541 tgtgtgcctg cccggtactg aagaacttag tgcattaaga aaacaataca tgtttgattg
   126601 acaggaacat acttacgttg gtgttataac agctggcgaa gagcgccgtg cttttggcgc
   126661 ccttgtgatc tatgctgatg acaaagtctt tgttttccac gacgtagtcc ttagcgaacg
   126721 tgtggcggca gcgaaattcc acctctttga gcacaaactg ggacacgtgc ttctggtgcg
   126781 ccacgtagcc gatgctgatg ccaatcatgt gcttaagcaa gaagcagatg atggggatga
   126841 tgaaccaggt cttgccgtgc cgtcggggca cgagaaacac cgtggccttc tgcttgaaca
   126901 cttccacgga agtctgtgac aggaagtcga tctcgaaggc gtggaccaaa tattgcagta
   126961 cgcgattggc cagtacggga atcttggtca ccgctataaa aaagataacg tgaatcaata
   127021 aattcttttg aaacggctcg agtcgaatgg gtttcgcgtc gccttccatg gtggcaaagc
   127081 cgccatctag ccacctcttg aagtccgtca taaagttgtt tatctgtaca aactgggggt
   127141 cgcgatacag ctcggtcagg gcgtcgagct tctgatacga ctgcctctga tcttcgggac
   127201 aggggagaaa gttcaggtta tccaaggccg tcttgaggtt ttcgtggaac aggagcgttc
   127261 gcctgtcctc ttccgagtgg tagtcgcgat agcgaccgca aaacgtcatc agggggagga
   127321 acgcctcgtt acagcagtgt gccagtccca gttcggggtg catcatttgg tagcgcttac
   127381 gacagagggc ggccacattg gtgaacgagg tagagatgca agagctgggg tgatttttgc
   127441 gctttaggag ctcttggtag cgctcctgga tccgcgaagc ggattccccg cgcagcatgg
   127501 ccacgtatgt ttctcccccc tcggcagctg ctgctgccgc ctcctcttct tctcctgctg
   127561 caaatactac aacaactcct ctttctttct cttcttcccc tgtgtctgta gtaccggatg
   127621 gtgttccgcc gaggtcggtg ggattgacag ctgcagccgg tattgccgct tccacagcag
   127681 tctccacgtc gttatgtgcg gtggagcgga tggtggaact ttccacccag acaccagcag
   127741 attttgaggt tcaggagacg ctacgcttcg atgaggccgt aaatatggcg ctagtggcct
   127801 gcgaggctgt gtctccgtac gatcggtttc gtttaatcga aactcccgat gagaatttct
   127861 tattagtaac caatgttatc ccacgggaac ccgccgagat gcctgcggtc ggggcagagg
   127921 cggagcgtac gttcccgaca cgtcatcatg acgtgttgga tggattttcg aatctgtccg
   127981 tgcctctacc accaccctgt ggagtgcggg attatgcatt gcacaatgtt gataggctga
   128041 cctacgaagg cgaactggtc tacgggagct atgtactgta ccgcaaaaat cacgttgagc
   128101 tgtccctgtc tagtaacaag gctcagtatg tggagacggt attgcggaac gcctacacac
   128161 ctgggcttct tgatcatcac aacgtatgcg atatcgaggg gttgctgtac ctgttgtact
   128221 gtggaccccg cagcttttgc tcgcgggata cgtgtttcgg tcgggaaaaa cacgggtgtc
   128281 cctttccggc tttgttgccc aagctctttt acgaacctgt tcgcgattat atgacgtata
   128341 tgaatctggc agaactttac gtgtatgttt ggtatcgcgg ctatgatttt ccatcggctt
   128401 cagattcgtc gtcgggaggt gatgacgacg aactgcgctt gcctttaaag gccgtctcgc
   128461 tcgatcgcct caaagaggtg ctgaaggctg tgcgtggacg cttcgtgggg cgcgaggtcc
   128521 ctacgtggcc cgcctcgtcg cggacctgcc tgctgtgcgc gctctatagc cagaaccgcc
   128581 tgtgtttgga tttggctagg gacgaggcca aaacagtgca ctatagcccg atcgtgatcc
   128641 aagactgtcc cgcggccgtg accgacgtca cacttagtca cattctgccg ggacagaccg
   128701 cggtcaccct cttcccggtg tatcacgttg ggaagctgtt ggacgcgctc acagaaacag
   128761 aagccggggt cgtgtctcta aatctatgac gtctgccaat aaaaacctct tgaaggaggc
   128821 gatgcgcctg agtctcgaga aacaacagaa tcagtttttg agacgcgttt acggacctcg
   128881 gcatcgcgtc acctctcatc actccttgca acttatgcga gtggcggcac gtgagcaaac
   128941 tcggtatagt caggcggtag tgggacaggt aactgagaac gtagttaggg atcgcgagga
   129001 tctcaaaagg gagctccagc gtgctagggt tttgcagaag gctgccgacg tcgacaacgc
   129061 tctggactct ttaattgaat tgaaggacac ggtggaggac gtgcgcgaca gctttgtaga
   129121 ttccgtggct agcacctgcg aggtggatct gctggagggc gacgataccg agtaagaaat
   129181 ttgtgtctat catccctgtc cgtttgtcct cacggctaaa tttccagcat catgtctaca
   129241 cggtccaagg ccaaatcccg gcctcggtcg gcgtctgcag aatctggtcg cccgtggcag
   129301 cctgcacccc tcagacgttc caaaacgtcg caacgacgag cctggatgcg tcaggcggct
   129361 atggctgcgg cggtgcgaga gagtcaagcg gcggcagcag cggcttctgc tgcatcatcg
   129421 acacgaaatg tcacgacagt tcgcaaaagc accactccgc cttcccccgc tgctatgctg
   129481 ccgcctcagt cgtcattgtc cagaggacgt accacttccc ggcaatctag tattgacgct
   129541 cctgttttat acgtagcaga cccacagttg cagtgctgtg aagattcgca ctggtctttt
   129601 gagtacgacg aggaagctcc gacgcaaaat acagaaatta ttcagccccg agcgcctttg
   129661 cgctccataa ccccttcggt acacggcaat gatgattgtg acgcggcatc gagccaagcg
   129721 tctcaggtgt cagtggacga agaacacgag gatgtccatt gtacctgctc taatgaacat
   129781 gttattgcta cctccatcaa gggtttggtg tgtgatgcct ctttgttctc acgaatgact
   129841 cagccagaac tctgtgaaat ggcagttacc tatctcctag tatatgtccc aaaggatgaa
   129901 aacttttgca aacgtgtgtg ctattcggta gacgtgactg atgccagtcg acgcataggg
   129961 tgtggctctt ttggagaaat ctggccaata gatcgcaggc gtgtggtcaa gatagccaga
   130021 aagcacactg aaaccatttt gagtgcctac atgtcgggtc tgatccgcac taaagcgggg
   130081 cctgaggccg aggagatgcc tggtgtgtat cacggactgc tgacggccac aggctgttgt
   130141 ctcatgcaca acctgacggt gtatcagcgc ttccacagcg acttgtttca ttttgagaac
   130201 tgggatctga cctcggttcc gagctatcgg cgcgcctttc accacttggc taatgctatt
   130261 aaatttctca accacacctg caaagtgtgt cactttgaca tttcacctat gaatgtgctg
   130321 atcaatgtca acccgcacta ccacagcgag attctccatg tagtgctctg cgactacagc
   130381 ctcagtgagc cctatcccgt gtgcaacgac cgttgcgtgg tggtatttca ggaaaccggt
   130441 acggctcggc gcatccccaa ctgtacacat cggttgcgcg agtgctatca ccctgccttt
   130501 cgacccctcc ctctgcaaaa actgatgatc tgcaatcccc atgcacgttt ccccgttagc
   130561 aatagcccgc ggcgcttttg tatgatcgaa ctggccgctc tggggaacgt gttggccttt
   130621 tgcttggtac gactgttgga tcgccgggga atagaggctg ttcacaatgg ccctgagtcg
   130681 ctgttgttca aacacgccgc gactgcctgt cacgcgttgg aaaacaaccg cctgacggct
   130741 tgctcggacg cctgtttact cattatggcc gcgcagctgt cttatcacgc cggcctgtta
   130801 ggcgacgacg gccttgccgt cgtgagtcag acagttagct ttgtagaagc caagatgtcg
   130861 tcctgtcggg tcagggcttt cagacgttac tatcacgagt gcctaggtgc tttgcccttt
   130921 gattacgtca gaaagaatct ggaacggcta ctggccatgg tggacggtgt gtatttatac
   130981 aattcgttcc gactggcggc gaacattagt accgaggagg atttggacgg cgattgtcgg
   131041 cagctcttta gcgactaggt ttgcggagga ggaacgctcg gaaagcgggc ccttccccaa
   131101 ccgcaagtat gtgggacgag acgggggatg agaacgagga cctggtacga ttactatccc
   131161 tgcgggacga tgagcccttg agcatgttta tcatgaacac tttcttgttg aagcaggaga
   131221 gttttcgtaa tctatctttt tccatcctgc gcctggcgta cgcctaccgc ttgtttacca
   131281 aggcggctcg gacctacggg ctggcggtgg ctgaggagtt tgtctccgcg gtcgcggccc
   131341 tggcccagga cgagctgctg cgtgacattc ttacgaatcg gtacgtggag tctcgggaag
   131401 agattcaccg ttcgcttcag agggtggccc agtgccaaga acgagaggag ctggtggacg
   131461 aggtctctga cgactacgtg tggctgagca aactgctaga tttggctccc aactaccgtc
   131521 agctggagct gtaccagatt ttagagaggg agtcgcgagg ccagtctcgt aacatggtgt
   131581 ggcacctgtt gcgtctggac tcggtgtcgg ccaccaagtt ttacgaggct tttgtatttg
   131641 gatgcatgcc caatgcgctg gcgcagcgct ctcgagcggg ggcgtcgccc ggtatccagt
   131701 ttggtttaca gcacgagggt gtggtcaaga ctctggtcga gtttcacgtc atgcacggcc
   131761 gggaaccggt acgcgatggt cttggcctgc tgattgaccc tacctctggc ctgatcggcg
   131821 cctctatcga cctgtgcttt ggggtgtgca agtctgatag cggagacgcg cggacgagcc
   131881 tgcacatatc gccctgcgcc agtgtgtacg aaatcaagtg tcggtacaag tatcttcgca
   131941 agaagacgga cccctttgtg caaaacgtgc tgcagcatgc tgaccccgcg tcggtggcca
   132001 agttcctact ctcacatccc attcctggtg tggaatttcg tcacgatgcc gatattccct
   132061 cagggcggga atttctgctg tcctacgacc cccttttcaa ggccaccctg aaacgcggac
   132121 gcccgattaa gcctccggag gctttgcgtg attacattca cgatttgctc tacctgaaca
   132181 aaacagaacg ctcggaagta attgttttcg acgccaaaaa tctggatgag actattaacg
   132241 ctccgcattc ccctgcgggg ccggtggcgg acgacgccgt ggaaaccgag ggcggctcgc
   132301 agcgcagctt tcacgatgaa gacacccccg atctgctggg acagttgacc ctttacgagg
   132361 tttcgcgctt ttccctgccc gtgtttgtca atcctcgtca ccaatattac tttcagctgc
   132421 ttattcagca gtatgtactg agccaatact atataaagaa gcatccggat cctgagagga
   132481 tcgattttcg agatttgcct aacgcacatt tggtttcggc tatcttccgc gagcgggacg
   132541 agagcgaagt ggggcgtccg ctctacctgg gcggccgggt gttcagttgc gaccacattc
   132601 ctctgttaat cattgtcaca cctgtggttc tggatcccaa atttaccagg catgtggttt
   132661 ctaccgttgt agatcgctgg agtcgtgatc tgtcgcggaa aacgaaccta ccggtatggg
   132721 tggccaatgc tgcaaacgaa tatgttgttt cttcggtgcc tcgtccggca agcccttaag
   132781 agacaccatg ggtagaccgg tgtgccttcg gtcttttgcc gatatagaca acacgtcgtc
   132841 agaggatgag gcagatttgc ttagtataaa ttctgatcga ctatcactaa cttcgcaaga
   132901 ctctatggcg ccggctccca aaccaaaaaa gaaaaagaaa acgaaaacac aatcggcgca
   132961 acacactacc cagaaagcac aactaactct ggccttaatg gaagatgagg atggctacca
   133021 ttcccctact cgtgtaacac ggacatataa tcgtccttcc cctcctacga aggcgaaaac
   133081 acctcgcgct gaaaagatcg ctgcgcgtcc ccccacgcca aaaaaccaga ggcgatcatc
   133141 aagccgctca tatgagtctg tatattaagc gtccctgttt tcaccctcag tacataataa
   133201 taacatacaa aaacaaactt tgggaacttt tttctttggt ttttgcatat catctttaat
   133261 aaaatcttta tgatacaatt ttacatgatt tgagtccgag cagtctttgt gatatcaagt
   133321 ttgctcctca gcggagacta agccatctcc tccacgtcgg aggtggccat ggaggcttct
   133381 ttgagagaag caagttcgtc tgtggcgggc aaatgcttat attttacact atgatgattg
   133441 cggaaatagc gggtgcagcg acaggccgta aaaccggccc agatgagaaa attgatggcg
   133501 aaggccacag ctacagatga agtgtactca ggtgtgtagg ctaattcata tttgataatg
   133561 ggatagatta ggccgcagag gccgcagaac gtaccgacgt gaaacccaaa ctgcactttg
   133621 acgtagcgat aaaacactac ttcaaggagc aggaagtaga tgatggagat aaatgcaaac
   133681 acgaaaaata cagccatgac catgtgcccg gtctggacga aaaaattatt accgaatccg
   133741 agacacagag acatggagat tactgctatg ttgaatccta gtagcatctg cactaagtta
   133801 acaatgagag tgcggtactg aatggtgcct tttagtttag gatgaattct ttgcaaacta
   133861 aacaagttct gcttaaagtt ttggtaattg gtcactaggt tgacattata gatagttata
   133921 cagaaaaagt gtagacaggc cataaacgcg atgacgctgg gaaggcggaa gctcatggcg
   133981 agggtgaaca attcgaaggt atccatcacc aggatgaaga tgaaggtgga caggctgtct
   134041 cccatgtagg cgatgtctcg tgtccgctgg ttgagattca aaccctcctc tttgcggtag
   134101 ctgattttca tccagcagca gatatagtag ataacaacac acagaaacac gatcatagta
   134161 aaggcaacgt acatgataat ctggacggtg tccaaaaaca acatgggagt ggttaggtgc
   134221 atcacgttgt agttgctcat gttcatctca gagtaatcca ccacgttaaa gtacgcacag
   134281 ggatagccca ctcctgggat gttcatcatg acaacgtgtc catcgaggtt gataaatgta
   134341 aaaactacca ttagcacgga gacgccccag atgcggctgt tcatccagtc caccttggag
   134401 gtcgccatgg tgccgccgcg gtggtggacg tcgaggcggt gccaggcgag tgcgtctcga
   134461 tgacgaaaaa ccggcgagtc gttaaatact tatggtgcgt gatgctcctt gagtctgtgg
   134521 tcggcgaagt ttccgcgcgg cgaaactgca ctactcctgc ggatttcagc cccgagggta
   134581 caacaccacg tccgagatgt cagccggcac aaccttcacg ggtgtcagct gtcatctcag
   134641 ctggtacggg atcattgaag acgcagtgcc agtagttcag tgtttattta tacacattgg
   134701 tcgcaacaat agcgagccga agcttcagac ttttatcgta cgagctgatc ccttgccggc
   134761 agcggatctg cgagtcgtgc atcgaggcgg ttatgcaaac ctggcggcca cagctgacgg
   134821 tgaagagcgc cagcagagtc tggaccggcg tagctccgtg ctggcacgcg tgctgctgga
   134881 aggcagtgct cttatccggg tgttggccca cccgttcagt ccggtgcaga ttcgcaccga
   134941 tcagcacgag ctagagatcc tagaagccgc gccagcgcta gatatcgagg ccgccgctgt
   135001 gtcaaacgca ctcagcctat tccatgtagc taaaatggtc attataggat cctaccctga
   135061 tttgaccgaa ccccgttcag ttaccgtggg cgaggagcgt gtgagtgagg aatatgggac
   135121 gcatgccaat aaaaaaatgc gcagaggcta ctatgccttc gatgtcgcca tgtcctttcg
   135181 aattggcgct cataaatatg tcttagaacg cgacgacgag gctctagtct cgcgtctgtt
   135241 tgagattcga gaagtctctt tcctccgcac ttgtttgcgg attgtcaccc ccattggttt
   135301 tatagcggta gcggtgacag acgaacagtg ctgtctttta ttaaaatctg cctggacacg
   135361 attatacgaa gtactgtttc ggggctttgc gggacaggct cccctgtgcg attatctagg
   135421 gcccgacctt tttgaagctg ggggaagtcg ctcttttttc tttcctggct ttccgcccgt
   135481 cccagtgtac ccagttaatg gcttagggtg cttattgcgg gaaacggccc tcgatgccgc
   135541 gggcgaagtg atatcttggt gtggccttcc tgatattgtg gggtcggtgg gaaagctgga
   135601 agttcagcct agcacactct cgctcggggt tcccgaggac gagtggcgcg tgttcggtgg
   135661 agaggacaca gatcctctgc gcatcaacgg gactgcgttt cgacaagcca gcgagacgct
   135721 ctttagccat ctatgtacac gtgcgggaga gggagaattc ctttcagcta atgtgcatgc
   135781 taaagactcg acccttcatc gcctagtcat cgtgaacttg gtggagtctg tagtggctaa
   135841 gtgtatccta gctcgagact ttaataccgc cctgcgcttt aataatcgac tccacaccaa
   135901 gaatgtttgc aaacagttta ttgacaatct gcgctatcga tcaggtcgtg ccttttggca
   135961 gattcaaagt ttactgggtt acatatctca acatgtaaca tctgcatgca cttccgcggg
   136021 tctgctctgg gttctatcgc gagggttttg tgaattctat gtttatgatg gaaccatgcc
   136081 tcacggaccg gtttctgccg agacgtgtgt gcggaccgtg gtcgagtgtt attggagaaa
   136141 gttgtttgga gacgtgccag gtcctgtgtg tcggttgcaa gccagtgctc ctggcattat
   136201 actgctttgg ggcggtatgc gtcttgtgag tcctttcggg gttgacgagc acgacgattg
   136261 gtggtcggtg gtgggtcagg tcttggggcg tttacccaca ttgtttcgaa agcggcccac
   136321 tgcacaggag ttggagtctg tttaccgcga agtgttgttt cgcttcgtgt ctcgtcgcaa
   136381 cgatgtggat ttctggctgc tacgatgtga tccgggggaa cacgaggtac gaccgcacgt
   136441 cggagtgatt gactgcgctc cgttctacgg cgtttggtcc gagcagagtg aaattattgt
   136501 acaatctcga gactcggcac tggcggccga aataggttac acagtgtacc tgaagagagc
   136561 gtttgtgatg ctaaccgcgt gtatggaagc tatgagcgta tgtaacgtgg cgctcgtggt
   136621 gcctgcgacg aattcttcat cgtcgtcttc ggcggtgtgg cctgggcctt tggaggagcg
   136681 agaagaatgg ctcagggcgc tgagtggaga ggcgcggcag gcggcggaac gcgtgataac
   136741 cgaaggatcg cgtttctttc ggctcaatgt gtagttaacg agcacaagca gttattcaca
   136801 acatatttgg gtcacataga ggtaggcttg gaaagttgga gttgagcacc tcaattagag
   136861 ccacttcgac taacttgccg tttagggttt gacgttccat tagtttcata gtaactttgt
   136921 aagactcgtc ctggcgcgtg atgcggaacc aaaaccgcaa gatggtgtgg agaaatgact
   136981 ggcggctctc gtaaaacaaa ataaacactt ttggaacctg ttgtacgatt tctggtgtct
   137041 tatcatcaaa aaacaggtag agggtgctac agatgagttt ttggcagcta atgcgcaaca
   137101 gtgtgccaaa ttggtctcgg atgttaacga cctttaagta ccccagtaag tctagcagac
   137161 actttctggt aagggttaag ttctccacac aagagagaat agtgcaaagc gtaaagtgca
   137221 tcaggttact agtcctcacg atgccgcaac ggtgtttcaa ccgcatcgag gtgagtttca
   137281 cggttttaat cgcgtcctca ttttccaaaa gaaaaatggt agagtagccc acgaacgaag
   137341 atttgaggct catttcgccg cggtactcgg agatggagca cagcatgcca tggtcggtgt
   137401 gaacccacag tcggtcgtta ctcacggtga tgtccacgat ttgcggggtg gtcacgataa
   137461 cgttgtgact cgtctcgtca gtatggactt ccaatacccc gcgcaccatc aagatgtcca
   137521 tgccgggagg gtctgaaggg gccgcctgca tcttgttgtt gttgactcgg acgttcagcg
   137581 tctgagggag gccgatggac aactggctgc ctggtcattt ggcggcgcct tgccttttcg
   137641 cggttgcaga tgagttccac gtactgtcgg aacttactgt cgtcataggc ggccgcaacg
   137701 atttctccaa aagacaagtg gagatactct tcgggaatgg gttcgagggt ggacagggac
   137761 agaacactga acagataggg aatcaccacg cgctcgacag tgtagttgga gtaaacgatg
   137821 gcttcttcgg caccctgagc ggtgactagg cgtttcattc ggaaagtgcg aaagtattcg
   137881 ttttcccaca gctcggtgag aaggttttcg agtttttccg tgttcggaat aaattgcgaa
   137941 aaaaagctgt tggccaccac acggttgtct tctatcgcta gcgggttgaa ggccacctct
   138001 tgcgccttgc gaaccgcttc ggtgattgac aggtggtgga gtttcggctc acgttcaaac
   138061 gtctgcgcgg accgctgccg cgcataccga gagaggaggt cgcgcaattc ccgcacccgg
   138121 ctctcccacg cttgattcaa gcttttcagg tcttggatct cgtccacctg ggcttgaatc
   138181 tgctcttcca agcattttat catctgcttc ttaaacagat cacgaatatc acggtcttgt
   138241 gtggcgtttg tcacgggagg tgcgctggtg gacggtccgc cgcctggcgt acgggatggc
   138301 atcaggcgac tttggtccac cagggacggg gtcaggtctt ggaggaagga ttccacactg
   138361 tcctcgatgc cgatacgcga cttgctgtct gagacgttca ataaaaattt cataattgac
   138421 ttcttggcgt cgctgccgcg gtcgtgtttc tccatcatgt ccacgattct cttacagttc
   138481 atctcatggc ggctggtggt cacggctttg acgggatacg tattgaggag ctgacagatc
   138541 ttctgatggc ggcacaggct gtcgtagcgt aggatttctt cgtgaaggtg ggagattggg
   138601 gtggtaaaga acagctgatt gcgctcgtac gccaagggtt ctgtcacgat gtatctattg
   138661 atggtccgtt ctttcagctg cgcttcgatc ttctcggatt tgatgcgctt gaagatgcgc
   138721 aactcaggtg agttgacgat gcggacacca cacaggtgtg tgactacctg ctgcaggaga
   138781 tgcagattgc tgttgagcag atcttgggct agagggtggg tctccgtgga cttgtggatg
   138841 gccgcacgaa tgaaggccgc gcgttgcgca atctcggcag gcttggactt gacatccatc
   138901 agcgggatga tgcccaccgt gacgtaccag tccacgtaga ggccgtagtc atcgttgtcc
   138961 gcgaattgat ataaaatgtc acggagcgtt ccgaggactc cggtctgcac gctctgtcgc
   139021 acagaggcgc tccacaccaa gagatagttt tccaagtcct cgtcgtctag agcttggtaa
   139081 ggaaacaggg tcgagtgaat cttccattcg tccgctactt gtcgcacggt aatagtatca
   139141 aagatcgttt tacacagccc gtacagcagc tgttttctca atacacacgg atcccggaga
   139201 acctggtgaa tgctcttgcc gcggcacgtg ccgataaagc cgtgcaagag acgaatatag
   139261 cttagtgtct gggcggtggg aaagatgtcg atgaccgtgt cgtcgtcgcg tcccgttaag
   139321 tacgaagacg ctttgattct caacctctca tccgcggcta agatcgagcg gatcgttgac
   139381 aaggtcaagt ccctctccga tgttcgcttc gaaccggagg acttctcgta ccaatggttc
   139441 aaatccatga gtcgtgtgga acggtccgcg gaccaggacg ttcgcgtgcc ctgcacagat
   139501 cagtggccct tcttcccttt tcggacgctt ctggtaaccg gcacggccgg tgccggcaag
   139561 acgtccagta ttcaagtgct ggctgcgaac ctaaattgcg tcatcaccgg gaccaccgta
   139621 atcgccgccc agaacctcag cgcgattctc aatcgcacgc gctcggcgca ggtgaagacg
   139681 atctatcgcg tctttggttt caacagcaaa catgtgcctc tggccgaggg cggcaacgat
   139741 attctgaagc agtaccggat ctgcgagtcg cgcgacgaaa acaccattca acgtctgcaa
   139801 gtgaacgatc ttttgactta ctggccggtc atcgccgaca ttatggaaaa atacttaaat
   139861 atgttggaac gaaaggcgtc tctggaagac gtttcggaga tgtgcgagag taatgtcatc
   139921 atcattgatg agtgcggcct gttgctcagg cacatgttgc aggtggtggt gtttttttac
   139981 tacttttaca acgccgtctg caataccacg ctctaccgcg agcggcgtgt gccctgcatc
   140041 atctgtgtgg gctctcccac tcagacggag gccttggaga gtcgctatga tcacatcacc
   140101 cagaacaaaa acattcgcaa gggcattgac gtgctctcgg ccctcatcca gaacaaagtg
   140161 ctcatggact actgcgacat cgcaaataac tgggtcatgt tcatcaacaa caagcgttgt
   140221 acagatctag atttcagtga cttgctcaag tacatggagt ttggcattcc tctcaccgag
   140281 gaacacataa catatgtaga tcggttcgta aaacccccta gttccattcg gaacccatct
   140341 tacgcctctg acatgaccag attgtttctt tcacatgtag aggtgcaggc atatttcaaa
   140401 agattacacg aacagatccg tcagagcgaa cggcatcgct tgtttgacct cccggtttat
   140461 tgcgtggtca acaaccgggc ctatcaggag ctctgcgatc tgagtgaccc gcttagcggc
   140521 tcgcctcagc cggtggacat ttggttccgc cagaatttga cgcgcattat caattactcc
   140581 cagtttgtag atcacaatct ctcgaacgaa atactcaaag agactttacg agcggaggac
   140641 acggaggaag ctttagaaac tttattgaca ttgcgaatca catacatcca gggcagttcg
   140701 gtgggggtca actcaaaggt tcgggcgtgc gttgtggggt accacggcac tttcgaacgt
   140761 tttgtagaaa ttttgcagaa agacaccttt atcgagcgaa cgccttgcga gcaggccggg
   140821 tacgcgtact cgctagtctc aggcttgcta ttctctgcca tgtacctctt ctactcctca
   140881 ccgtacacga acgaggaggt attgcgagaa ttgggtcgga tcgacttacc ggtcatttct
   140941 tctctctgtg tggatgagaa aggtgtcagt gaggcgggcg tatcgtcggg aacgcatacc
   141001 caaacgcggg tagcggtaag cggtggggac gatgatgaag caatggtgct agggatagat
   141061 gaggatactt acgatattcc ttgtatgaac gaggaggtgt ccgattccga tctcttggcg
   141121 cagactagtc tgtacgagga cccattcttt ggcaagtatg tcaagcctcc gtctatcagt
   141181 ctcttgtcgt tcgaagagac ggtgcagatt tacacgacct ttcgcgacat ctttcttaag
   141241 cggtatcaca ttttgcaacg tgccaccgga ggccggttcg ccgccttgcc aatggtcact
   141301 tacaatcgcc gaaacgtggt ggttaagtct aattgtcaga tcgtctcaca gacgggctct
   141361 ttcgtaggta tgttgtcaca cgtgtccccg gcgcagacgt atacgctcga gggttacacg
   141421 accgataaca ttttgagctt gccaggcggt caccgcattc accaagaggt ggcacagcgg
   141481 ggactgtcgc ggctggtgct taaggatgcg ttaggctttc tgtttgtgtt ggatgttaac
   141541 gtgtcccgat tcgtggagtc cacacaaggt aagagtttgc atgtgtgtac cacggtggac
   141601 tacggcatca cgtcccgtac ggcgatgacc atcgccaaga gtcagggact ttccctggag
   141661 aaggtggcgg tggattttgg cgatcatccc aaaaacctga agatgagcca tatctacgtg
   141721 gccatgtctc gggtgacgga tccggagtat ctggtgatga acgtgaaccc gctgcgcctg
   141781 ccgtacgaga agaacacgac catcacgccg tacatctgcc gcgcgttgaa ggaccgacgg
   141841 accatgttga ttttctagag aatgggcagg gagacaagaa aaaagaaaaa aaaagacgcg
   141901 gagagggagc caccctgtct ggcttgcatt ggttgtttag tggaagaggc aaaagcccgg
   141961 agggtggctc cgatgggtct cattctgctc cataatagtt atttcagtat gcactggtaa
   142021 taaagatctg tgatcccgtg tggaagagag agaggataat aaaacatgta ttgaaaactt
   142081 gccaacggct atgtgatctt tctcacgtag cagaacaggg agagaccttt gtactaattt
   142141 tattgttttt gtggtttttt tttcaaagaa tgagatgctc tcttaagagc tgagctgtta
   142201 acggatgtgg tgatacattc ataagtattt ccttaacaga aaaaaaatgt ttcataaatg
   142261 agaggagaga agtatgaggt gtttttcttt aacgcaataa atcagttagg aagcgtagcg
   142321 tttggcgtgc atcctttgtc ttttatgcaa ctgaaactat ccgataggca gagacgaagc
   142381 gagtctagaa agctcgttca gatcgttcgt ggcctgaggt tttttatttt tgcggcggcg
   142441 cgccagcagc ggcgcctctt ctgaagcgat tcgtgtatat agcgtgcggt ctgctaatca
   142501 tatagaccaa ttgacatgga tatccagctt ttgatacggg ttattatcgt ttgttatgga
   142561 agcttttgaa cttcatgatt aaggataaag gggcctagca aaaaaagttt ttctcctaag
   142621 agcaattttt cttaagagct atatatcatg gtaaattcag aatcctatgg tgtctttttt
   142681 tatctccaag agaaaaaaat caacattatg gtctaactta cgatgatcct ttggtcactg
   142741 ctgaccaaca cctacagttc tttttttgta cgaatcctaa agtacaatat tgttcgttct
   142801 caagtaacta acttatctgc tatgttttgt ttttcttttt ttccgtatac gtgaggatta
   142861 ttacccgcct gcaaggcgca agcaactctg ggctagatga cacagagaac tcacatgagc
   142921 ttggcttgca tgacaaagac atctccctcg atggggatgg cgcaacttac tttaaatggg
   142981 cttatggtta caatacaaaa agagagaaaa ggaaacttaa ctgagacgac tctataattt
   143041 gtaccttatt gtgactatat actacgtgat tacttgtata atataacaat aatgatatat
   143101 gaaaaaagta gcaacaagag acaagaaaca gcttaatcac cctgaccaga cagaccatca
   143161 ggaaattata tatatcttga gacggccaag aaggacttga gtaacggcgg ccaaaaatga
   143221 actcatcatt cagggctgcg gcctaaacgt ttgtgatgat gatagtcgat atacattgtt
   143281 aaatcattca tggttgtgtt gactagatga tacagatgaa tgtacacagc taggtgagac
   143341 ttacagctat ccatccattt ttcgttgtga ttagctgaga gattagacgt ttatttatca
   143401 ctatggtatg tgcactatgg agtagcccta taggaattgg ggagcagggt gtttatcgct
   143461 atggctcttt tatcactacg gttgtcacta atgatttcct agggagcgga gacacaagaa
   143521 cttaaactct attcatatac ctaaatgata gcttagctgt taactctaaa attgtcacta
   143581 taccttattg tcctatggtc actatgagaa tatcaacaaa aaaaggtaaa actttataac
   143641 acgcaaacaa caaaagaaag attagcttat cgttaaacaa ctatacggct atacatacat
   143701 aacaacaaat atatagctat gatgatggtt atatcacgca ggcttgtcta tcgcttggcg
   143761 gttactggga tggaaaacga aaacaagaga gaagtaagtt catcgcggac cggccgcgag
   143821 gcgcataaaa agcgtagcgg ttgcaaactc tgtgcattgg ttcttgttgt gggttgagat
   143881 gcccagcagc acggccagac tcctcgatcg cgaaccagcg ctcaccgggg agttcggccg
   143941 ggggaccctg tagttgttgt tcgttttgat gcttgattag atatcctgtt ggtgagggga
   144001 ggtggcaggc tgagtttttt gtttttgcaa ggttagcctt cttctacccc ctacacatgc
   144061 gtacttgttt cttgagttaa gtgtttgttt ttttttctta atagttatcg ttacaagtct
   144121 ggcttgattg ttcagggggg gttgcatctt tttagtgagt gtgataccac gacgtagggt
   144181 gtggtaaccg taacaataat atctgttggt taggagaact taaatgtgta ttaggtatta
   144241 ttctcttatg ctgctaacag aattgcttct ccgtaactat tatcgtctta cagatagatt
   144301 gcgtttgttt tttttttttg ttaaagttcc ccagcaaaaa cagggagtct gtggcttttt
   144361 ggttcgtgta catccgtgtt cgcgtatcga atttgatctt cctgcgatga tgtagggtcc
   144421 ttgatgtagg atttcgaata tcggtatttt ttttctttta gcaaagtgag ggttcgtgta
   144481 agtttctata caaacttatg tgaagtttat gacgttcgtt tgttatctcg agagcggctc
   144541 gaaccttctt ctgtagagct ttatttagtg caactttacg gggtgtagaa gctaaatgaa
   144601 tctctgaagg tgctactcat ttacacttcg aagaaacatc cagttcgtga aaaaaacaag
   144661 tgtcttcgaa atcatgtttc cactattttt gcaattacat ctgtgaaagt aggcagtaga
   144721 taccagattc ttttttattt tgtttgtctc ttatacaatg gactacgatg tttctcgaga
   144781 gtatgtcgta agcttgtccg tggtgtagat cgagttgcta ttgttatttc cttttgcaca
   144841 cacagttgtt tcaattagat gtttgaccgt gattttgccc acccggcccg ggagacaagg
   144901 caaggagatt tgttttttgc gtttgccatt tatcatcgtt atttactatt agtggtgaca
   144961 atgacctgtc agattgttga ttattttttg ggctacagac tacaaatctt caaggatcga
   145021 ggaaaagcaa acaaatagga aaggaaaaaa gggaccacct tacctgtggc gtctcattct
   145081 gtgttgcagc ggcagccggt gctgttgttt agcccggaga aggagacgag gacgacgaat
   145141 cggcggtcac aatgcggagg agaaggtctt tcggcatcgt cgtcgccggc gctatcggaa
   145201 cactactcat gatggcggtg gtcgtgttct cagcccatga acacaaagaa gtaccaccgg
   145261 cctgtgatcc cgttcacggt aacttggcag gcatcttcaa ggagttgcgg gcgacatacg
   145321 cttccattag agaaggcttg gtatgttagg caacgtagtt ctcagatgtc agtccgaatc
   145381 ggaggagtca cagtctgtca catgatgata tattgcttca ttcttgtttt gcagcaaaag
   145441 aaggacacgg tgtactacac atcgctgttc aatgaccgcg tgctccagga aatgctgagt
   145501 cctatgggct gtcgcgtgac caacgaactc atggaacatt atttagatgg tgttctgcct
   145561 cgagcgttgc atttggacta cgataatagc actctgaatg gcttacatgc gtttgcttca
   145621 tccatgcagg cgctgtatca gcacatgtta aagtgtgtaa gtgtttcagg ttcgataacc
   145681 ccgcgatatg acacgtaaat agcgatatcg tgtcaccaga tgtcagtcac agtcttcccc
   145741 tgtcgagacg catcttatat cgcgatatat cgcggattat cgcagtatgt cgcgatatat
   145801 cgcgccagaa cactccggat ggcctcctat cgtcggatat cgcctcatat cgccttatat
   145861 cgcggtatat cgcgggttat cgccatatat cgcggttatg tcgcgacata accgtcatgt
   145921 cgcgactatc gtcacatatc gccactatcg cgacttggca ccgtgccaac gatagtcgac
   145981 cctagggtgg tcgtgtggtg gtagggggct gcttacggtt tgcaaaccgg agaagttcca
   146041 cacgctgttt gtcggtttgg aaacgttgtt tatacatgtc tttgtcttgg cagcccgcgt
   146101 tggcatgtac tggcaaaacg ccagcttgga tgtacttctt ggaggtggaa cacaaggtca
   146161 gttaaggttg ccaggtagat taaaacgcag aaaccattgt tctgccggtt ttctaaaacg
   146221 ccgttcaacg tgttttgcag ctcaacccct ggaggggcac ggccaaagcc gcggccgagg
   146281 ctgacctttt gctgaactac ttggaaacgt tcctgctgca gttctgagcc agctgtcaat
   146341 caaggcagcc aaaagcagcg ttctccggtt tacaattctc ggatcgtttc gctagttaag
   146401 ctctaataaa cgtactgttt aaccacgttg cgtcgtgacg ttgtttatga gtgtcacggg
   146461 gtgggagtgt atgatgttgt ataaatagcg agagcgactc gcggcagctc tctcaagctg
   146521 cctacgcgcg tataactgct tgccgagcgg ccctggatag cctgcaacca tggaagaaac
   146581 cacgtcaacg cgcacttatt ggactttcag gggcgtttct cgcgtgcttc accagtctgt
   146641 gaatacgggt ttcgatgtgc ggcagtcttc ttttgagagt gccacgctcg tccggtgcct
   146701 ggacggcgag ggtaccacga ctacgctcgg caaagggtgg ctctgttgca ccgtggtgca
   146761 aaacggagat tcaaatgctc ctaaaggaca gccgcaaccg ggatttatgt ctttggacgt
   146821 tactgtggag gaccatttgg ataatttgtt tgtgcgtggc acggtggtga ataacaagaa
   146881 cgtgtcttct gtggtgggcc aaggaaaaag tggtgacagt tcgttgttaa ctgttatatc
   146941 tgaaggagac acgctccaag tgacttttat cagacatcac actaaatttt cggactcaat
   147001 tgcgcaagca tcatcctctg gtgcttcgtt gtcctccggc attccatctt cctcatcctc
   147061 cgtttctgcc tctgttccat cagcggccgc tttggaggag agacgggccc gtgccgagcg
   147121 gcatgaacgc aaaaagcacc aacatcagca acaacagcag cagcaggcta actctatgca
   147181 ggatggcagt ggacagatac gggtgtctgg gggagatcgt gatccgcgcg tcttgaatcg
   147241 gcccaaagac cgccggtccg agacggacgg taagtcgggc cgttccgcgt ccgcggatgg
   147301 tgctggcggt tcggaatctc atagcagtgg gggtgtgtgg cactatacag gcgggtcaca
   147361 tcattaattt cgttttcgtg cggtgttcgt ctaggctctc ctttagacaa aaggccaaag
   147421 acgcaccacg agccgaagac tgcggcggaa cataccccgc gtcatatgcc tatggaccat
   147481 aaccccgcat ctgaccctgt tgctttctta aattattctt cgcacgctcc actgacggac
   147541 catcccggta gcgacggtgc gttattacaa aatgagacag ctgggtttgg cgacgccgag
   147601 gagcgccctg aggagcttgg ctccagggcg ccttctcccg cacgtgggaa tagcgggacc
   147661 gaggcgggag ctgatgctgg ggtcagggcg tccactagtg ctaccgatga tggtggtgat
   147721 gatgagcatg taacgccctc tacttcttcg ggactgtcta accgccatct tcctcctccg
   147781 aattcgcagg cctcatccgc gccactctca cctcatcctc gcagccccca ttttgaggac
   147841 attatacaat cgctcaccag gttaattaat gagtgtggta agggagatcg gggtgatact
   147901 cctgctccct ccagacgcac gcccgagtgc ggtgactctc atgccagtcc tgctgccacc
   147961 agtactgctt ctactgccgc tgccgccaca gccgtccctg tgtctgaggc tccccgaccc
   148021 gtatgcgaga ttcgacctta tatggtaaac cctgctgctg cccctcagcc tccgccagag
   148081 cctcagcagc cggctaccaa cagacggact cgaggagggg ctcggccccg caacggttcc
   148141 cgtggaggag gcggcgggcg acgaggggct tccacctcgg gtcgtaggcg acggcgcaat
   148201 caggatgatg actctgagga cgagattttg ccgggcccca gccgaaggag gaccgtgcca
   148261 ccctcatttg cagaggatgg acttgaaatt attgatgccg ctgaggaggc ggctatagcg
   148321 gctgcttcca tcgcgtcctt ttttgactga cttttaaatg accataaatt gaaataacac
   148381 actgaatgcg tgtatatatg tatataataa agtatattat tattgttgta ttttatacag
   148441 tattgtttgt aataaagaat atggttataa acgccagtca attgttttat cgtgatgttt
   148501 gcggagatat tcgttagcta agacaaagtg ttcgttgccg aggaaagact tggtgttctt
   148561 gggtgaaggg tgccaggctt taaggatgag gtggcggctt ttattgatca ggcattctag
   148621 ggtctgggct tcagcgcccc agagcatgaa caccaagtgc tcacggcact ctgacagcct
   148681 ggagattact cgctcgctca acacttgcca gcccaagtgg cggtgcgagc ctggctggcc
   148741 gcgaaccaca gtgaacactg tgttgagcag cagtacgcct cggcgacacc agtcgtctat
   148801 gcatccgccg atgggtctct ggaagccggc tacggtgcga cacagttcgc ggtacacatt
   148861 ctgcagcgag ggcggcgcga cctgtccggg cagggtgccg aacgccacac cgctagcgct
   148921 cccgtcacag tagggatcct gacccacaat caccacgtac acattatcag gcgcacacaa
   148981 gtaactccag cgatgcacgt gttcgggtgg cgggtacaca gtgtcgctct gacgagcgcg
   149041 cgcgacagca tccaccgtct ctcgcagcaa gtctaagtca tgggatggta tattcagaaa
   149101 gactagccat tctttactaa cagacaagag gcgagtctgc tcgtcatggt taagcataca
   149161 agctttatta tcaggaatgt tttccaacat ccactgcttt aaggccatta tgtagtaaag
   149221 cggggttgtt tgttagcggc tgtttccagt catctgggat atcaaggtag tatttatcca
   149281 gacggtcgat caaggcggta tcaaggtcgt gacgtacgag aagctctctc acgaggttat
   149341 acagagcata gaacagctga agtccattac gatccgctcg agtggccacg ggaatgcgga
   149401 cagggcgatg catttttatg tcttcatgac gcacgacaac gagagcggca aattgtcctt
   149461 tgtgaccaaa gtcaaacccg agtacattct cggtaaagat gctgctgcta tatgtgagat
   149521 atcgaaggtc gtacgcgcgg cacacgttat ctacacatgt gtagatagat cctgtgtctc
   149581 cacactcgct gtagccttgc ataatcttca tccaagtcgg tgcaccatca gatttcagaa
   149641 gggttaacag agttcgcagc tgagcggggt tattgtgtag cagagccaca aagtccatga
   149701 aggtgtcgtc caagggtatt gtggacgcag catgtttagt gaggggagtg tagcgaagaa
   149761 gttgcgaaag gttgccatcg ggatgactga cttttattaa aggcttggcc caactgtcat
   149821 cctcgggtga aaacgtttcc ccggtaaagc atcgacgggt cagttcgaga caagtgaggt
   149881 tttggggtaa ggtctcggca accacgagcg tgaccaaaac agcagcactc accagtagtc
   149941 tccacatcgg ttgtctctta ctcagtagta taccagtctc gatactctat ctgtccttgc
   150001 aaggttatcg ggtgatagcg ccctagttga tttatgaagt ccgagttaac gtctggtaac
   150061 cctaaaagtt tatatattgc gtctaccagg ttggaggtag ccgatgcact aactaccaag
   150121 ctgtcgttac caatcttgat gatggctacc ggcttatgac agggagtcaa cgtcggagga
   150181 aagaatgaaa cgctggtcac tgttgaccag gagttaactg acttgttagt gtagtcacag
   150241 gatgttatat tgtatgtgtc attgcggtcg caagtggcct gaaagtaaat ggtgtcttca
   150301 gtgtcgtatg tcagagtata acccggtgat tggggaaaat atgtactatc atcctcattc
   150361 gatgatgcta ccggctcttc atcactatat tcagtagttt cactgctctc gtcttcctct
   150421 ccggggtctt tgaatacaat ggaaatagtc tcattgcaca agtccacaat ctgcagagct
   150481 tcatacggac ttggggtggt aatgttaatt gtaacgtttt catatccagt ggagttgtaa
   150541 ggttctgtgg tagttacatt catgtcagct gtggtgtctg gtaaactagt tgtgtttgtt
   150601 tcagttgtgg agttagtgcc attgacagta gatgtgctac tagtagtggt agacgtgtta
   150661 ctagcgggac tgctggtagt aataggacta ctagtattgg tcgtagaggg tttggtactt
   150721 gtgctggtac tgttggcggg acttgaggtg accgatgtgc tgctcttggg tgtggttgct
   150781 gatgcggtgc cagtggttgt tattgttgtg ttggtgctgg aagtggacga tttggttgat
   150841 gggctcgatg tagtggtatt cgtggtagct gggctggaag ctggtgaggg ggtcgacata
   150901 ttggtggtag aggcggttgt tacggtgctg gtgattgtgg aagcggtggg tgtgctggta
   150961 ttgcctgcgg tggtgctgct ggccttggcg ctcgtggcga cgatcaacag cagccacctc
   151021 attgccaccc atcgcatgcc tgtggctgga actctgtgaa ataattgtac aacggcaggt
   151081 gcggtgccgc gatcgacgga tatgacaagg cacagatgtt gatattaaat atgtctggct
   151141 gcttttcggc caccgccgcg caaagcgtcg ccgcattaat cagatccttt ttcgtggcgc
   151201 ccgacacgta cagctggtgt actccggttt cgtggtacga cacggctctg gggattaccg
   151261 atcgtacggt atccagcacg ttgtctgagc tgttgtggca atacttgaag gcggccacgg
   151321 cctgcggggt gtgcgggacc gtttgtgtaa tgatctgaga tccggacagg acggtgatgt
   151381 tgtgcaattt caacagcgtg gtcttaaggt tctgaaaggc gttgccgcac gcggcgctga
   151441 cctggatttg gatggcggtg gaatcataca cacggctgac tcgagacagt tcctcaaaaa
   151501 tatatctgta ctttattaca cagctggggg caaagcggta atcgttgggt agcaggtaag
   151561 gcgtggtatt caggtcggtg gtttcgcgat cggtctccag caggacgcgg tggttcatca
   151621 ggtctatggt cggtatggag gtggtttcac tggatgcggt agatgtggag ggggagggct
   151681 ctggggaaga cgatggtgac aaggacaggg acaggtcgtc aatgtacatg tcatcgttgc
   151741 tactgttgtt ggccacagac acatcacgtt gaaaagtgtc cgccaagaag tcgtctatga
   151801 catcttgatc catcttcttg ccggacccgc tggacgcgtg actatcctcg gctgcgggcg
   151861 aagtcgtgtt aaagacgatg agccgcttgc gctgctttac atctctggca tacctgcgaa
   151921 tcagcgaagt gccgtacggg tagagactct ttgtgagctt aggtggtgtt ggtggctggc
   151981 gcgcatcgta cgagggtggg ggatggatga tcctaacatg gttcacgtct tggttgtccg
   152041 gagggatccg cagaaagcgc tgctgtggca ccactacaat ggttcggtgt gtctttctct
   152101 tattagcagg agcgagggac ttggagacgc gttgggaggt gtacacgatg ttaatgttgg
   152161 agaacatcgc ggacggcctt ttcggtctgg attttaccac tgcttaaagt aaggcacggg
   152221 gtagggcttt tcttcgtcca gccgtctgta cgcccatgga tttcgttggc gcatgagaac
   152281 gtaagtgatg tagagaaggg caaatagcat gaagaggagg aaggccaaga cgatgtagcc
   152341 cagtgttccg atgattggcc attcatctgg atcgcgtctg atgaacacgt gcgtagatac
   152401 actgtagcgg tctcccaaaa gaattctcat gtgagccgtg ttggggagat catgagtggt
   152461 aaagtggaag atgtactccc acaagctctg gttgtgtctg gtgatgtttt ggactttgtg
   152521 tgaggagtgg ttcgtgtttc caaagtacac aaaagctttg ctgctggaat acacggtttc
   152581 atttgtacat gggtgattag taacaagtac acgtagctgt gtcatggtat cgtttgatgg
   152641 agaggcaaat acagctttga tcggcatgac aaggaattcc cacgatgtat taagagtttg
   152701 tcctgttgcg atgaatttgc aagtgtactg tgtggttacg tttggcgctt gtgtgtacat
   152761 ggtgaaagac tgagtgctga tgttgtagaa cattcccttt gctgtaatga cgaataagta
   152821 tcggttaatc gtacatttca aagattatgc atatcacata ataaagatgg aaaatgattg
   152881 tacttacatg tattgcttgt ggtgactgat ccgatgctgg taaggttgcc atcgcatcca
   152941 acttgttcaa agcactctat agatatcagg tctcgtgata cattctgagc atgtgacatg
   153001 ttgtgaattt gacatgtagt ctgcagtact aggtagttgt agctgtaggc actttcacat
   153061 gtaacataga tatcaggtac ttgaggtttt ttagttgtgg tgctggttgc agttgtgctg
   153121 gtgtcactgg tggtgtcaac ggtggtagtg tcggtgctat tctcagtagt agaattctcg
   153181 gaagcattgc tggaggttgt tgctgactct gttgttgctg gagctgttgt tgtgttgcta
   153241 ctggtggttt gagtatcggt accagttgaa ctgttgctag tagatgtttt ctgagtacta
   153301 gtagcggttg acgttgcggt acccgatgtg ctgctagatg ctgcattgga actggtcaca
   153361 gatgatgttg ctgcactaga actggttaga gacgtagtaa ccgaagtagc tgaactggtt
   153421 acagtcgatg tggatttgac agttgttgga gaagatgtgg tactcacagt tgatgtggta
   153481 ctggttccac cgatcgcctg ctgagcaata agcacagcgg ccacgagggc cagaacgtgc
   153541 ccggtgccaa gcattgttgt ctgacaatag actttgacag ctctatatgt acatccacca
   153601 cgtcagttgt gacgcttaaa cttacagctc catataaggc atgcgttaat aataaagact
   153661 acgaatacta gttgcgctaa caaaacaatc atcacaattc gattctgctg acttcgaggc
   153721 caccagttca gagctgcatc tggagtctcc accaagtctg tatcgttaac cagtactatt
   153781 gcatccttat cagaagtatt agtaattttt gtaaccataa aagagcggac cccataagta
   153841 ccattggacc cccaacaagt tactgtacta ttcagataga atccataagg tgcagtatcc
   153901 aacaccttta caaattttaa ataaaggggt ctggggtgtc tatcataccc atgataccca
   153961 cctttaagaa aagtagtgtt gtatttggtg gttatcataa taccacccgc taagaatcta
   154021 gaatgtctgc ctgatgtgtt acaataaata gttaagttac tagcattata ataaatataa
   154081 gccaccttca catggggggc gagaggatca cctgcataaa agggaaggct atataccacc
   154141 gtcataataa tcaccatgca cactataccc agataaacag cgtggtaaaa acgtaacatc
   154201 ttaccacctc ttcacatctg gtccaaagta ccgtgtgcgc cttgacagcc atgatttata
   154261 gtcagtcaag tgacgtgtgg tatcatagtc taacttcaat atgcctgcaa tcattacgcc
   154321 cactgtcagc agcacgcaca cacagtacca tagggacagg tctgaatccc acccgcaggg
   154381 attcaggtat ctcttcttgg gtacaacccc aacacacaat acaccttcac ggtcctcatc
   154441 tatcttcagc aacagaccta cagttgtcat gggataaggg ggcattctca ggatcacagc
   154501 agactctgaa gaccacaagg acccacggac ctctactcgg tatggtattg ataatggtgt
   154561 ctgactagcg taatcaaaag cccataccct cttggtgtca ttcataaacc aataaagtct
   154621 gctatcaagt tgcctcaata aacacttgac tttgatgtgg ttcctatccc aacacatgtc
   154681 tggggtctgc acaccacaga cactgaccac cacacttgtt agaagaacaa tagctaaacc
   154741 tagcatcatg atgatcacac caggacacaa gtatacaaat gagtacaatt ttattgcata
   154801 caatcttatt tatatacatc tgtatctgaa cactgattag gtaatgctaa tgagatgata
   154861 tgatatggag aatactgata tggatatgta atgtaacact gcagggtatg ctatcatcta
   154921 tgtacaaggt caggggcacc ccctccaagt ccattagtca cagtccacca ctgtttatta
   154981 actgttcagt gcaatgttaa gtccactgtg cacttcactg ggattcctgg ttcatgtcct
   155041 cgatggcttt ctcaatggcc atgttcaggt tggccaagtc ttcatccttg gtttcctcga
   155101 actggcccac tgcatacatc ttagctgcct gatcataaat gggaagcatg aaggaattgg
   155161 agttttcatt agtgaagatc ctgatagcca cctgcttggg gaatctctgc acaaggggta
   155221 ccaagatttg cagggatcct aagaagtcca ctggggtagc tgcgtgaata atcatgttgc
   155281 ggtagtctga agaccgaggg cacatatcgt gtggctgcac ggctttcaga tcccaggcct
   155341 gcttgattcc actggcacag gcttctgcag tcttgcggac cacttctgca ggatacacat
   155401 taggcatggt gtgttccacc aggaaggggg tagagatgct caggttgggg accttcccaa
   155461 gtttcactct ggtcacatcc actgcttcct tcacttcatg ggttcgggtg taggtcacaa
   155521 tgatgcctct gtggttcacc tgcatgcttt tgcatgcatt cacagcttca gccatcaact
   155581 gatgcacatt agtagacagg aagggaaggt tcttgtactc cagtgacctg gtggtctctc
   155641 tgaacatacg ggacacttca tcagccctta ctctcccacg cttggtttcc acggtggggt
   155701 tcttgaagac agttccagcc ttctccctca tagcacttct caccctctca cagtccaggg
   155761 gggtgagcct cttggtgctc ttggttctgg gggccttggg ggtcttgccc ttggaggtgc
   155821 tgggcatcat aggggctggt ggaggtgtgt ggatggggga cactggggat gtgatggtac
   155881 tggcagagga gaagtggtca cctgcacact catcacagca ctcagagtca ctgcttgagg
   155941 aagaggaact atccataggt atttgaccag atgccccgga catcttagtg gttattttca
   156001 gttgtacacc ttgctgttca cttgtggcac gtgcagacac ctcaggcaca gtgtcttcct
   156061 cttcttcact gtctgagatc acaatacatc cagaggtggg ttggatgtct tggcccttgt
   156121 acctgatgaa agactcaccc tcctgcttaa tctctgatgg cttcagcatg cacgtgggag
   156181 gtgagggtgg tttaataatg accttcatgg ggtgttgggt cttacgtgat ttctttcgct
   156241 gactcatact gtcagtgggt ttgcaaacag ctggcttggt actactggtg ctgctgctgg
   156301 tggtggtgga ggaagatggt gctggggctg ctactgctgc tgagggtggt gctgggatct
   156361 tgggcttggg cttggacttg ggtttggggg tgccctgaag actggtagtg atttccatac
   156421 caggaacttt gatggcagtg gtggtgggac caatggtggg agcagtggtg gtgatcatac
   156481 ttgatggggt gggggcagtc attcctgctg agctagagtc aatccctgct tgactgacag
   156541 cttgggccag gatgtcaaga ggtgttggag gtggtggacc taagttaaag aatacacagg
   156601 acacacttag tgcttttgta aacagggaca catttattga tccacaacac aagtacacca
   156661 caacatcttc ccaacttggg gttttctctt actggggcct cccacctaag ttcccacact
   156721 tggttcccac aataatgagg catacaccaa gtatatagtg ttatatctgg agtatatatt
   156781 gtataacata gagtataata taaagtataa catagagtat aacatggttt caataataca
   156841 attagtacag tcagtcaatc cagttatatg ccagggggtt acagtacagt tagtacatca
   156901 ttgggggcct gactacctgg ggacttacaa tatcagagta caatatcagg cataaatgca
   156961 gttataggga ccagcccata taactgtgca gagtttaact ctttacttgt cagtcttgct
   157021 tctggtctgc atagggtgca ggctcttaga agaagatcca gcaccttcct cttccttaac
   157081 atgaggcttg gcatacttaa tgacagtcat ttccacttct gactcctctc cctcctcagt
   157141 ctcctgagga gtctcaactt cagtctctcc ctcagtctgc tctacctgag tctcactctc
   157201 agctgcctca ggctgtgcct cagaccctat ctgagtctca ctctcagtgc cctcaatatc
   157261 tgtctcatct gtcccctcag cctgagtctc tgctccctca tctcctgtct cagtctcctg
   157321 ttcttcctca tctgcctcac tctcctgttc ttcatctgtc tcactctcct gttcttcctc
   157381 atcctccgtg tcagagtgaa ttatcacaga ggccagtggg atgtcagcac caggcacatt
   157441 ctctgggagc aaaccagaga caactgggaa cttatcctca ttgagcttat cattaacaat
   157501 ctctctaagc tcattaaggc tgtagaactt catcttctct gtgcccatca tcagggtggc
   157561 atggaactca ttaataacaa ttctggtttt gggcttcaga ccatctataa gttcatcatt
   157621 gctctggtta gagttggtat ggatagcatg gataatttca tcaatcagat acagtattag
   157681 cactctaacc tggtctgata gcatggtaat gggagtgtgc atacccagca tagcttcatc
   157741 attcttatga taaccttctt tatacaaggc catacccaga gtagttatca gatggtcaaa
   157801 actactcaca tggaaagcaa cctctttctg ttccttatcc agttgcttaa tcagttccac
   157861 gccagcctga tttgcatctt tcaggtcatc ataattagat aattgtttca aaaatagttt
   157921 ggcatgctcc tcattattga tggctttagg accaccagta ccctgcatgg ccatgatagt
   157981 gtacttcatg caggtgtatg caactctgtc tttgatatca cctctctttg ttttaatctt
   158041 tgacataatg aatttctcca gattgctgga tgagttaact gcatactcaa ctatcttttt
   158101 gaggcacacc atgaatttgt ccttatactg aggaggcaca ggagtgtcat taaactgttc
   158161 attagcaacc tcaagtaagc atctcatgtt tttgaagggg attttaagtt tttccagaag
   158221 caaataactg ttttgtattc cctgttctaa cttgtcaatt ttgtcagaga acacttttct
   158281 agtatcagta agttgttctt tgatgatatc atctgcaagt cttctgtttc tttggactct
   158341 gagcttaacc tgtttcactg ttaaaaaata aaatagtgat aagtatatgt ggtgtgaatg
   158401 tggtgcaaga caaataaaga cacaggacac agactacata cttaccaacg agctgatgag
   158461 ctccaactac atcatccccc tcctggatga tttcttcaag ggtctttatt gtgtcatcac
   158521 cagttacttc aaacagaggg tctcccagat tgatttgagt cagcctcttc tcttcatctg
   158581 ccagcatctt ctccagcagg ttaacagctt cctgcagggc catgtccttc ctattgacac
   158641 atcaaagtaa atggacatga gacttgggtt catatataaa aactttatta tatgtatgtg
   158701 catataaatc caagtgttta acatatactt acttaggatg ttttggtgga gaaggcccag
   158761 tagaaggtcc tccagaagtc ccctcctctg gatcaccagt ttcctcagta tgggtctcat
   158821 cctcaggctt tctcttcctg gactccatgg ttacaggtgg ctattggaat atgagagaga
   158881 gactaagtat ctactgcatt tgcctctacc tggtggccca agctacattt atactatcat
   158941 catcagcctc ccccaccggg acttcattat caacaacaaa ggggagtggg actgaacccc
   159001 ttacctcctc tgctacaaag ctgattactg ctcaacctgg gtctgctgtt gctgctgttg
   159061 tattggctgc ccaatacaag gctgaatctg gatcatcatt atcatcatca tcggtgatac
   159121 tacccacggt gctggccgcc agtggcatgg tggtgcttgt gatactgttg attggactta
   159181 acctgagctc aaccttctgg agcccacagg tggatgaaga gaacgagctg gaagagggcc
   159241 ccagtcgtct acatacggac accaccttta taagtgcttc tacagtggat ttatgtgctt
   159301 aaacagtgtt aaaataaaga cctgcagaca aaataaggtg ttgtatgcct ttattaacaa
   159361 tttggcatag agccaaaatt tcatatctgg cggacagcca gttggctcag atccaatacc
   159421 tggaagcgtg ccaaagaaca ccgtcaccat ttggcatagg gccaagaata gcgtcaccac
   159481 ttggcaaggg gccatgcgca gcgtcatcaa ttggcatagg gccatagtgg gcatagggcc
   159541 aatagcaccg tcaccatagg gcatagggcc aagatataga taagcaccgt caccaataag
   159601 ggggcagggc caatagcaag caccgtcacc aataggggcg ttcccattaa tcaatagcac
   159661 caccccttat gggggttggg ctataggacc ctcctcccat atatagcatg cattatatag
   159721 gctccacccc ctttatatag actcctatag gccatatatg gcgttggctt attgccatat
   159781 gacgtaatgg cgccaatacg tcatatatag cctatagaat ctataggccc catttactta
   159841 cattacttgg cacggtgtag ccgcgttcca atgcaccctt cccggctatg gaggctggat
   159901 cggtcccggt accttctatg gtgctcctcc gacgtcccca ggcagaatgg cggttcccta
   159961 aacgtgcatt gcttatatag accgcccatt gggcacgcct accgcccatt aacgtcatag
   160021 gaccgcccca ttgacgtcaa tgggcatgta cttggcagtc atcgcgggcc atttaccgcc
   160081 attgacgtca atgggagtac tgccaatgta ccttggtgta ctgccaagta cccatttact
   160141 tgccaagtta ctattaatag gtattgatgt actgccaagt gggccattta ccgtcattga
   160201 cgtcaatagg gggcgtggga atgggcaatg ggccacccca ttgacgtcaa tgggaggtgg
   160261 gcctattgac gtcaatgggg tggtcctata tacgtcaatg ggcggtatta atgacgtata
   160321 ttaatccctc ccattgacgt caatggagga gtggccatat tacgtcaatg ggcggtccat
   160381 atgacgtata taggaaagcc catatatggt attggcaatg gctataagcc aatatggaca
   160441 tatgccaata tggattattg cctatatatt ggctataatc aatactggcc cattgccata
   160501 ttggccaatg gccatattgg cttatggcca ttctattgaa cctggctatt agccatattg
   160561 gatattgcct atatggatca ataacattgg ccatatgcca atacaatatg gcggacttgg
   160621 caccgtgcca agaccccacc ccaaacttgg cacggtgcca agtcgaccac ccctcaattg
   160681 gcaccgtgcc aagttttttt ggctcagtgc caagtccgcc atattgaatt ggctgggtgc
   160741 cagaacctcc attttgaatt ggcttgattc caattcaata tggcgtccat ggactcatgc
   160801 caattcaata tggccgatct ggcacccagc caaaacaata tggcggccct ggcagaatgc
   160861 caagaccgcc atttgtaatt ggcaccgagc caaaatttct tggcaccgtg ccaggtcgga
   160921 cattttgatt tggcaccgta ccaataaatt ttggcaattt gccaagtttc gattttactt
   160981 ggcaccgtgc caaaatcggg attttgcttt tttcggattc cccgacactt ggggaacacg
   161041 ttgcgcgaca tttggaggtc ctccgatcga tggtttttca gataacccgg ggggtatgtt
   161101 tttgaaaagt ctggcaaaat gccaagttct cagatattga aaatgcgtct tttgtgcctt
   161161 ctctagaccc aattttttat actttttttg acccgttgaa cgtccaaaat tacataactt
   161221 tccaggcaat tttacccaac ttttcaagtc aattttgccc gtctctcaga ccaattttac
   161281 ccgacttgtc aagccaattt cgcccgtctc tcagaccaat tttacccgac ttgtcaagcc
   161341 aattttgccc gtctctcaga ccaattttac ccgacttgtc aagccaattt tacccgtctc
   161401 tcagaccaat tttacccgac ttgtcaagcc aattttgccc gtctctcaga ccaattttac
   161461 ccgacttgtc aagccaattt cgcccgtctc tcagaccaat tttacccgac ttgtcaagcc
   161521 aattttaccc gtctctcaga ccaattttac ccgacttgtc aagccaattt tgcccgtctc
   161581 tcaagccaat tttgtccgat tctcaggcca attttacccg acttttcaag tcaattttac
   161641 ccgtctctca agccaatttt gtccgattct caggccaatt ttacccgact tttcaagtca
   161701 attttgcctg tctctcagac caattttacc cgtctatcag accaatttta ctcgtctttg
   161761 caagccaatt tcagaccaat tttacccgac ttttcaagcc aattttgccc gtctctcaga
   161821 ccaatttcac tcgtctgtca gaccaattct tgcctgtctt tcatgccaat tttccgacaa
   161881 aaacacacga aaaatatact ggttttatac actttattca gcctatatat ggcccacaaa
   161941 caataagttt acgagtatga tttctatatt caaccatgtg aatagtgcct agtagtccat
   162001 caatatcctc ctcataagga taagagtccg agtcaatagt agctgcgaca ggggttggtg
   162061 gcatagtata tgaagcagag gtagcaccag tcacattgac ctgaggtagt tgagttgtgt
   162121 tggacacatc atcatagggt gaatgagtgc cattcactgc gatcacagtt cgcaaaaatc
   162181 cgttatgata agtatcattt tttccatatt ctaggagctt cttaaggaac caattgaagt
   162241 ccataaaggg tcttcttaat cgggtattat caatccatgt gtagtcgatt ttacgtgcca
   162301 gacccaacac atgttcagta ctgttatgca cattagcaca tcggagcgat ccgtcggaat
   162361 gtacataaac cctatataaa tgtaagaaaa aataacataa aaatactttc ctgtgaatat
   162421 caaaaaatgt tagataagcg atttaacttt tacttacggg ctatgattgc agcttggctt
   162481 attagtataa agccggtgtc tggttaaatt gtttgtcaat gacataatta cactttgctg
   162541 catatgtgta gttgagtttg gtggatagca tatttgtcca atacggcaag taagcctgta
   162601 aagaaaaacg cattaatata gtacaatgat gtcatttatt ttttcaatgt tatacattta
   162661 aatgtgaaaa aaggatacgt acgatactgt acggttgttg cagattttga agtcatagca
   162721 gtcctgtggt gtgtagttta tattgattaa tgagcagcag gattttgcaa gaagattcgt
   162781 cggcagaagc agtaagatgc aaacgatata gcatataaac atattagccg ggaggatggt
   162841 gcctaaacag ccaggcggaa ctatatcgtg atgctaacgg gtaccttctt tttccgttgg
   162901 attgaaagta ttgtttatac ctaattggta ctggtgtttt gggtttaggt tttggctttt
   162961 gcgacggttg gcttcgttgg cctttgggcg cactgttttg tgattttgct gccgatgctg
   163021 gttttgccgc tacaggtttt gcggctactg gtttagccgc tgactttgct gccgctggtt
   163081 tagctgctac cggctttggc gctgttgctg gctttactgg agctggcttt gccggagctg
   163141 gttttgcagg agctggtttg gctgtagctg gttttggtgt tgctttcacc gttgatctcg
   163201 ccgttcgctt gggagttgtt actgttggtg tttttaccgt cgggctgatt ttatcaggtt
   163261 cagggacaag gatattaggc ctggtacaaa tgctactagg tcttctgtaa gcgtttgaaa
   163321 gttctatttt aactttgaaa gagatgaaat tggcttctgt cttggcccaa gtgatgacac
   163381 gcatctgaca gtgttccact tcaacaccgt ccttaactat gtaacgaaga gttgtactac
   163441 gcatgggtat catatgcgca gcgaaagttt tcttttcttc ttccgtaata ttcatagatg
   163501 tagcaggcga tgtagccatc ttcgaaatct tttggaaaac ggacgagtgt tgtgcactac
   163561 aattatttat aaagatatat gtttaccaaa agcattggta taacctgtat tatgaatatt
   163621 acacgttatc atacaaaact cacctgaggt agaacgccag tctatttgac cacgctgatg
   163681 gtctttcgat aaggtattga ttatacttat tatgaaaaat gtaaaggctg gtgtttccac
   163741 attccggtcc tgtttgatga gttgtgtaag atgtgaacaa agcaaaattt tgtcgaggag
   163801 atggatacat gggacaaaag ttgccgagtt taagattctt tatagaagta tcattgatag
   163861 aagtatcatt aaatccgtaa cgcaatagca tcagcaagac gaaggtatag agttgttgct
   163921 tatagttttt catcgcttta taattaacgg caggcgaata gcaatagtca gtattctaga
   163981 ttgggatgtg tgagatccgc tagcggcaaa tgtgatgagc ttctttgctg aaatataatc
   164041 tttaattaat ccaatcctac gagtgagctg gggttgtctt gtgtttttat tttttatctc
   164101 ttcttcaggt tgctgacggt acaggcattc atcaatctcg ccaggtctca cctgaacgct
   164161 gttcaccaca agtgccactt ctgtgacgtt gatgctagaa tatatataca cacaattagt
   164221 aaagcacagc tgttgtgaac accgctgtta tgtttaatga gcgatgggca acttaccgtt
   164281 ttagtaaact aacgtcgtca tgattatgac tggtagcgta atgatacgag actgacgcat
   164341 taattatttt ttccaacaac tgatttcgga gtgtcgcatc aatctgtcgt gaacaaatat
   164401 cccaataacc gtccggcctg tagttcggat tccaattccc aaattcttta gtacagattg
   164461 acccctgaac agtgaacgcg caaaacaaca cacacacggt gacagtgata aacacacgac
   164521 atgcacccat gttgtgttct aaaaactctt tattgacagc acgttattta tagctaattg
   164581 tcatattcgg gctccttcaa cgtcacttct cgggtgctga cttgcaacac cttaggcatt
   164641 tcccacgatt cggatggatc ggccatggct tcggcagcga gttcatcgta gatggacatg
   164701 taatagtgga tgttctcgtc gtcatcggcc tgagactcga tcatcatgga cgagcgatgt
   164761 ccgtattgag gattgacgaa ggatgtgagg ttcccttttt tgtcaaagta caagacgtta
   164821 ttatccgctt catcgtcgct ggtggaatca gtttccgact gtgattgcca cagctgttgg
   164881 tagtcaccct tattaggtcg actctttttg ctgctgggcg agcttcgccg gctgctcttg
   164941 attagtttgg cggcctcctg ttctgagtat ttggttttaa ccttgttgcg agtatgacaa
   165001 gtgctataga gtgcggccac taaaactagt aatagacaga ggagggcgac ggtagaagca
   165061 cagtagatga tgatacccaa gagttctgtt aatacacttc ctggttcggc ggtggttgtc
   165121 gcagtaagaa cggtggtgac gttagtgctg acgctcgtgg tattcgaggt ggtggcggcg
   165181 gttgtcgtca ccgtagctgt gctgttggca gtcgtggtat tagcagtcat gttggtcata
   165241 gagcttcctc gaggtagttt ataaacacac aatcacgtgg tggtactgcg aacccacgtc
   165301 ggtattaatg gctgtcacgg ttgcgtttta gaagtgcacc aataaggaaa atgagcacca
   165361 cggtgatcgc tactgtctcg tagcgaatct gcgtcaggag gctgaagcaa tggtagattg
   165421 tctgccaggc aggacctttg ggttcaggtg aatggagtgg tttcgggaaa taatactgca
   165481 cgtaactata tgcaattttg gtacgtcgcc aatataggga gaagtcaaac gacacccaag
   165541 atcgcgggct ggcaacgttc cggataatag ccgagtgatg gacacagttg cccttcattt
   165601 ctgagctgag ctccacgttg ttgtagcggt gttttcctcc gccgagagtg gtgaaattca
   165661 gggtgccatt ctgtccatca tcggtcccaa tcacaaaact gctcatgagg tctgtggttt
   165721 caaatgtccc gggtgtggca aacgtaaaaa tgaagtcgtt gtcaggagtt tgttgcgcat
   165781 cgatctcggt gtgaaggtat atggcaaatc tcacatagtc tacatctttg tgggtgaatt
   165841 ttgccgggag caccttggca tatgacaggt acattacata gtagcccaca ttggcgatcg
   165901 aatgcctgac cccgaggtaa gatgtaagct ccagggattc accaataagc gtccgtactg
   165961 tcaatacaac gccggcatag tatggatcgt ctgacatcac agtgagattt ttagtttcag
   166021 aaaaggttct tcgccaaaat ggaaaacact ccatatcatc ccagctagta cacagtgccc
   166081 aaccgagctc tgtaaatttc ctgcaggtaa tgaagccgtt ggctagttgg ataactggcc
   166141 cggacgtaga agcggcgtct tcaggtgcgt taagcatgtg gacgtgtacg tggcctgcca
   166201 tgtctttagc gatagttgat gttggaagac tatgcagtaa aagtgcgatg ataaggcagc
   166261 cgagaaagat gctgttgtag gccatttttc tgaagctaga gtaccaagca ataggtgaga
   166321 aacaaccaaa cgacaatgag gcagaagact acatatgcca gacagccgcc tgagtttata
   166381 gaagtagtgc atgatgtcgt cacggacgag gagtctgacg agccagcttg acagacgtcc
   166441 gaggcgtgag acatggaaag taaacaaaga aagtaaagca tagcggtctt catagtatca
   166501 tgcggcttag tatttttgcg ttttcggaat taaccttctt ttgcaaatac cgcttatagt
   166561 attttctggt tatgttccag gcaggtagtt caagctgagt gtcaactact tcatagagcc
   166621 cttcttcgtt cttactgatt cgtaagaaaa gtctgttgaa gaaaactcta actgccagag
   166681 catggggatt caagcaggtt cgagtgttgt ttgggagcac agcaatcact tcttgcttgg
   166741 tgcaattttc gttagggggt agtggttgta gataaagggt gccattgggg atagatgtaa
   166801 acaatgtgac gttagcacat tcacagaatt ctgttttagt accgctatga attattacac
   166861 attttaataa aagtatatac aatataatac caagtgaatg tatttgtaaa ccgaaacact
   166921 tcattatcat aaatgtaccg ccaaatgtca tatcgtaccg tggataacat gccgtctttt
   166981 acactctgta atcttgcagt ttcatgattt cggtacagca cacgaagtac gctgcggctt
   167041 caaacttatg tgtctgttgg gttttttggt tactgtaaac catgtttgct tatccaatct
   167101 atcaaacacc gacgggttac gaacacgcac acaagtttta tgtggtgatc catcatatac
   167161 tattagttca taattattac actcaacact tttaggcttc agataaacgc atgttgctgt
   167221 ccatggtata ccataataat atttaacgca actgcaacgt agttccgaac cctgtgaacc
   167281 tgaaaatcct gataatatca ggcatatgag cagcattgca gcaatattaa cacgaacagt
   167341 attcattgcg tttgaaagta cgcgcgttat tataactaaa ggaaagacaa tacaactaat
   167401 ttagttacaa caagagagtc atttattgtt cgtaacgttt taggtatttc tccatcaact
   167461 ttttaccaag cggagatgtg gtatccaaac acacttcaaa gccgtttctt cgttgaactc
   167521 tgtaaatata ggtttagatt ttagtctcta catattgtat aactattgct aatagcatga
   167581 tgtagagtta ctcacataat ttcagtttta tcacattcac tgcttggtag tttaattctg
   167641 actatctgga tgtctgtcgc gttaatgcct ttcatagtac gtggacatag acagcgtgga
   167701 tggtttgcaa aaacggtacc ggataatata agcataaata ccattgtaac tacaaatata
   167761 ttacatgcaa gtttgttaaa ctgcatttcg aatttgttta ctagatgtat actttagtgt
   167821 aataaaacta ttcgaaaggt ccgtctggtg ttgaacttga ttgagactga tcttcttagt
   167881 atccatactt gttatacagt tgccacatct aatctgtaaa cagtgtcata aaatgttgcc
   167941 aaaacgatga gtatgttcct ccgggaaatt tggatagtac ttttttcatc atcggcgcct
   168001 ctggattcaa acaaactttc tgtccgtttt ttagagtggc aataatttct ctgcgatcac
   168061 aaccgccgtt tggtttcgta atggtcatgc tttgaatatt cttcggatga attccttgcg
   168121 tcacttgtag acactgacaa cgcaattccg aagctgcggt ctggtgatgg gcaatcaaag
   168181 tcatcagtag cagggccact cctaacactc gcgggttgaa tatcgcgcaa ttcatgttta
   168241 tttcgatgcg atgtatcttc tatcaaaatc aaaaccgtgt gatgtgcacc cgcaggaagt
   168301 ctgctagcga tgaacatggt ggatggtgtg gtcctaaact aatggtagta attcacacta
   168361 ctctagggtt acaaaacggt tgcagatttc acagttctta tcgtttactt ttatgagact
   168421 tttgcctaca cgacaccacg tacccggagt cgctggaaat ctattccgaa ggttttcata
   168481 atttaaacat atcggtggtc tgttatgtat aggattaaaa gaagcgatag cttcggttac
   168541 ttcgcaccta ggacccgcat gttcaattga taggcatagt gtcttgtgtg gaattctgtt
   168601 gtattttttc ccaatacact gacagcgctg ttccgcaacc aaaccgtgaa cagaaagaca
   168661 cagcaataca tatgccacac aaacacgcat cacgtattgg tgaacgagga atgtttattc
   168721 attggggaat ctactgggaa aacatgatgg tgcccatatt cacaaacttt ctctatttcc
   168781 aatctaacca ccatagcgag ttagcatgcc agatcttatc cattcgcaaa tgtaagtcga
   168841 atttattaca ttggttacaa ttgtgtacat attcacgagt tccattaaca gtcttcttta
   168901 cacagtagat tccgttacca tttggaatgg tgctatttac aattttaaag tccaagcaca
   168961 ggggtaatcg tggtttccca tttttgttca tgactgtctg cgggaaatgt gctattgcct
   169021 cgttaccaca gggtgagccg tactggtgaa gccagagaca gtctgatttc ggaggaataa
   169081 atcctagctt cgttttacct ttgcatgggc attccttctc tctggcggtg ccttgtaccg
   169141 taccacaaag gaacataatt acaacacaca acagtactaa cgaccgcatg gcgatcaaat
   169201 aaataaacgt aagatacaca ctggtccgcg cagccgccgc ggtgatgttg atggatgatg
   169261 ttgatgacac gctttctgga gatccgacat gatggtaatt gtttcctgaa cccgaacctt
   169321 tgcagcacgc tggatggaac acgaccacgc tttccagcac gcatcttact cgccctagag
   169381 tccgctaacg acatcagagg taggaaaagt ttccgaagca atccaggcac ccggtatcca
   169441 gtccgactct tcaagttttt tcaggatctt ggaggggatc agccgcaggg tcactgcggt
   169501 tatggcgctg tgcctccgaa ggacgaggga gcgtttctgt gaggtagcca tcagtactgt
   169561 gcaggcccca tggtcgtcgg cgcaggaggc gtgatgcgtc aggcgctccc atcgtccagg
   169621 tccgtcgcga gatcgagcgg acagcagctg cacggcgttg tggtactgat aaaagaccat
   169681 atggatgttc gagggggact ttccacagat tctgatcgac ttataaagcg tgttagacgg
   169741 aaatactccg tcaccctttc cgcggattcg gctgacgcgg cgtcacatgt tctgcgagtc
   169801 ctatacaaaa gtgctgctca gaagggtcgc gcaggtaggt acgccacgat aaaataaaga
   169861 cacatgagac tcacaacatc gtgactgaga ctgtttttta ttgtgcattg tggttatgca
   169921 atgtcatcct gcatttatat atacacatct atctgagata tctcttattt ttttttgtat
   169981 acaatgaaag aggagtatga acaaaatcaa aatggacagt cgtcggtttc ttggctttct
   170041 gcatatcagt gctttggaag ggagtcggtg aaaacggaga actctgggcg aggaggcggt
   170101 taggcaatct tttcgtacat gtaggccgtg agcatcttgc catatgtagt gttcactaag
   170161 atcagtcggc agcctagcgc caggaggatt atagaaaata gaaagatcac gaatatcagc
   170221 aagaaccacc agtctcgggc tgcatcatcc tccgggagca cggagtggtt gccggcctgc
   170281 tggtgttggc ccgagtccac gtgcgcagaa gcagtggagg agttggttag ccggcagcgc
   170341 acgttgtggg tggtgttgca tctattcacc gctatcgagg agctattgca agtgtcacat
   170401 tgggtacaga tggtttcgcg cttgtcgttg taggacccag ccgggcacgg ctcgcacacc
   170461 gtcccggtgg tttcgctgca gttcgtcttt accctatatc ctttgccgca ctttgggcag
   170521 cactccgagc ccaccgcgta ctcatcttgt ttacacgcgg gtgcggcgga ccgacttgcc
   170581 aggacagcgg cccagatgac cgacagtagc agcatgtccc tccggggtgg ctcatggtgt
   170641 ctcgcaagtc gcgtcaccct tccgtgcccc cgactgaccc cacggtgatc acgggccagc
   170701 ggtttgccat ccgaacaccg tcacgtaaat acacaagccc gtgccgccat tttggttttt
   170761 accccactcg gcgcacatgc acacgcaaca cgcgacaaac acccagagat cagatcactt
   170821 catgtattca ctacaagcgt ctctttattt tgctatacag aggcggtacg gcaacttcat
   170881 cgtacacatt ctcatccacc aagtcgttgt acgactcgct gcggtcttcc ttctcaaagt
   170941 acccactgtc actctcctca tcatccgcga ccgagtacaa ctcatcgtag ccaggcgggc
   171001 gcatgaaatg cgtagacata ggtcgatagg cgttcatctt tttctgaaag cgttctcggt
   171061 tcctgcacat ctcaccgcac gcacaccgaa ccactagcac cagccccagg cacactccgc
   171121 caatcaccat catagtcaac cccagagaaa cccattgcca gtctataaca aaaataggga
   171181 caggagtttt ttctgtgggc agcgggggtt cccgacgaaa gttctggcta cggaaacaat
   171241 caccatccaa aacatactgt tgcagcacgg gccagcatcg atcaggctcg gacggagggc
   171301 aaggcggctt ggtgttggac tgattattag ctgccaagta atagtacagt ctgtcgaaac
   171361 cgtaaaaggt tccgcactgg tggcgctgcc actcattgta ctctgagctc cagatctttt
   171421 taccatctgc atgaaatccc aatttaggcg cgcagtctgg atcaccgggt cggtgcagag
   171481 tctctatctg cgttactatg gtgaacctac tcgtgagaaa accgtgagtg gcattgcgaa
   171541 gcacacaatc gaacatgcca gtagtgttat cactaatgtt catagtcagg gtaacataat
   171601 gagatatggc caaatcgtga aacttccagc tggcattaat caggcggtga gtcaaatcat
   171661 cgtccacggc cgttccgtta gtggcattga tcttcagctc ataaccgcca tattctgatt
   171721 gacagaaccg cgcgcggata gacaccatcg gccaagagtg aggcagaaag gcacatggca
   171781 cggtcacctg ggacccgatc ggcataatca gaggtgccgg cgaattgtgc tcgtagcact
   171841 cgtcccacat ggtgtggtct atgctgcctc ccctcaccct cggcgttagg ctcaccatta
   171901 cgatggtcat cgccaccata gcgcgtctca cccacatagc ggctcgcggc gccgataccg
   171961 gcgtgcaggc tttgactcgg agcgccccgt catgaatagt tcgttttgaa gccgattctg
   172021 cgtccgcgga gtctgcacct tcctgcccct ccgccaaaag ctgcacggtt tcggcctcct
   172081 cgcttccccg gccgaagcct tttcgaaacc gcacggtaca cgacatgata ccggcagttt
   172141 cgacgtgcag cgaccaacaa caatcccgcg accgtggctc gtgctcaccg ccgaatgtga
   172201 gcgcggcctt tatgacgaga tcggttgagc ggtcctggaa ctcaggatca tcatagtgtc
   172261 gccgctcgtg gggtcccagg tcagagagga ctcgtccgcc tgctttttgc gatacactat
   172321 agccggcagg gtgaagtatc gcagccgttt ccaaggctta gtgcaacaga tagaaataat
   172381 gatgagcata aaaatgagaa aagacagaat ggtagctacc acgattggaa tttccatggc
   172441 gcaagaaact cagagtccac cagacaacga cactgcacaa gctagttaga tatagaattt
   172501 atttactggc ttcacaagct gcgtcacacc ggcccgtccc acgtccgctc tatcatcatg
   172561 tgtatcaaca accaccacca acaccaatca acccaaccga tcgatcgatc acccagtctc
   172621 tacaccatat gcgtatggtt ctcaatgtcc accacagtct ctgcggcacg atcaccgctg
   172681 ctgtcactgg tgatttccac acggggcagt tcatggggtt gctgttcatg aagttgctgt
   172741 tcatgggatt cgtaggtcgg tggcgagtaa tactgcacgg ggtcgggcgg gccctttggt
   172801 ccataccacc actcctcaca tgttcttact atgatctcca gtgccgtctc cggctcgtca
   172861 ttctccaaaa ccctcaggct gcgaaagtcc ttacagttgc agccgtatcg gtaccagctc
   172921 agaaaacagg agcaagtgaa cacgtattgc agggttgcac aggcgtgtcg cggatagtag
   172981 cacaggtata tactggccaa gacgttaaag atgagaagaa ccacaaagat ggcagtcaac
   173041 agctgtgcct gtattatcgg gtccatggtg atagggaaga gaggtctttt aacagttaat
   173101 tttggtttac gctcattcta atgttgcaga tgagatggca acttccaagc attcttgtac
   173161 ctcctcgtgg gtctgcacgg gtgtctgtgg cgcggcggcc tgggtaagca gtggttgttt
   173221 gctgacaact cgagttactg gttggttttc ttcaatggtc accaccgtgt ccacgggctg
   173281 cacattctgt acttcaggta ctaacccctc gttgttatct ccttcgcggg gcggagagta
   173341 gtactgcaca gggtcaatcg gcggagcact cccgcgccac caccgtctga atcggtctgt
   173401 aatccatccg cctatcgtga acaattctcc gctgttcaga gatgtaaggg ttctgaactt
   173461 ttggcaatcg cagccgtagc ggtaacaact cacgacacat gcacaggtga gcatgtccat
   173521 gatggcagcc ttggcttccc tcggatagta gcagatgtac acgatcccca atatggtgag
   173581 gatagtgcat atcacgataa cagcgagcag agcgtacaac tctgtgtcat cagaacccat
   173641 gacggcggcg agaacgctga caagcagtca gttagccagt cagtcaagca caaaagcagc
   173701 tgctgcgagc cgtccaggta aagccgacgg tgttttttat ctgccattct tgctcgcgtc
   173761 agtccatgcg tcattgctgg ctgctgtcgc tcacgggctg tgtgctaacc acggtttgca
   173821 tagcgacggg agcctcggag cccaggatgg gtgccgcatc tgacgacact tcgaacacat
   173881 cctcgtcaag cgcatcggtt tgttcctcct gaatggagga catgggctcc tgcgttccat
   173941 ctgctgacct ggatctgggg ggcttgctga tgcggggctt ttttgttttc aactctttga
   174001 gatagtcaat ttccatcaac acaccctctg cctggcgtct gatctcttca cccttcaggt
   174061 agcttttcag caggccgacc tccaaatcgg gatcggaatt ttttgaacgg cagctttttc
   174121 ggcaaccgcc cagaaggatg ccgagccacg gacatgtgaa cacaccttgg cagacagcca
   174181 tcatgtgcag cggatacacc aaggttagaa ttaagaatcc agtacccatg atgccgacgc
   174241 ctatggcaca caggatgacc acaatcattt ccatctccgc tgtggatggt aaacggcgga
   174301 tcgaggctca cctggttcga ctcgtccggc gccgcaccga gtcccgcgcg tacctttcac
   174361 tctggcacct ggccctctgg catccagccc tttgacaagc gcacctcagg agcccctttt
   174421 tgtagatgta caaaatgtgc aaggtcattg tgctgctgat gcgctggaac atgactggag
   174481 attacacttg tgatgcgcga acatgcgcaa gtccatgtgc acttctgcta tttttcagag
   174541 gacacctgcg gttgcatctt catcaacatc tgcagggtgc tgcgcacagc ggtttcgatg
   174601 acggcagcca tctccggtgt cacattgggg atttgcatca tatccgtagc gaagatagta
   174661 gcatacggac ttgaggaggg agggtcagga gtggtattgt tgggaacctc agtaataaca
   174721 gcatactcgc cttccatcat caggttaacc ttttcacagt tcttgtagat tctttccgtc
   174781 tcggtgtcgg catggctgag agaacggcta gtgggtattg caggcaaagc ggcggtgaca
   174841 atcttttcac tttgcgtatt cactgcttca tccatctcta tgctcactcc gtttgtggga
   174901 attttcttac ccgatgccgg tgggcacatg atgagcactc gcttgtaatc ctgggcgaat
   174961 cgcttcaggt tctcacgcag gtacacgttg cggtactcgc tgtcaaactt ttcacctcgg
   175021 attctggtaa caagtgatcg gaaacagtag catgtaaaaa tgtctttaca cacactgccc
   175081 acgcgtctca catggaagat gagaagatac agaaaaagaa ggatggcaac aattgctatg
   175141 gaaagaacga gtcccacaat gatcttatcc tcttggttag tcagcatatt cgcgggttgt
   175201 ggtggtggtt agttgtcttc agtgcagttc ttgagcggag cgatgttggc acggagcctt
   175261 ctggcacgta gctttgtctc aacatgcttt tatgtagaat gacagcgctt gctgtgaatc
   175321 tgacatgggc gggttgcaca gtacatgtca atcatgccct tctgaaattt gttcggtgtt
   175381 ccccttgcgt gccgcggcaa gccgtcgtat gcaatctgta cagcattccc tgttaccttc
   175441 tgaaatctgt tagccatggt actggaaaag ttatcagtgt ctatgacacc tgtcataata
   175501 atcgggtagc tgaaacatat gacctccaca tagatggccg ttttcagagt tccgctaagc
   175561 atgacgccgt ccaaagcgtt cctgagtccc gcgtcaatca aagatgtgag tcggtcctta
   175621 agctgctgca aatccaccgc accggctttc tcagatggta tgcgggacac atctacacgt
   175681 acttcgatgt gcgtgtgtct cgcagcagga gttgagtagg tgagctccgt ttgcgccgct
   175741 ctggatacca ttatgggttt tgcgggacac gattcgtgcc cgcggccgcg cctgcctcgc
   175801 aaacatttct tcaacttaca gaaagctgca cgaacggacg ccagcaacct catcttgatg
   175861 aatcaaactg tggttagtgt agatgctgtc ttgaggatgt tgattggagt ttgatatata
   175921 tagtatattc agtctaggct atgtcagtga tgtatctcta cctccctctg tcttccttct
   175981 gagatattac gcacattcca aaacgtgctc gaaggcggcc tggaacttgc tattcatggt
   176041 ttcggaaaaa ccttcatcat ccatgatttc ggccagggcg gcggggcagt tgctgataag
   176101 cactttagcc tctgccgaag actggtacgg attaattgcc tgcacactga agagaacgct
   176161 ttgtaccttc tccgtaagca gcgtggtcag ttcctccgaa aacgtacacg actgcaacgt
   176221 gtatgtgttt tcggtgagga aagcacacag gtccacctcc atgtcaatca tagtgtgtcc
   176281 cgagacagaa gtagagtagc tcagtgcggt tttcaccatg gattctatag tggcagtgtt
   176341 ttgagtacat tggctctgct tgcgtttgcg gcgaaatatg ctgagaaacc tttgcatcca
   176401 tcccttcaag gttctgtaaa ccgtcgatag catcctcacg atggcgcagc ggtgctcgtt
   176461 gcgtggatgt ggttctagat gctgcagatc tagagtggag caagcggtgt cttggcactg
   176521 gttcatatta tcatgaattg tgacacatgt catgcttagc ttttcggtgc gtttagaagc
   176581 gcggctttca cggcggcctc gacggtagat tgaatgagca acgccacttc tggcgttacg
   176641 ccagccgccg caggtatatc agcattgggt tccggggtcg gtgcgggagc gggacagggt
   176701 tcgggatctg aatcgggatc tggaacggaa tctggaacag aatccggcgt gggtgtgcgc
   176761 gccgcttcct cttcggtatc aggcgcctca ctcacgctat gtttggatgg aggtttgtga
   176821 ataagtgcct gggtttcggc gttgtctgcc tctgcgacat tggtgtgtgt ttgcgcacga
   176881 ggaggctcat ctagagttgg cagttcgcac tcaaaacctt ctaggtccac ggtcacaaac
   176941 tccacctcag tctgtttctt gttctcgggt tgccctcggc ggctctgagg cggctcggtg
   177001 ggatacagct tggcagtgag ccagttgaag caagtaaagc agcatggaaa gtagaattcc
   177061 aaattttctt tagttagctt gtttctaact gaaatctgcg agcaacatct tccaataaaa
   177121 gctacgcatc tggaaacgca ctgacaaaaa cctgcccata gagaagcgca ccacaaagaa
   177181 caaacgcaca tgctttcttc ctcatccccg gtggacgcgt cgcgcttcgt ttcctcatca
   177241 ggcattctca ctggacagtt aaagcgcgta cacagtctac cgaataaatt ccaaatgtag
   177301 ggacatacac gatctcggta gagaatgatc agtatatcaa agattatggc tgctggtatt
   177361 ccaatagaaa gcaaaacaat cgtcgcagta tccatcttta tcccaagaac cgaccacccc
   177421 gacaccaaaa gaaagccaca gacacggatc actggaaaag caaatgccaa gcggcctttt
   177481 tattactaag agtcatgtga aatggcgcag cctcatggaa ttgggataaa gtgcaagtga
   177541 ttaaaagcaa aacatatagc gagttacacc aactgtttta aacatcacca tctgcttaca
   177601 gttccgaaac caataccgca cgatatttat gaacttgagg cgtatacaca gcactgctag
   177661 tcagttcggt ttccacaaac accttttcgg tagttgcaca gacaggaccg cataacacag
   177721 taggcctcgg aggagcgacc tgcacttcag ttttatcatc ctgattgttg ttagtactcg
   177781 ggtcccaggt gtttaccacc tcccactcca ctctctggtt cgcttcatct tcttggtgtc
   177841 ttcggctcca atgcgatcgc cgccgtactt cgtaacgatc tttttgacaa caatggctgc
   177901 agtcgtgtcg gcacctgcac catggtccgc agtcacagca cacctcgtaa cacagtctgc
   177961 aggtgaacgg ccagtcgtaa atcaggtaga tgaggcccac tagcgatgtc attccgccgg
   178021 ctccacatac cagcacgcca agaggccaca tgtctaaaac actcccagca gaattggtgt
   178081 tacccggcga tgtagcgttc atgttgcggt agctgctcgt cgtcatccct atatttcggc
   178141 ggtaactcac ttttctggtt ctgtaggttc agacgaacta tgatgaaata tacatttgct
   178201 cgtaaccagt tgtcaatctt cttctctccg gacgatattt gacaattagc tcttctctgt
   178261 cgtccgaatg gcgctgtcgg tagtacctca ttcttctcat tcttccctgt ccaaacatta
   178321 atgccacgac aacggtaata actagtgcca aggcccacac ggcatgcgta gctggggctg
   178381 caacatcttg aaggtacaca ttaacggtag tgctagatgt tggtggtgca gaactaacaa
   178441 acgtacaaaa gtcaggtgta ctgttgggat agctagtgcc gtttccagat gtaactgtaa
   178501 gatcaaaggc ctctggtttt ggactgttgt cttgtgtctt tagaacatat cttcggctat
   178561 cattatgtgt aacattgtat aacattaagg tggacttact acaattatag caaagggtac
   178621 cgtaatgatg ttttgtctga tgagaacctg acgttctgca aagttcatgt tcagttggtt
   178681 ttccagtctt gttatgcatt aaaacccaat atgtatgatg atgagtggta atagaaaaat
   178741 tagttgccgt caggtttaca gtttctccaa cagtcgcatt aacttttact aatgtgtatc
   178801 cgagaacggc agctgtggat gtacgagttg tggtagtatt tacagtactg ttgattgaag
   178861 ttatgttaat gttatgtgta ctcgttggtg tagtagtaat agctgaactt gatgtggtaa
   178921 tggttgtgtt tccacttgta ttagtaaata tttcgctact atttgaagat gtaacggtag
   178981 ctgcagatga agtagatata tttgttgtaa ttgaggtatc cgtactagat gtatttacag
   179041 taccggatga tgttactgta ttctgagttt gagtgggtgt tgatacgttt gcggtggttt
   179101 ctgaagtgga tagcgctgta ctggttattg tagatgttac actcatattg gtagtggata
   179161 taggtgatgt gcttatgaag gtagatgttg cattagtagt agttgctact gttgatgtat
   179221 tgtttgcagc ggcataacga gaaagtatgg cgatgaaaat gtagatagta cgatccttta
   179281 taaggtagct tattctgaaa tgcatattgg aattttattc acacgccgtc ttgatgtttc
   179341 gacgtacgtg tcttgtagtt tcacagccgt tacacctaag tgatcatgac tccgtctgga
   179401 acacctttat aggtcgttgg tacaataaaa tgcgtcattg ctacgtgctt cagatttcca
   179461 cttggatgtt cttcaggttg aaagttattt aaaaacttgg agccttgcgg gttctaataa
   179521 catacatgag ttagataata taatacatgc aaataaatat ttgctaatgc ataataaaac
   179581 tgaatacata ctctaagaat taggatagtt ttgtatattc tggatgtcgt accgatccat
   179641 gtcaaatctc tagagagaag ctgctggagt caaaatattg tgtagtgttt ataacactaa
   179701 atggagggtg cttctaaaag taagttaaaa attatgaatg tctaaataag ttatactgca
   179761 gatatacgca ttctgaaaga tacaaaaata aaacacgtac ttaaacgaat cagtagtttg
   179821 caatttctag tagttgctca tgtatctaaa aatgaaagca cctttactta gtaatttaca
   179881 aaggtaacaa acactatata atactaacct gctgcaatag tacttattat tcaagtggaa
   179941 aatacaaaaa cagttatgag ttatgaaaca taatagcaac acatattcac ttcgctttct
   180001 gttctagcgt ttaggtttat gttatatggg tattatactg aaaataaaga tctatattca
   180061 tactcaacat cacgcactct ttcattactt gtaagatgaa tatgtatatc acgtatatac
   180121 aaatgtgtgt catagtttgt taacacaatg tgttactacc atctatttct attgtattac
   180181 aggaagttgt ttatacgttc agtatattac gtactcatac cattgtcctg catttgtgca
   180241 tagacacaca cacacacaca cacacacact gacgcgagat ttacaaattt aaaaatagat
   180301 ctcatggtta tacaaattaa actcataaat catgtcacaa ccttatttat ttacacgcat
   180361 aggaaatctt tgtatatgca acatgtcagg ttcttccgtt aacataaatg tacagataat
   180421 tataactttt tttttacaca tttgtataaa cattgtgttt ccgttgcagt gacgcaacgc
   180481 acttcctaaa catctgcaca acggcttgcg gcagccggag ccagcaagcc acagcggcgc
   180541 atatgatcaa cactacaagt atccaaagac catgcagttc tcgggaagcg tattgagcct
   180601 catagacaac gagcgaaaca ttgtatgtaa acgatgtgga tgctgatgtc ggtaacgatg
   180661 taagttgtgt tgtcgacatt gatgttgttg taacggggcg cgccgtcgtg gtccaccatg
   180721 gatgagaata gttactacag ttatggagaa ttggaatggg tggacctggt gtacgggtag
   180781 tgttactcca taagcgggag taaccagata ataaacaatt ggtagccttg ttagtacatt
   180841 gaaaggtagg tgtacctcca aacgtcaata ctagatagtt ccagtacaag tcctgtccac
   180901 agagtttaac agtctcatta tgaattaccg tggcgttcac agcaccttga acaatcaacg
   180961 taaccgttcc cggaaaggtg ctgttgaaac tgcaggatac attgtataca ctctggttag
   181021 tgggatgttt agaagcatag gtaataccca tgggagtcac ctgggttctt cgagtaatgt
   181081 tcatgatgtt agtaacgttg tcatacgaga aacagtcgta tgtcccgggt gcatagggag
   181141 atataggcca tcgcattgtg aagccatctg tattagtcgc actagtctta gactcgtcat
   181201 ttggaaatat tggtgcatgg tttttataca tgtaaacttg tgtgctagag ttttgatcgc
   181261 atgctgtaaa ataaatgccc ctagtacatt ctcccgagac aaatacacac gttaccgtgt
   181321 acggacctga cagtgtttcg ttttttgttg gaccgctaac gattttggtc atgtttgtgg
   181381 gaagctgata cttcatatct gtattactgg tataatcttt cgaagcacag cgtaacgctt
   181441 ctccagaggt accggagggc cacatcatga gcagtattaa ggcatgcgca tgtttgggag
   181501 acaccggctg catcatggcc gtactcttga ccttcaagta agtacccagc ccatgattta
   181561 aaataacaga cggaaactgt aactgttaaa atcaataaat acttttatta taaaagctgc
   181621 aagaatccta tcgagttctg tgttgtctgt tgcggcggag gtcgaaccac gggtttcttc
   181681 ctcacgatgc cccatatgca aaacccaaac aggcacagta aagtgacggc cattacggag
   181741 atagtcacaa tgtccacggt actaaggctc atctgtattc gtacagttgt gctgactggg
   181801 ttcgcagaag taatattcac gcgcgggcca tacagcctac gaaccggcga tcaacagcgc
   181861 atatcggagt ctcgtaggct cgcagaaccg ttccccgatc atatttatcc cacacaaccc
   181921 tcacgcacat gacgaaacac ataggccgac accactttca cacatgtccg tcccagatgg
   181981 cctgtttgat acttcggtag ctaaaccgtc gccaccttgg tttccgcagg ggcttccgag
   182041 gcgaatatag ttcgaaaccg cgaatacagc atgaaaacag acgatcgcac cgccgtggct
   182101 gtgcgaaccg caataggcgt tgcagtagcc atcgggcttg tgagtctact catagccctc
   182161 atgtggtggc tgctggccaa gtaacgatcc acaccatgaa ttgtcgcacc agatgtttat
   182221 tgttttggga gatgatgggg gtgagcgtgg tgttggcggg cgtactgggt ttgacggcga
   182281 cggtcctgct tcacatgcag cacgtgttgg ccgccaacag cacgtgcgcg gcgggaaaca
   182341 acacgagcaa caccacaaac gttacgggct gctcgacgtc gtcgtaaccg tgcgacgcgg
   182401 gggaatgcgg cgcggtggcg gaggacgagg aggacgcggg ggtagagggg gcctagcagt
   182461 actgagagct aggacctggc taccttcggt tcctcccttc tgttggcaac agttattatt
   182521 ggcgcccgcg cccggcgtct tgacgcccga tgactgtttg cgacaacgaa agctcaataa
   182581 gcgtttggaa agagagggct tcttggtggc ctccttgcta tgtctcttta gcagcgtggc
   182641 gagatccgtg cactgtcgat tggcgtgaca gacgcgtgtc gctggttgct gggtatcatc
   182701 acactgaacg gcaggcgacg agggaggcga cggaggggat gcagacgaca tagcggagac
   182761 agccgaggcg gcctgagcaa caacagcggc gttggcgtcg ctcggacagg ggttcttagc
   182821 tgtcaatctc tgcaggcggc gcggccacag cgacttgcgg ttgcggtgac ggcggagagg
   182881 caaccaaata cagcacttgg tcgacagaaa cagaaggaag gccatcaaaa gtcctaggag
   182941 aaacacaacg caaagagcaa tctgaaaaaa gcgactagta aagtccatta tccacaacac
   183001 ggtgtccatg ctgacgagtt tgttcgtata aaggtgtcgg atgaatgtgc ggcgccaaca
   183061 cgcagacctt ataacgcctt aggggctgag cgggcagggc ggggagagga atcatgatag
   183121 tcggaacggt ggcgcgaagc gggtttgcgg cgtgcgcccg tgccatggag cgcgttgtcg
   183181 tcgtcgtggt gccgaggcgg acgcggaggg cgggagaggc ggctgccctg ggcggcggcg
   183241 gtagcatgat gcaggaggac ggaatggaaa gtagatgatg gcgaggagga agaagagtcc
   183301 acagatgtgt gtatcgtgta tgaagtgtgc gtatgaacag ggtgatggca tgcgcttctg
   183361 ggtgagacgc gcgaaagtga aagcgagcgt gtgcgaggag cgcgattggg acctcccgta
   183421 aaggctgtat gatcattcgc atgcagctgt gcgcttggcg tagggttgtt atccgacacg
   183481 gcagagaagg acgagatgac ggcgtgcaca ggcacagaga cagcgcgaaa cacgcgtttg
   183541 cacaacctgt acgttgcggc cataggaagc aaacgctgca cggcaaggta gcgagtgcgc
   183601 tggcggagcg agaagccgca gcaacggcag aactcgttgg tgagagctaa gagaaaagcc
   183661 acgaagagag tggtcactgt aaaagcgaaa gtacagcgaa agaaggtgca catgacatac
   183721 atataggaaa gcatggtggc gcgagggcta gctgcaggat tgaggagaaa gccctgggtt
   183781 gtcagtatgc gagcaaaatg ctcgccggag cgaagtttat gagcacaggc gggcatgggc
   183841 gggaagaggc gtgcgatgaa tagtcattag tgaggccgag ggatcgaaac agaaactgtg
   183901 tgtcctggcg agtcaggtaa acacaggcgc tgacaggcag caacaagtgt atgcaggtac
   183961 tggcaggtga aggtgaactg cgcaggtaat cccggcgcac ctggacctgg gcgggccggt
   184021 tacccggccg tctctcaatg acggtgtttt cgaggcgaac atgttcgggc cgaacccgct
   184081 gggcatacgc ggcggactgt gtatcatgca gttacagtgt aatgacatag cacacacagg
   184141 cagtagcaga gtgcagtgag cccgagcgaa acctgatcga caggttggcc gcctgccaag
   184201 tctcccgggg gagaaaagaa aaccgcgtga cacggcgacc ggcggcgatg catgacagac
   184261 atgcccccgc tcccgcgaat cccccgggtg gcccccgaga ccccatgctg tgcccggcct
   184321 ctctcctgtg cgacctcccg ctgcgttcgc tgtcaatcat aggcctcccg ctgggcgctg
   184381 tcaatcaatg cgctccattg ttctctctgt tggctttctg cccattgtta atttctcttg
   184441 gcgcgccgcc cggaacgtat gtttgcatcc acaattcaca tacatgttta ctgatcacgt
   184501 atgtgcaatc tcatctggct gcatgccaat gtcttctacc aaccctcaca gccaattgcc
   184561 attttcagcc ccccgcccaa aacacccccc acccccttcg cctcgctgcc acgacccgaa
   184621 gcccccgccg aggcctcatt ctccatacag gggaggaaat gtgctggctt tctgccactt
   184681 cgcacgcttt gccagcgtcc catgctataa agctcgccgc ttctctccct tgcctcacgt
   184741 tctgacctga acgcctccac ttcgcgagac cctctaccca actctccaag agccacctct
   184801 ccaaccatgg cagactcgac caccggcccc gactttcgcc accccgagga agaccagcta
   184861 gtgccgcagg tatttgtctc tactttgtac cgctttatcg ttcgctcgcc ctcgcgaatc
   184921 atctctttct ccctttcttt gtcgatttgt aggcccgtcc gccctcgccc ttatgtcctg
   184981 acgttgccgt ggttccactt tcgcctgaaa tgcctaagtt gaccaagcag cccgaaatgc
   185041 cttcgactac tccaatctgt acttcacctg aagctcctcc gaaaccgccg cgcctgcaca
   185101 gacaacggat gcaatcgacc gattgtaaac gcccatctga aaccgactcc gacaaagaaa
   185161 aaagccccag cgctccgcac tctacatcca acccaacacc aaagccacca tcgaaaccac
   185221 tatcgcaccc cgcaccggag cccacgcaga atccgcagcg caaacgccag aagaccgtgg
   185281 tcaagcgtcc tagccacccc cctccaccgc ctcctaccca gaccgccgtc attcccaccg
   185341 tgtgtgttag cccccctccc tcagatcccc cttccaagcc tcctcccgtc cctcccaaaa
   185401 gacgacccga gttacacctg cccctcaaag gtccacgcat ggtttctatt gagcttcctt
   185461 gcctcacggg tagcggctca cctacctatg actatcctgt taattcggct cgtaccctgt
   185521 tataatccaa acaatccatc cgtagtagtc acgccgaaga aggctgtgtc gtctctttct
   185581 ccgcagcccg ttgcctgcgc cgctgcaacc accgctccca ccagcctcgc atgcggaacc
   185641 gacccttaac tctcttccac cacgacgctt cgtcggctgc tcctggacat tccaagatgg
   185701 cagcggggca ggacgccact gagacatacg aacaggtgga cgaacgcgac gaacgtgacg
   185761 agtcggagtc cagagtcaac gagcgactcc gtaaggcatg cccccgccag tccccgcact
   185821 gacaccacac gtcatgcgcc cccttgattt gcagtctcca ctgcgcctcc acctgcgccg
   185881 gccagctctc cggccgcggg agaatgtcct ccgcgagcgg caccacgtat tcaacgtgcg
   185941 ccttccagtc catgcaggcg caccacaaat cgtgggagtc gtcagcgact cggcgccatg
   186001 ccagctcccg cataggcgtg tgtcccacaa gcccgcaaga aacggcaggt tccatgttaa
   186061 ctgtgcggac tgtaacccga aatgtgtcta aagttgtatg ttgtcgtgat aactgtgtag
   186121 cgcgattgtc taactaatcc ctgataaccc gtgttgtcat ttgatgtaca tgctgtcacc
   186181 cgttccccat ttctatgtgc ctccccgtaa aaatagactt aacaatatct ataaagaaat
   186241 cgcaaaagac atgttctggt ttctgtgtcc tttattcgcc gcctcgcgct tagcacataa
   186301 aagcacggag gaataccttt aacgtccgtt catgaaataa atacaacaca ataggtactc
   186361 cacaaaccat aaaatgcgct atggtgacta atacacacca caatataagc caccaatctt
   186421 taaaccaata agctctgcac attgtccaga aatagtcatg cgccagaaag tccggtttaa
   186481 cgtgaggctc acatataatc catatctcgt cggatatgtt taatgaaaat cgcatgtcca
   186541 ctttagtggt agtccaatcg atttcgtagt atcgtaagtc gtattccagt ttatctgaac
   186601 tgagtttaat gtctttttca aaaaatcgga gatactcaaa tcctttgtca cggtttacca
   186661 taacctgcac aaggtaagag tctatgttgc cggtgatgta tcccttcatg aacagcttgc
   186721 cgccctccag ataacatgcc gtctgttgaa cggtgtataa cgcgcgtcgt gcagctagct
   186781 cttcttcagt gagcactggc gtcgggaaat cccagccgaa tgtcagtccg agctgcagcg
   186841 caacgcctcc gagcaccaat attgctagag aaaccgccat cacgaacgtc tggattcgta
   186901 gcagctaaca ttgtgcacgg tgtttctgat ttataacaaa aagcgctaca cgtaagctgt
   186961 tacgcgtata ttgaatgaga gccaactcca acccactagg cttagtgccc gattgcctaa
   187021 gcaagtaact atagagtcgc acaaaaacac atgactcgtt attctttatg gattacaaac
   187081 acttttattg cacatattat gatgaacaaa catgttgccg taacactatg acagtgtcac
   187141 ggccatgttg tccgttatga ggtagttgcg gttaattgtc cacatgagca ccacgcctta
   187201 tctcttctat gaaccggcaa ttccaaacat ggtatcacat tgagtgacag atcagcagtc
   187261 tgcgatgatt cgtatactgt cagctgctcc cgttccatca tctgtaacac atataaaact
   187321 cgttacggtt ttgttccgat gcatgtattt cacctgctaa ccacccacat gttttacact
   187381 gcaagatgat atgtaacaac cattttacct gctcacacct tgtggttgtt aatggacacc
   187441 tcgccaaaca gacgaacatg gaggctgaac tttgctgcga tgaatgtgat gattgcgaat
   187501 ccaacggcaa cgtaaaatgc caatctcgca agcaggatcc agtcattgcg gcgagatact
   187561 ctctcggcat accaaaagat acttgtatga tcaatttcga cttgaacctc attcacatag
   187621 cagacaaacg ttttagccaa tccataatcg tgatacatgc gcaagtcaac gcggtatatg
   187681 gtaggagaga cagcttcgtg cacttcccat gttctggtag taagcgtaga atgtgtctgt
   187741 ttctcatgtg accgacgaat gctattccgg tcatgagtaa ctatttccac gcgttggagt
   187801 ttcgcaaaat cagaccgaac agtaaacgtc gctgccatct ttccaccctt aacatgacaa
   187861 cgtgaatgaa gcaactcata cgacgatgac aatggtaagg gacttgcatt gatgaccagc
   187921 aaaagcgata gcagtcccaa tgttgtaaca agaatcttca tttcgatgtt agacagtgtg
   187981 tcccagaatc taggggtgaa agtccgcaac tgtcctacag aaagagcggt atggagtgaa
   188041 cggtgtttgc agatatatac actagcaaac acgcccatga gagccacgtc agaatcattg
   188101 acgtagattc cataccgtca ttctgtgtac tgaccgaata tggacacgga acattcgtcg
   188161 ttaagcgatt ttaagtacgt ccttagttaa agttacatgt aaccacaccc attataggga
   188221 cgttacaaaa tctctattgt atatctagac ggcctttgac gattgtccgt tcatcacgat
   188281 gatttgcagg ttgccgatca tttcgcgttt cactctccca aaggcttggt gctatagact
   188341 ttggagtaag tatctatggc gcctggcctc tggggaagtg gtacgcgcaa ttcgggacgc
   188401 ccgttcatag gaaaacgaca gggagggatc atgatacaca gatttttttt aagatctatg
   188461 ccctttgatt ttatcggctg gatcttggcc taggtcgtta ctctcagcta agtgcaaaga
   188521 tcctgccgac gaaatcatag gatttgcgtt cgaggataac caattcttcg acctaactac
   188581 gtatcattca catatgcatt atctagagca tatgagcatg ctgctgggtt gcatctgatg
   188641 aatttacaga cgcataccgg aatgcataag cagcccaacg ggatataaag gagaacaggg
   188701 cgggaaagaa cgagtatata atggtgcatg gtattatgag aaatgcgtgt tatcgctgac
   188761 tgtcctgtcg ctaatcgagc gtgcgacgac ctggacgtgc aaatggttgt atggtacata
   188821 tgccttataa ataacaaccc cttgcacatc cgtgccgaaa catgttcgaa acacatcaca
   188881 aaacacgcaa attagtatgg ttgatatttt taatacaaag aatgaataaa aatatataac
   188941 agcatattct gagtttatta atgactgcca caacgtctga gacaacgaac acgatccaag
   189001 tcctcaataa catacagcat tagtgccgta agcataagtg acagcaggat cataatgata
   189061 tacagcatta gcgtagctcc tccataccgc tccagcaaga acacgatgcc ctttggtgtt
   189121 gcttttggac acccaaacag tccgcggatg ttgagtgcat gcccatggtg aaagcgaagc
   189181 tcaggatcac agcccaagat gcggatggct cgttcgtagc gcctcatgaa cgcatcacat
   189241 gcgggaccct ggtccacaaa cgggcaatgg cggcctgctt ccttctggtg aagaccgttg
   189301 tctggctgag gcacacgttc gcaggttttg tccatgttgc cgtcttgttt ctggagcgta
   189361 tttgagtcat tcctccaagc ggaggcgaca ccagataaga ctagcaaaca tatcaggctg
   189421 ccaatcacca cgttctcgtt ggaaccgcac gagccgcaga gaggcttcat aatgtcccga
   189481 tggctcacga acaatctgac aggccacgtt agacggtgat ttatatccat gatagatgtc
   189541 acgtgcagga agactgaggc gcgcaaacca tggactgcac tcaacgaccg tacgctgtga
   189601 ctccgtttgc taagcagcca tctcgcaggg ccgatggagg ttttcgccac accgatttcg
   189661 taagttgata tcaaacttta tgatcggtgc gacgaaatct tgatcgagac cttttttcca
   189721 ccagcagcaa caataaagtt catcgcatat gggtaataat taaccaggca acaacaacat
   189781 aaacaatact cataaaagtc caatacaatt tactaagaca tgagccatga aagtttttat
   189841 attcatatag ctggaacttt aaaaattgag ttaagtcata gtcaggaaca cattttataa
   189901 ataaaggttt gtaataatga tccacctgta caaccacttc tttaaacata taagacaccg
   189961 gtaaatggaa ctggtaacgt aatctgctgg catgttcaag acgcgcatga tgaatgatac
   190021 cgtgatcctt cttgtatgtc ttagcttctt ccagaagttg cataggatgc attgcatgac
   190081 tatacatagt atcattcata atcactactg gatggcctgg atttgtagaa aaggcaaaca
   190141 tgtattttcc atcataatag tttctcaagt acacatgaag ccacgtagga tccgaaaagt
   190201 cgccaagaac aattccgttt acatgaagcc gaccatcttc aatcttgcat tcgggatcca
   190261 attctgtata gccatatata tgtccatcag gtatgccaga ttttggctta tatgtacgtc
   190321 tctgttgaca tattttatta caacgttcgg ctggaacgat gagtaaaagg caggtgaaaa
   190381 gaagcgctcg aggcaggtgg tagcagtaca tcttaggaga ccgcggcatt ttggcataga
   190441 cgtcgcaatc ttctgtgaga gtactaacgt ggccatccta aatatattca aaacaagaag
   190501 taaacacagg ataagcgtag ctacatttgc attgacgtgc ggtgcttcgt tgggcactgc
   190561 gtagaaccac acgcaactga cgaataattg aacgttaaga tgaatttgca atcgtatacg
   190621 tcaatgcaat gtgtttgttt ccatgactta caagttctgc aaaaacaccc cggctaatcc
   190681 tcttttgatg acaaaggtcg gtacggtata cgtggctcca tgaagcactt ccagtagcac
   190741 tccccaattg cacaacctat ggccatcaca acaagtaaga tggccgttcc caacatgata
   190801 tccatgcacc ataaccatgc aatggtcgca tatcttcctt catacaccag cctctggaaa
   190861 tccccattga ataagaaatc ccaggaggct atcgtttcgg ggtaacacgg aatggcacac
   190921 gtgcactctc gacattctct caaaaggata cgacccaggt ctgccggcgc aggtgtccgt
   190981 gttgtaagac agatggtgtc attactggaa aatgtagtat tcggcatagg caggcatcgt
   191041 ttgcgttgag aattttcccg gctctcgtag tacgggaaaa cagtggtttc attcggaagc
   191101 gctttcccca tcatacacca ggtaactttc aatatccctc ccatgattgt gcaggtagca
   191161 ttggcctctt cgatatccga ctcatctgcc gttgccctat gctgaatcca aaagtaggcg
   191221 agcaagaaca caacgagcaa gcgcatattg aaaaaaaagg gttattgctc gctttgctct
   191281 tgagtggctg aacgtgtgag ataaatggta ctttgtgtct acttatatgc cctgtgagaa
   191341 tattcccacc cagtttcatt tgtatcacgc gcagccattc tcccaaataa tgacataata
   191401 ctttaattat aattaaacag agtatatatt ttatttcaca caacagtttt ttaatcaggc
   191461 tgagcacgac gactcggttt cgtaactctc agaactctga gaactctggt cgtcggcgta
   191521 tgggcaggga tatcgtggga aagaccaggc agctccgttc agcttgtcgt aggtgtagaa
   191581 catccatctg gtggccagcc atcggtagca ctcggtgctg ttgggtctgt ccatagcatc
   191641 aagctcatca tagaaacgaa gcttcatttt caggtaccac cgatcaagct cgcgttcata
   191701 ctgagccttt tccgcggcac tgaggttctg gtacgctcta atggaattaa tggcatcttc
   191761 catatggaaa gtttcggcga caatgacgat agggagcacg gccaacaggc caagcacaat
   191821 cagcctcatc gtttcaacga tagatcagca gtcccgctgt ctagttagct gtgtatgcct
   191881 gtgacagctc cgtcaatcac tctcttctga agcaaatgtt tgccagggca gtttaaactg
   191941 gcgtgtcgaa gtgccaactt ggcacggctt atatgtatcc tagatggata cgtcaatcaa
   192001 agtccctacg taaaacatgt ccaacctgcg ttttacctga cgcacatacc attgcttcat
   192061 gtcccggtgt tatgacacgg ggatccgcct ttctcacggg taacagtccg gttcctcatt
   192121 cccaaatgcc gtaaaaccag taggatcgcc cggtcaggct ccagtgcatc tgaataagca
   192181 tgcaaagcat aaaactccat cgaataaaca tcaaaaacag tccccagtag gcatgcagat
   192241 gtcgaccttc aaacatgagc cgatccagtt gatcgataga agcccaaaag ggaaaccagg
   192301 agatcctcag cttaggctca catgtaatga catgtgcatt acagtatgca caaggatgga
   192361 cgtacaggtt tatagccgat acatgttttg taagttgaat gtttttcaaa atgtatcgtt
   192421 gttcatattc tgtagacaca tttgtaggct caggcaatct ttctgaagaa aactttgtga
   192481 ttacgtcggc actaagatac aaatcaggag cggtagcatt gccagagtat gtccacatcg
   192541 catccagata attatcatta ataagatgac attggcttcg agggttttcc aagtggtagt
   192601 tcggaactac tttcgttgca ggcaatgacg gcaaagacaa attcatcaaa aaatcagaca
   192661 ttttgccgtc aattcccata ctgttaggat ctatcacctc aaacatcggc gggtgaggcg
   192721 gtggcgacac actcagaatt agtgtgtcga tccatgccac atacattatg aaccccgata
   192781 acacgaacaa gttgagcagt ttcatggttg cgatagcttg gtcctggtgc tgttgccgca
   192841 aacagcacca ggacggatca ttcttatgta gtaatttggt gacgtgacaa tgaccgggtt
   192901 ggtgcctgca cgcctccttg tcatagatcc aaaaaatgtg tacttttgaa aatcgcgcca
   192961 tttccaacgg tcgtaacggt cgacggtacg gtgtgtatcg taaatgaccg gctgtatgac
   193021 cttgaacgac cttgagtgat tgattgtaac ctgtcattta tgatttatgg gattcatgtg
   193081 aagagcttta cggagacgca aggaaaaaaa cacacaccaa cactgagggc ttatgattaa
   193141 tagcttattt cactgttttt attaggagca ctcagacaac aggttgttca gggaaagtgg
   193201 acgaaaagta ctcgggatac catttgtcag cagtgagagg cacaatagcc atcatcagca
   193261 ccaacacctg gtccacgtag agcaggagcg cggcccgaat agcgtgacgg tcaaacaacg
   193321 accgagggtt ataacacagc accatcaaga tgtcgtggag cagagccagt gtaatcaggt
   193381 ccacaatgac agcagtgagc accgctatcc atttctgagc gggcgtccat gactggtagt
   193441 acacaatcgc gcaaaaaagt ggcagggcga caatcaggca ggcaacgaca agccgtccgc
   193501 gtgggcgggt ggaggccaga acacaggcaa acacagtaca gctgagttcc agcaccagtg
   193561 aaaacacata ggcctgccac atgacggtgc gttccaaaca catgctccaa atcaccaacg
   193621 cccatgtgtt caaagcggtg tagacaacag cggcgggcca tacggtgagg cggtaggttg
   193681 tctttctgcg aaggttgaaa cgcaggacag tgggaacgat catcatccag ataggcagtg
   193741 tgtctttcag gtaaggtgtc tggattcgcc aggaactcat gatgcacaaa aggcatagac
   193801 ccatggtgat ggccagctgg atggccatag ccgtgtacac tctgaccagc cacacgaaac
   193861 gccgcatcca tcgcatgact tcttcaacat cgtcgtcgtc ctgatgacga gcggttgtct
   193921 gatagcccat gctccccgag cttctgaggc acatcgcatg tgcgagccgg gtcttataga
   193981 ctagcttcag tttttacatc tttttagtgt tctaggtttt aacctgggca ttattccagc
   194041 taaaagaact gaaaacgcga ttgaaaggta catgccagat attggggatg agcatgagaa
   194101 acgtgacctg gaataacgca tagtaggaca catacaaagt cagtgacccc tgtattatct
   194161 gcttctccca caagtgtttg cggtgtcgtt gcgtcatcca gaaaaacagt atcatgaaaa
   194221 gatccagaaa cacagtgtaa gtgctcaaca tgatgtgtgt gaccgtggtc gggttggagg
   194281 ccgcgatcgc aagcaatgcc actaagctgg aggcccctaa ggttagaatc atagcgtagc
   194341 gacgaacggg tcgatcgtat ctgttctcat caaagttgtc aaaaaacgcg gcagtggtcg
   194401 tcagtgtgaa aagtgccacg gagatgacgt gagcggccaa ggctttagag acttcgccgc
   194461 agaacccgaa gacagtgata ctgagcgtaa cccagacgac atagacggtc atggtaaaca
   194521 ggtcgctggg ttgtctttcc catcggatga ttaagcaggc cagacagatg accggtagca
   194581 gtatggccag aatgggagcc gggtcgtttt gacacgtgtt atgccactga gggtagctga
   194641 accagatgta gagagtgaaa acagcagtga cagtgaactc gaagatgaaa tagctataca
   194701 cctgcacgag gatcttaaac cgctgtatcc aggcggtgct ttcgttaaac cgaacttgga
   194761 atcgaaagga ttccatgatc ctcagatctg aagtcgtcta tcccccacag gtacatgaga
   194821 gttcagagaa taagatggac agacagtctg aagcgatgtt aaacagataa tagtctgatt
   194881 ttcgtgaatc atccataaac agaagagggc gagcaaaatg tcctgttgaa actgccattc
   194941 caaagttggc tcacacccgt taacattttg tgaggatcta gagtccacag gctcggtgtc
   195001 agaagataca cgtacatata gtacatgaca ataagtatgt ccacatacac tatgcaggcg
   195061 gagaccacgt gtttcatggt tagattgaac tttgtgatat agatgttttc ccagatgatg
   195121 attcccatgc tgccgtgtag aatgatcgac agcccattcc gcatgaccga gtgacttagc
   195181 tgtccaaagt aaaacaggag taacagaaaa gtgctcacga gggtcgcaat gtagcgacat
   195241 tttgagggta atggtcgaga agaccataga gctaagccgc tgcaagttag gaaaaaggtt
   195301 gtcgtaaaca gcagactcag accagctgtg attccatcgg tgcaaaagct gatgagagtg
   195361 gatcctatac aggcaaatac aacgatgtac aacaatccat tgcccatatg aatcatatcg
   195421 tcttgtcgat ggtcaaacat attccacaca aacatcagca gcacgggaac gataatcagg
   195481 ataaacgccg gctcgactcc gcaaatttcg gtattaaaaa ccatgcagtg gaattgcgat
   195541 ttgaaggctc cgtaggaaca gatacagacg gctatcacga aaagcaagca caggtagacg
   195601 ctggcgagtg gaaggtgttg ccgcagccag ctaagcgatg atcgctcgtc tagatcgagc
   195661 tggatcatag gggcgggtgg ccgatggacc gtgaagggtt gcaagcgagg tgcgaaaggc
   195721 atgctgacag tgctgtgacc ttgacagtct tatcgcaacc aggtgtttcg aaacgtctcg
   195781 cagagaattt aaagagtatg gtgtggcatg catagtgtct ggcgaagcaa acgtcataaa
   195841 ggtacgcgtg gatcacgatt tcggaacgtg agccgagagc gtagatgaac ggaaaacgct
   195901 aaacatgttg tgaacgttgg cggaccagat gtccttagtc caacagaaaa tggaaacctg
   195961 ataaagcacg atgaacaggg tgtacagctg cagagagctg cttttaattc gttcgggtcg
   196021 cctgtgaacg agatagaact gggtagggat gaggagaaca aaacctagac tgaagattgc
   196081 ataaccggca gcgcgcaaga tgacactgag atttttcgaa agcagtgcga tgagggaaaa
   196141 agcaaccgcg aaagaagtta tgaaacatcc agctagaggt ctgatccagt ggagacagat
   196201 acccgggatt ccgtaggtac aaaataacaa cagactcaga acaaaagttt gccaaatggt
   196261 atggtcgttt gtacagagat gaaacacact ggtagacaaa caagttaaag taacactgta
   196321 gatccaggag ctggtttgat cgacagattc ttctaaaagg tgagacacca tgaacaaaac
   196381 cacggggatc aagaacaaga cggaaggagc aggatctacg cgacaattgg tggcgttgtt
   196441 atacaacatg gggaacgtga agcgcgcgag gccatacacg aggacggtgg caacgagggc
   196501 caaggtgaag cagccgtaga ttttgaagat acaggtcgtc cgctgtaacc aagatatact
   196561 ggctacactc gagcgctcca tgtccacact gctcctcgtc ctcggagtgg tagataagag
   196621 agtcagcttc gcgagttacc cgtgtttact tatacgcctc tactgccgca tccttacggc
   196681 gtaacatgcg ctgtgttagc tgagtattgc ttgaagtaag ctatgagtga gctgaacatg
   196741 ccgtcccatc gagcagacca gagacccgga gtgaggagca ttacattagc ctcgtacagt
   196801 agcacccaat tgacataaag catgatagaa ggccacctga tttcatctac ggggtgttta
   196861 tgtcgaatgg ctacggtttc catgtaaacg tctatggagg tcaacactaa aaacaagaaa
   196921 tacatagtaa taaaaagcat atgggagggt gctaaatgtc caaaggaata aatgaggctc
   196981 atggtgaata aaacggtcat gctaaacagc atggctagca ttttgcgccg atacatctgc
   197041 atgttgtcaa acacggccgc ggcgctctgc aggatgaaca taagtgcggt cagcaagaaa
   197101 ctctgaaaca ccgtccagtc gtcggtacag gtgctaacca acaggcatga cactgtcatg
   197161 taatagagtt cccagaataa accatctata gtgtgggcga tgcgctttgg ggtattttct
   197221 acgataagta tggcggccgg aatgcacatc atgagtagag gcgcggggtc cttcacacag
   197281 tctacagtta ggtagggcct ggctgttcgg tagacgccgt acatggcaac tgtcacggcc
   197341 acttccattc ccagccaggc atatacctgg aaaatcatgg taaagcgcct cagccagtgc
   197401 atgttgaggt gccatcggta ctcgctttcc atggtgttcg tgttgagaca ggataggaaa
   197461 tgatggtaat aaatgagcag atacacagtg tttatatatc aagcgttcgt ttaatgaaca
   197521 tcaaaggagg cgtgacctca taaccatggg tcctccgcct tccagggaaa cgaccacata
   197581 atcacattgt tatagtgtac caggtgaaaa atacagtaca gaagaagtga aatactcatg
   197641 gcccgttcat tagagcgctg ctgttgccgc acattactaa gctgtagaca catggcgttc
   197701 ataaatccca cagtcccgac gatgtacaac gtttgtgcta tccaccaaag cgtgactgaa
   197761 ggccgcgtca cgctatgtac aaaacaatta gccgccaacg cgccggcaca tagcatgtca
   197821 gaaagcactt gccgcttgat gaggggtttc cagttgctcc catcgctcac ataaatcatc
   197881 aggataaaca gacaaaaggt agctatccag ctctgaatga cggtccaggt ggcgacgcat
   197941 ccgctgaacc atacgtggga aaaggctatg tgtatgacgc agaataaagc aactccgcaa
   198001 ttcttccaaa gagagccttt tcgtatgacg cggttgatgt aggattcttg aatgaagacg
   198061 agcgcgggac tcgtcatcat aatctgtcgt acgggctcct gtgcacaagt gtcgaatagg
   198121 tactgctggc atcgtaccaa tccgtacacg aggacggtga tagagacttg aaaagctaac
   198181 caaccataaa ctgaccacac gtggatgcag cgattcagcc agatcacatg gttggttagt
   198241 ttagtcatca ttttcgaagc catgggtggt ggcggaggaa tcgactgttg gacgggtttc
   198301 gttctgggtg ctggatggag aaaagtgttg catccagctc gtgagcctct ctagggagct
   198361 ctcagtagtg agaatgagaa gaactagcag atagcaatag attaagtcct cgtagagaca
   198421 gagaccaagg acacatgtct cctggctaga agagacttta gacagctgag aagtatcgaa
   198481 aaccgtcacc cccaacataa aagccaacac aatcacgtag taaccgagta gaattttatt
   198541 tggtagagac aacggttgca aggacagcgc aaccaaggta atggtgagaa tgagaaaaaa
   198601 gataagaccg agagtgcgcc aacggcgata atgcaggtct ccaagacaag ctagccccgt
   198661 gcaggtgaca aataagattc ccgccaacag cccggaccag gtaaccagtg taatgtcaac
   198721 acacaagtta gccaacacca cagccgtagc cgtaactagc gtgtaaatcg ttaacacggt
   198781 ccagctgttt gagtgctgct tcttggcgtg aaggatagta agacaggcgt tgggaataag
   198841 caggctcagg gctggcagaa atccagtttg gcaaatgctc tcgggaatct tcacataagg
   198901 cgcagccaaa atcatgagcc caccgatcac aaatgtacag gatacttgca gagagacagt
   198961 acgatacaaa tgaagactaa aaaaacaaca gcggtgagac agcttcagag actggttttg
   199021 tattcgagtc tttttgataa gtcgcatgac ttgatggcct gtcatggtga tgatggctaa
   199081 gacttgtatt ggcaagtgag gatacaaaag gcgaatatat ggaagttact tttatatata
   199141 caatgttctg aattttttcc tctggcccat tcaaggactg ttctgtagta ggaaccaagc
   199201 ccaagaaggt tcggtgtgat tcatctgttg aatcatgttt cccatccatt gattgacaga
   199261 gaacatcatg ctgatgatgt tgaagagcgc gatgatagcc gtatacacag ccaggctgcg
   199321 agcaagttca gcggcctcgg tgagaatcag ttcagacgat gtgggataga taatcagcaa
   199381 caactggtgc accagaaggt aggctacagc actgatcaga cacatgtaca tgacggtgaa
   199441 gatcttgtag atgatggccg ctttggcaaa ggttaaaaag aaaacaaaac acaacatgca
   199501 ccatccgtag atcacgaaaa acattctcca gcgcacggca ttacggccgg cataaaacac
   199561 aatggaattg cagagcacga ttaccactgc agtcagagac aaacccaaac cgagattttg
   199621 acgcgggcag caaaaacctg tcataacgca cgtgcccgtc tcaatcagta tgcacatgaa
   199681 cgtggctgag cccgagcgat tgatgagttc tttttggtag caacatgcca acccgaggca
   199741 aagaataggg atcagcatgg cgcccgtggg cactgcacag agcaggcata gttctgtcac
   199801 gctgggaaag ctgaaccaaa acagcgcaca cacgcttaac gtggcggtca cttcaaacaa
   199861 agtattgctg tacaccgaca cgacgctgcg aaacttgtct atccattcca ataagttctg
   199921 gtgcatccag ctttcggcca attcgctatc caaaggctcc tggaggctca tgttgcgaag
   199981 ttcttgtttg tggctttctg ctcttcaaac cccgaggtgt cgagcgctct aaataaaacc
   200041 tcggcaaaca gtctatctta tgtgaacgcc gggcttcgga gttgacgtca ttaattgaga
   200101 ttaacctccg cggcccacca ccgtcccagg ctgaaatcca agtcaaaggg agatgatgta
   200161 gtgttacgcc aaaaatcagg atcgatgata agaaggccga taatatacat gatgagggtt
   200221 tctatgtaga tgcgaatggt gagaaccaaa gtcgcatctt cgaagagctc ctgcttgcca
   200281 ataatcgtca tatcgtgtat cgacaatccg atgacgaacg ttaggagaag cgcgatatag
   200341 ccgccgaccc aaagagtgtc cgaagcagga agcgcgatta atgccagcac catgaatgta
   200401 ctgttcatta gcatgacggg gaaaaaccat cgatgaagac ggttaacccc cattcgtaaa
   200461 cgggtaaaac aaatgagccc caagttgaac atcataataa ttaacggaag cagactggcc
   200521 atgaaaatgg tttgaaaaga acggcaagtg gccatcataa tgagagccgt ggcgttcgga
   200581 aacatgtata tcacaatgaa taccagctga tgcatacaac gacactgtcc ccaaacatgt
   200641 aatatgaaaa gagataacat gggaacaaaa agagaaagta tagagtagcg aggtataatg
   200701 ttacagaact cacgaaagga actcggagaa actatccaaa tgaccagact aacgataaca
   200761 gtagaagcca gttgtaatac aatagccacg caaacttgca tccagaacat aattcgcctc
   200821 ccgagaaggc gtaactcgtc ctccatgtcg gtttcgttat tgaataccgc acccatgaat
   200881 ggattgtttc tttattaagt ttacacaaga agctagcgac tttttgtagc tggggattaa
   200941 gtgagagtgc tatttttggc gtgctccacc cacttaggca tggatatcat aaagatgatc
   201001 accaggaaga tggctatggt atctacatac aagcggatac ccccccggat acagtacatg
   201061 aacgaggatt ggtaaatcac aacatatgtg tcgtatgcca agatgaaggc aaagaaactg
   201121 atggaaaaag ctgagatgga attggtgagc ttcgtgtgcc acggcgcgga ctgaaaggcc
   201181 gtagatgtca gaaacagggc caagacgatg atgtacatgc cgatgatcca tttccagcga
   201241 ccgtaattca atcccgcaat gaacgtgagt ccggtgaaag cgatgaaagt agccacgctc
   201301 atgatgtagg cggtgacgat aacatagccc tccgaacata tgttgaacaa aatggtgggc
   201361 accaggttca cacagatgta gaagaaaagc acggtcagat tactggggtg acgcgcgccc
   201421 agaaggtagc tggtaaccat gcaagtcagc ggcaccaaca aagtcaacac ggtgctgtgg
   201481 ttgttaacgc acaggttctg gttttgcgga tagcctagcc aaattaagct ggcaatcgcg
   201541 aaagtgcagg tcaaggcaaa ggtgtaaacg ccgtagacac gcagccacac gacgaagttc
   201601 ttaaaccaca caacggcttc ttcaggcgtt accatcaagg gggaactgtc ggaaggagcg
   201661 ctttccatgg tgttctcggc gttatcctgc tcaaccattt cgcttgttga caaagacaac
   201721 gtctagccgc tacttgctag gcgatctaac tcttatacac aacgcgtgag acttcctggg
   201781 agttgggcgt ggacacgaag tagagcaaag taacaaacag atacatcaaa tccatgtaaa
   201841 gacaaagcgc agctggaatg taactctcgt attcgatgcg atgtagagtg tcttgtgtgt
   201901 cacagatcac tgaagcgaca ataaccgcca ggccgccaaa cattaccacc atctcaccga
   201961 cctcgtcagg aaaatagtag aagatggatg cgagaatgat gatcagggca ctggacgccg
   202021 tgatcagtgg gcgataaaac tcaatatcgc gagcgaagcg atatgtcgca atgctcaaaa
   202081 cgataaacag taacacggta ctcagcatag catagacggc ggatcggttt ccgaattgaa
   202141 agccagaggt ggtaacggcc acggccgtga gtaatgtata aatgagtgac acgaagaggt
   202201 ttttaggaaa ttggggctca gcccaattca aaatgcccag acagatgact gacagcatca
   202261 ggcagaacag catcatgcgc atattgcaca caacgtgttc gaggcggtcg ggaagcacca
   202321 gccaacagag agcacagatg ctcagaaata gaaggctttg aaaccataat aaaatgtaca
   202381 ctcgtaacag aaacacagat cgaacgatcc ggacctcgtc cgacaattgc atgttgttga
   202441 ctcagctttc acacaagtga tatgtgcgtc taaatatgta atgtgtttcc cccaccacat
   202501 aaagaaatga cacgaaacac cggaattaga gaattgaata caaatgcatt tttttaatca
   202561 aagcagtgaa tattagcatt caagggatca tagatgctaa ccctttcaag ggaacagtgc
   202621 caccttttca tatatttagc tcttcgtgca cgtcgtagta acagttgtct ttcattggta
   202681 atcggctcgt cgttttgcca ttccttttgg attatggcca taatgtctgg gggtggtggc
   202741 tcatgggtat ctgaggacag agatgactca ctctcatcat cataagaatc aacactgccg
   202801 tttgtttctt gtgaaacaat gacaacgggc tgatgttgag gagcttcttc tgactggtta
   202861 tcatcatctt cttcctcctc ttctgagtca tcgctttcac cctcgaactt tacggttctg
   202921 ggagagaaac ctctgtctac acgaaacatc acagtaccat cagacgcttt ctccgttaac
   202981 tcatcgtttt cttgccacgc accactttgg ggcccttgta gaaccgtaac actgctccac
   203041 ggaaagcacc aattctgatt ctcttgcaat actccggtag gcattaaatc actacgtccc
   203101 caacaacaac tagtaggtat tttatcatga gcgcgattgc tgcgcgtgag ccagtcgtac
   203161 gcaccacaga gctgctcggc ggtaactgta ttgaccatag agcaccaaga cagatcttgt
   203221 ttacgggcac cgtgattgca gtagcactca ctctccagac gagcctcgcc acgcagtccg
   203281 cggtcaaatc gcgtaatgcc acggagcttc agaaagccgc atctgaacaa catctggatg
   203341 ttatcggcta ggcgaaacac gtcgctttcg tcgattctca gcacataaca cacaccgcac
   203401 tcgtccagca gaattattcc acaggtcagc aaaattccaa aattagcata acggccagtg
   203461 acgccaagta cgtaccatcg gcagcacatg cgttgattaa tatactttat gagattgtta
   203521 aagttatcct ctctcatctt agcaaaagga tacatttgac gtagcttctc cacagtaccc
   203581 agaaggagca agggatcggc ctccgatcgc ccaggggttt tcactaccac gttaacgcca
   203641 tgaaactctt ctgcggtctt ggctagacca cgtgcgtctg tgggatcgag acacaacaat
   203701 ttctcgactt gaaagcgagg ctcggtggtg gagaagggcg tttgcggatg gcgatatacc
   203761 gattcacatg tcagtaaacc atgatgtgcg agttctttga gtgaggtacc tatctgaaag
   203821 agtccgtcac tgtcccagtc atacacgtac acaaatccat agcttcccag cagaaccaca
   203881 cacgtagtct cctggatttt tttgcgatca ctgccatcac gcaactgtac ccccaatatt
   203941 cccagtgctt ccaatttctc tttgcagcaa aggtactcgt cgaacgaacg gctttctacc
   204001 tgggggatat ctataccaga gcgaaggacg agaaaccagc tacaggggtt gcgtaacgga
   204061 atgatagtac cagaattctt tttaatatat tctcgtaaac atggttgatc gtattgtcgt
   204121 agataaacac cctgtaacat agtcagacaa cgctggaaca cgaggttacg caaactaaag
   204181 acgccatagt cgcagcgtat cacgtcctcg ggacgctcat ctcgctgctt cagatatgta
   204241 ccccaggctt cagcggcact tctggaaagc agtgtcatgt ctactttcga aaagagtcac
   204301 aaagtgttca gcgacaaact caatcggaca gtttagatcg atatgaatga atgagtctcg
   204361 atcagagctt aatatacaag cgcctcaggg ctgtccggat gactgacaga tgacgtgaac
   204421 gcgccgaaca attcctttat tggaagaatg cccgcagatc aaaactgcta atccagtcag
   204481 gcgatagatc acgattcaga tgcactctac gggcttccac ctcgggttct gacacatcaa
   204541 cctcggtgtg ataagcgtcc atcaactttt gaccgagacg ccagcggtcc gcctgagcgg
   204601 cttgtctttc agcgtgccac gcgtcaatat ctttcagatc gtacatgctg tcttcatcga
   204661 ggtcaaagcc aagatcctcc cagtcgtcat cttcctcttc gtcttcttcc atctgaaaac
   204721 cctcgttctc acgacctatg acctcaatat cgtcctcgtg cacgtcgtca aagtcgtcct
   204781 gcattcgagg gatgggtgga ggcggaggcg cttgaagcgc gggagccggc agcgcgggca
   204841 cctgaaacgc gggcgcctcg ggcggttgtg gcgcgggcac ttcttgttgt gcaacagcag
   204901 cagcagcagc cgccgcctcc tccgctggca cttgttgttc atgctgttgc tgaggcggag
   204961 gcgacggctg tggctgctgt tgaggcgggg agggtggtgg cggcggaggc ggtggtggag
   205021 gcagatcatc aggattgaag agagcccggc gacggcgagg aggagcacct tcgtcacgat
   205081 tctcatgtgg acgacggcga tccacaaagt caccgcgaag tacacgtgtg tgccagatag
   205141 tgaacgcatc ccagccgtcc cacgtagtaa tcatgtctgc ccgaaaacgg tccgggcgac
   205201 acaaccagcg atactgacga acgaaatccc gggagacccc atgatcgaaa gcggtaaagt
   205261 gtagacgata ggtttcatcc aggtgaatgc aacgcacccc gcgttccaag cgtgctatag
   205321 tgcgaagatg gtgctcgtgc cggcgccgca catacaattt catcaaacct cctttgaaaa
   205381 actccgaaag ggtgtcagcc actcgataca cgttccccgg ggccagacat acatgggatg
   205441 tgcgatctgt gtacggtcga acgatgaccg tgtagatgcg accgaatcgg tcgaaaataa
   205501 ctatactgct gacctcaaaa aatcctccca gacgataggt gcccacagca cccataatgt
   205561 accagcgaca gcgtagtctc agactcaggt acatttgaca ttctgccaag tggtagggat
   205621 cgatggcctc gaaaggccac aaatcactca gacaaccgaa attggccagt agctttagtg
   205681 tatcggcgtg acgcccggga gtgtgaagat tgacatctcg attatggtac gcgcccacac
   205741 actgcgctag ggaatcggcg tcatgagcct gagttaacat ggcagaaaca acatcatgag
   205801 gcacacgggt agcatagggc gtgtaaaact gcctgtaaac acattcggcg tgcaaaagcc
   205861 cgaagcgcgc caactcgtcc atgtgctcag ccgccaggat caaaatatcc tggctgggtt
   205921 cataaatgta catctttgtg tccgatgcca tgcacatgat aagctcggtt tccacaaaac
   205981 gatcctgcac ccacatgata catttgccga tcactgccat tcgctcgcga caacaggtaa
   206041 tgtcgtccag caactgatca cgtagttcag gcatgtggct gcccggcctc acatgtacaa
   206101 accagttaca aggtatgccg aggcacaaca catgatcgat gcgctcacgt acccaaacgc
   206161 gaaccgagtc aatgttcgcc tgtctgagaa acaggtcctt gaaatcagcc attacgcgaa
   206221 gatacgtatc gtatctagcg tgacagtaag ggaaatcgtc cgggcgagtg aagctcggag
   206281 ctccatcttc ccaccgggta cgccacatga tgataacggt ccggcgtttg ttcagattgg
   206341 gacaaattct ctagatcctg tcaagctctt aaaagggaaa ggatctgtgt acgtcacaag
   206401 ccgtgactga tacaccagag cagccagaac gcgttcggtc gttctttccc gcgtagatga
   206461 tttcgtagtc accagacaat ggagtctagg accggtatct tcctgatggc tcgccgcttc
   206521 gcgctctgcc gcttccactc cgacaatgtc cgattcgagc acgtatgtct gctgaaccgt
   206581 atcgtagcgg tgtagaacca gaacattagg gtctagtctc tcccaagccc cctggcgagg
   206641 gtcaaaacgc tccgttaaac agagccagtc gtaatgctgc tgtacgaagc gctgacgacg
   206701 ctcttcgcgc tcgaagggag ctagaagttc gtgccgacga tccatttcac gctcctcaac
   206761 gtgagggcag atgcactgat gttccatgcg aatctttcgc tggcgctcag gctcgaaacg
   206821 gcggtaagcg aacactagtt tcaaaagccc catgcgaaaa aattcagtga gggtgttggc
   206881 tacacgccgc agattgtggt taggctcatc cagctggatg gcgtacaccg ctccgaacca
   206941 atccaacacc accatgacct cggccacgaa cgagcgccca agacgtggac gtcctgtcac
   207001 tcccaggaga taccagggag tagccagatt agctctaatc ccccaccacc atcgtttagc
   207061 ttcagtttcc gtcaagctgc taaagggcca aacggtgcgc agctccgtaa cggtcttcat
   207121 gagccgcata atcaccgtcc cgtaaccggg agtgtgaagt ttgacatcat gatcaaggat
   207181 tcgatctgcc gtcacgtaaa aactgtccgg agtagtttca ttgagaaaca aaatgtgcat
   207241 agtgcgtatg gaacgcggac cggaacgaat gagggtcgga gacaagcgac ggagctggtt
   207301 gtgaacgctg tcacgataaa taaactccga tcgcaacaca ccatacttgg ctagctcttc
   207361 caagtgatgg gctaccagaa ccatgtagtt ttcacgaggg tcgaaagcgt agatgcggca
   207421 gaaacgaccc atacaaataa cgaaatcagt ttgcagatag tctcgctcgt gatccctatg
   207481 cggttcaggt atgagtttga gggcgtaacc caacgcacac agcggttcgt tacagcagat
   207541 cagtttgcgg gctgcatgtt gagcttgtac gagctgctgg tcgcgttgca gttccacata
   207601 ccacccctga ggaggtccca ggcaaagacg gcgaccccgg tatctccaca cgtaatgctc
   207661 gatctggggc gcatccaaac aaaagaacag gtccctaaaa tcaatcaaca cctgccgata
   207721 aaactgcaat tcatccaccg ggcgatctga aaactcagcc atggtgacac aacgatgata
   207781 actcacctcg gtctgttaac cgatctagcg tttggaccga taatttaaaa tctcggtccg
   207841 agctgccgag cggttcaccg accaggcttg agactctcgc cactctcgcg tgcggtccaa
   207901 gaccatgatg gttcactcgt ccagcctcgt ggatatatag cgacgctaaa ggcaatcact
   207961 ctttcctcag aaccaatgag accaaaacgc attcacagtc aacagaaaca ttacaaactt
   208021 tttttttatt gaagcacaca aagattcgtt tttattccga acgcaaacat atacacatcc
   208081 aaactggttt tatgttttat ttacaaaaaa gtatcatttg tttattacag ccaaggcggc
   208141 aaatacgaac ccggtcgggg tacggctgga cgagggtatg ggcatccttc caagatggca
   208201 gccttagccg ctctgttaat caacacttga gtataataat cgcaggtgac atcttcaccg
   208261 ccatcttcgt cccctccctc ttcgctacta ctgtctgtag gcggacgggc atctgtttcc
   208321 acagatctgg aaggtgatga aagacatgcg gcctgtacgc gcgctcctcc cccatcaatc
   208381 tctaacagat catcgtcatc agattctggt acctgaggct ttttgtacag catagcgggt
   208441 ttggcatcat ttggcgcaga tgcagattca ggttcagagg catgtccttc ggcagacata
   208501 ctttgtctga ggtttacaat agctcgttct aataccgggt tcatttgatt ccatatggaa
   208561 taacaccgaa caccctgttt cacttcttta gaatgtacat aatctgagag acggcgccaa
   208621 aagttgtgag cggcctccac ctcggtggct tggggaaagt cgcagcgcac atgaggctcc
   208681 cagctaccgt cggccgctcc ggacacctcg tgatgactgt tacgagagta acagccacca
   208741 gggttgaggc ggcaaaaacg gtcacgccga acaagccact gaaatcgtgt ctcctgatgc
   208801 ttatgtccca ttcccctatc catgtacaga tagcggtccc aaaactgata ggttcgatga
   208861 ggacaatgcg gaggcatctc cagcctctcg gcatcggaga gagccaagct gaaacgccgg
   208921 ccggcctgat agattttcaa caaccccatg gtaagaaggg agtcgatgtc atcggccaga
   208981 cgccacacgt cgcgccgata cacatcgaaa tagaacagct cgccgaacgc gtccatgaga
   209041 atcacccatt cagcatgaaa aactcccgag ggcaaaacct cacccaccac gccaaagatc
   209101 aaaaccccac agcaaagacg gtctttaaaa aactgcataa gcttctcgaa catcaagttg
   209161 tccatacaca aaaaaggcca acatgatttc aagtcgtcgg cttccgcaca gattaacata
   209221 ggacgagtca tctctcctgg ggtacgcagc ggtatgcatt gaccgcgata acgcgccatg
   209281 gcacgctgta gctgacataa agaataatcg ttcattcgca gatgggaaat cacgtcatca
   209341 ggctgggtgg tcaacatggg catacgaaac ttgcccgagt agatgctctc acagtgaagc
   209401 agtccatgac gcgcgaaatc atccaagcca ctggccaaaa agtagagcac attctggtct
   209461 cggtccaaaa cccaaaggct ttcatagcgc cccatcagca ctacacgctt gctcttgctg
   209521 ggcggtagaa ggtcatccac atacagacag ctgtcatcac agtattcgtc ctcggagtcc
   209581 tcgtccgacg aatcgccatc atcttcattg cggcggcccg gccagtactg cagaacgccc
   209641 aacacttcca aaggctcttc gcaacaaatt aatttactcc agggagagcc aggtccctgg
   209701 cacggcgtgt cttccccaaa aacactggga aaagtggcaa acaccatccg ccaaccaggt
   209761 ggcgcagaaa taggcacact cacacggcat tctgctttca atgataccag aatgcgcaga
   209821 gaactttgag actcctgatg actaaacaaa tctttcaatg cccccagtgt ccgcctaacg
   209881 gcgggccctg aggcgtaacg ataggattgg cgtaacatcc tgatgtgccc gggcacatca
   209941 acccttcacg ggctttatta cccttcatgt catgacgtcg tacctgtgtg ccagactgac
   210001 ggcttattag ttatggtcgc tatcctgcga aacccgctca gttgctcgca agccacccgc
   210061 cagaacgtcg gaaaaacctc gcccgcaaca tgaattcgag ccagcacaac ataagcgtgt
   210121 ttctctccat tggagcaggg cccgtcatta ccggatacac gtgcgttttt ctgttcggga
   210181 ttctgggaca cttttacttg tattggaaaa accatcagag acgacaccgg acaaacagtt
   210241 tcagtgatgt tttatttcga catctcatga tcaccgaaga ggtctttacc ctcaccgttc
   210301 ccgtctgggc gtatcactta actactcacg gcaacttacc gggctcgtgg tgccgaagtc
   210361 tcacctttgt tttttatcta acggtattcg ctcgtgcctt cttttacctg ctcctcatct
   210421 gggaccgata cagcgtaatc atctgtagac accctctccc tgttaacctg aactacagtc
   210481 aggtcatagg cctgtctgtc tggctggttg ccgtactgtc agcatcaccg ttctccattt
   210541 ttaacggaag tgtgaaacaa tgcctgggca acatgggcag catacccagc gaatcgtctg
   210601 ccgttctcaa cctggaagtg cacctgtgct ccttctggtt accgctcatc atgtcggcta
   210661 actgttacta ccaagcaaaa cgccgagcat cgcctgacca actccacgaa ctttaccgat
   210721 gcagtttgct gattaccatt atcacaactt acgctatcgt atggtttcct ttccatctcg
   210781 ctttactcat agacgccctg attagcataa gccatgtaga accctctagc gctctccact
   210841 gggcatcaat cgtagttacc tgtaaatcat ttacatttgt atatgcgggc ataagcccac
   210901 tagtgtattt cacatgctgt cccaccgtac gtcgcgaact gctgatgtcc ctgcgtccat
   210961 tcttcacctg gatttctggc aaaacgcggc gaggttacgt tccgattaag acacaacctt
   211021 taaacatccc cgacgagccg atggataaca agttaccgca cctgttgaac gaataaaaaa
   211081 taaataataa aacatactca gcactctgtc ttagtcgcgt atacatttct cacttagaca
   211141 tcggtaaaaa cgcttactca aacattatat aaagtgaccg cgccactttt tccagtgacg
   211201 tggttacatt tggcaatgcc acgctgttat attccacatc ccaaagcttg tgttaggcat
   211261 cacacaaccc aactgattgt tatctagtta acgaaatccg cggaactagg taagtgcaaa
   211321 taacccaaca gcttctcaac aaaacaggag ggttaattaa ataacgtaac gtcgattact
   211381 tatccgctga tacatgtttt aacagccgtc atgaccaaca ctaacaatac gacttgtcat
   211441 ctcaacggaa ctctcgaaac ttttaaaatc acccgtccag tagccatcag cgcctacact
   211501 gtactcgtgg ttatcggact tttgggaaac attgtactgc tcagcgtgct cgtcgtgaaa
   211561 cgcaagctca agtttccgaa tgacatttac tttttcaacg cgtctttggc agatgttttt
   211621 gccgtgtgca tgttacccgc ctgggtcaac tatgcactgg actccaccca acttagcaag
   211681 ttctcatgca ttacatttac gtttggtttt tacgtttccc tgttcatcca agcctggatg
   211741 ctcattctgg tcaccgtgga gcgatacgga tctctagtat ggatcgcgcc gatcaccaga
   211801 aacaaagcca tagcgaattg tgtcctcttt tggcttatct ccatattatt ggccgcgcct
   211861 tactactctt ttagaaatga aaatgatcaa caccaatgca tcatgaggaa ctatgtctgg
   211921 tgcgttggca caacatggca catagttctg gatttcttag ttacggccac tacctttatc
   211981 ataccagtga ttaccgtgtt agctctgagt ttcaaaatgg ccaggtggtc aacctttggt
   212041 tacagaaacc tcaccagcag aaccagtctt atccttattt tgatactgac agtagcagca
   212101 gggttctggg gaccttttca cctatttatg tttatagaag acgtggcagg gcagatttac
   212161 cacattcaaa aggattgctg gtacttacag ctcagacacc tgtgcagctt gatgaccgaa
   212221 accctagtgt ttctacgttc cgtttttaac ccttatattt atatgataat cagttacaag
   212281 tttcggcagc aggtgcgcag tctactcaag cgtactcagt acgatgcttt ggacacgact
   212341 caattagcag aaaccatgga gctgaaagcg aaaggtgtgg cagtggccga ccccgcgccg
   212401 catgactgcg aatgcttttt gtaaactatc aaacgtgtaa aacaataaat gttcgtttgc
   212461 ctcacaaaag actcggtttc ctgtggagca tatgcgatga cagaaaataa ccggcgaaca
   212521 attagcacac ggccggtagc aaacacgacg gcgtcaacat gaccaacaca ggacactgtc
   212581 acataaacga aagtctcgcg acgtatggaa tcgctcccgc cgccaccatt accctataca
   212641 ccattgcggg aatctgcggt gtcacgggaa atttgttact acttttggtt ctgttcacaa
   212701 gacgcataca ctggttcgca aatgacatct actatctcaa tatgatcttt acagactttc
   212761 ttgttttcat cacgttacct gcctgggtct actacctgct gaattacaca caactttcac
   212821 actacgcctg cattgcccta tcatttgttt tttacgtttc tatctttatt caagctgact
   212881 ttatggtagc agttgccatt gagcggtacc gaagcctggt gaaaaacaaa cccctcagcg
   212941 taaaaaaagc cagcgtcagc tgcgcgtgta tttggatcat tgttattgta gcatcttcac
   213001 cttactacat gttcaggtcg caacacgaaa cgaaatcttg cattctagga aactacacct
   213061 ggcatatgaa cagtcccttc cgtaccacca tggacgcatc cattaacatt tggtcatttg
   213121 tcgttccggc cgttacaact ttgctaatag ccagacgcat ttatgtgtgt acttcaggta
   213181 acaaaaaaat gaatgccaga gccagtggtt tgttagaggc catggtgatt agcatgctat
   213241 tcttcggagg acttttcaac ctgaacatct ttcgagacat agttgcagat acatcggaag
   213301 aaaataaaga ctgcacatat cttaaacaag aacactttat tcgcatggtt ggtgtggccc
   213361 tcgtttacgg gcgcgctata ttcaaccctt ttatgtatat gtgtgtgagt accagattgc
   213421 gccaagaaat aaaatgtttg tttatgcgaa taccttacga aacactagat gcagaacacg
   213481 ctaaactcat ggttgattta aaaaacagaa atgctaatgt ccccgatcct aaacctcgtg
   213541 aatatgaatc tgtgttatag aacatcacag attggaatct atgtttaaaa gtcatccgaa
   213601 tccacggaca tgctggatag tcgccactca agatgaataa cacatcttgc aacttcaacg
   213661 tcactctcaa cgcatcggca ccaagccgat acatagctat tgctctgtac agcattgtca
   213721 tctgcatcgg gttcatcgga aacctgctgt tatgtatcgt gttagtcaag aaacgcaaac
   213781 tgcgatactc cagcgatgtt tattttctcc acgcctccat ggccgacctc gtcagcactg
   213841 tcatgttacc gctctggcta cattacgtcc ttaactttgc ccaactctcc cgggaggcct
   213901 gtatcagctt ttcggtgact ttctatgttc ccctttttgt tcaggcctgg ttactcattt
   213961 ccatcgctat ggagcgatat tccaacttag tgtggatggc acccattagc gttaagacgg
   214021 cctttaaaca ctgcatagga acctggatcg tatctgcctt cgtggcatca ccctactacg
   214081 catacagaaa ctcacacgac gaacacgaat gcattctagg aaactacact tggcacatta
   214141 acgaaccgct acacacgtgt atggatgtgg tgattatagt atggaccttt ttggccccag
   214201 tactggtaac cattatagca agcgtcaaaa tgagacgaac gacctggggc aatcctaggt
   214261 taaacgaaaa gaacagcgac attcttgtag tactagttgt catgacagtg ttcttttggg
   214321 gaccgtttaa tatcatgttg gttattgaca atattttaca gagatactat gataacacca
   214381 tgaattgcga tgtagagaaa gttaaacata tcatggctat gatttcagaa gccattgttt
   214441 attttcgcgg tatcacagcg cctattattt atgtaggaat tagtggcaga tttcgcgaag
   214501 agatttactc tctgtttaga cgccagccat atagcgattt ggaccccgat gccaatcaat
   214561 tcatgattga actcactagc cagggaagaa gtagaaatag aaatgctaga caatcggaaa
   214621 gcaatgtacc gcagccagaa gaatgcttct ggtaaaatgt ttaaagccaa taaactattt
   214681 tcataaaatt gtacatgtgg tctatgtgtc attcttttgg gcgggctcat gatgtaaata
   214741 aaaagcttct cgaggaggct gttcagggca caaacagcca cgcattagat tgttgaaaga
   214801 tgactagcac cacaatgaat actaccacga attccagcac cacgcctcaa tcaagcagca
   214861 ccacgatgac aacgaagaca agcactcctg gcaatacaac tactggcact acgtccaccc
   214921 tgacaacaac atcaacaact tctaatgcta ccagcataac gtctacttta agcactaccg
   214981 gcaaccaaac tgcaactacc aatgctacta ccctcagttc cacattaaca acatctacaa
   215041 atataagcag tacattgtcg acagtttcta ccgtcgcatc caatgcaaca tgtaattcta
   215101 caatcacaac gaatatcaca actgctttta ctacagcagc aaacactacc gcgagcagcc
   215161 tcaccagcat cgtaacttca cttgccacta ccattgaaac cacatcattt gattatgatg
   215221 agtcagcaga agcttgcaac ttaacagaca tcgttcatac tactagatca gtgacagtta
   215281 ctttctacac tatcatcttc atactcggtc ttttgggaaa ctttctggtt ctgatgacca
   215341 tcatttggaa ccgtcgcatt tcctttacgg ttgaaatata tttcgttaat ctagcaatct
   215401 ccgatcttat gtttgtatgt actttaccat tttggataat gtatcttctt gagcacgacg
   215461 ttatgtcaca tgcatcatgt gtaacaatga cagccatttt ttattgcgcg ttgtttgcca
   215521 gcactgtttt cctcttgtta attgttttag acagatgtta tgccattcta ttaggcacag
   215581 aaaaagcaaa tagacgttta ttgcgcaatg ctgtttctgg atgcatgctc atgtggggat
   215641 tgtgcttcat tttagcattg cctcatttta tctttatgaa gaaaggaacc aacgtatgtg
   215701 tagcagagta tgaaccagga cttaacaatt tctatgttat ttttatcaat actgaggtga
   215761 acctatgcac cctagttttg ccagccgcag ccattatcta ctggtatctg aaactgacca
   215821 aagcactcaa aacccatgaa cgattgcgtc atagactaac gtctctaaac atagtgttag
   215881 ctgttgtcat tgtatttgct ttgttttggc tgccgtataa tctcatgctt atgatgtata
   215941 gcttagttca catgcagata ccttgggagt gcagctctga aaaaatactg agacgaagtt
   216001 taattattac agaatccatc gctctcagtc actgttgcat caaccccatt atttacttgc
   216061 tcttcggacc tcgctgtcga agcgagttct gtcacttgtt gcgatgctgc tttacacgct
   216121 tatgtccaca cagatcctgg agcgccatac gtgcagagac ggtctccatc agtctcagtc
   216181 actcacaggt atccgcatcc tctgaggatg atgacaacga tgtgcatgat gaattgcaat
   216241 ttttaatttg aaacacataa catgacaaat gctcaataaa caaatgtatc atagcttgcg
   216301 tgtccgtgtc tcttcttggg gaggtgctag gttattaaaa cgagccaccc gtttgcacat
   216361 gcaacacaaa acccgtgcac atgggacatt ctatcaaagc cgagtgccaa catgctaacc
   216421 cgaccgtggt acatcgatat ctggtggatc acgctgggat gcgccccggc catgagtgta
   216481 acagttttat tgacaacagc cacggtcggg gcacactcca ttgtggttca tgaagcatcg
   216541 ccgccaccac catcatcgtc gtcgctacgc ctgcctatca catccccctc ctctacacac
   216601 tttaccgact cgtcaaaacc atcatacgtc gagcccagcg ccgcggggcc cactcgacag
   216661 cgaacaaacg ctctcaacag gcgacgacgt caacagcaaa gaaaacccta cacctgcatc
   216721 accggcaccc attggacgac caacctagtg tttacgagct gcgaaaacac acccagcttc
   216781 gttaagctcg aaggcgttcg aaagtggact ttaaaaggac aacccctggg agaaacctcc
   216841 tactacggcg ggtgctgccg ccttgcgcac ggagagaatg cgtacatcat tctcgctaac
   216901 ggttatggtc ctgccatcca cggtcatgct ctccgtgtgg attatgcgac tactaactgc
   216961 acacaacctg cgattccgtt tcccacacgg ctggagatta cgtctacgca ggggcttcag
   217021 agccggtgtg gagcgcatcg cttctatttt tacggtctgg agtgttccac ccagctggcc
   217081 ttttccaccc tcggagtggt ggatgtacgc cggtgtccct ccgtactcgc cgttcgaccc
   217141 cttcgacgac ctgggacctt ttgggatgaa cagctacgag gactatccct ggacattcta
   217201 gtctgtctgg cgctagtcat gctgttgttc atggaaatca ttcccggtca ggcgtttcgc
   217261 tatcccatag ggacgtggcg gcgagtctcc gcttttccct ccacatttcg tctccaccgc
   217321 tgggtaaaac ggaatctggc ttctctattt tccaggcaaa ccgaacacca gaaaaagccc
   217381 tccgaggcgg ctgcgaaccg cacatggaca gtgccgtttc catgttctca taccgtcctg
   217441 ctggccccga tcccattccg cctcaggcgc accatgtcat tcccgtctct acaattctcc
   217501 acgtcatccg cccacaatgt gtcccagatc accgacgaca atcccacaca cggtacttat
   217561 gagagccaca acctgccacc tgtcactttg cccgtcactg actacataga agtgatagcg
   217621 gagcatgctc cgataatcta tcgtcaagat gccagcgccg tacaggcgat gctacttcag
   217681 gccgctctgg aacgcgatca taatcgcgag cacgatcgca atcgctgtta acgcctgtca
   217741 tatcgaggtt ggcgaggacg ccaccgtgga acaggagtgc cgccagcgaa acgtgctact
   217801 ggccaccgga cagctgacgc cccacagcca tcgaccgcac gtactggagt tcaccttctc
   217861 caccaaggac agactagggt ccgtgcaacg gctgcagctg cacatcaccg gtttgcagct
   217921 caataacaga accgttctcg accaatctgt ctactggcgc ctgttttcgc gagccacgac
   217981 gctcgagggt ggggtaaagc aaaaagctaa gctacgtctc atctcggaac aacatgtccc
   218041 cgcacgccac tgtgagatca ccgttggcag agacagcggg ctggacgaaa cagagccctg
   218101 gggcctgtta aacgtcctca gctattttgt ttggtgggtc gctatgtgtc tgttagcaat
   218161 agacatcatt atcaacgcct accagtggat tcacaagatc aacagcaaaa cccgcacggc
   218221 ggtctcagtg cgggctgaga tcctgcgcaa cgagcgagaa atgttttgga aaaggcggcg
   218281 ggcgcgacac ggcggcgttt cggagtcgcc cgtctccagc gtaccgcctc gctatgcctg
   218341 caacgagccc tggtccctgc cgagcaccgc agacgccacg gcgagcaacc agtcagcagc
   218401 agcgacccct gcagcaccca cacccccaga atattcctca tcatctgtgt ttcctccttt
   218461 tccccaataa agagagttgt gcattatcga tgtggtcttt gtcccttgtt tcgggtcact
   218521 gcctttaggg tctggaacgg gagacatgga caaggaggaa acctggcggg gtctcatggt
   218581 gtactcgcat agcctatggt gtatctgcgg acactggaag gcgcacattg tcatgagcga
   218641 tgaggccaac tcagaagagg tggcctgcag caactggatg gaagacgcga tcatgcgctg
   218701 gatgcgtaat tctcgagaaa cccacgacaa gtggtgccgc tgcaccgact ggaggggaca
   218761 tgccctcagt ctggaggaaa atcgaatttc tctggtgacg ctacccgcgg ctatggagac
   218821 caagaacacc gcatccagac acaacagcag gctgtcgtgt ttcactcgcg tgttcaaaag
   218881 ttttcgaaaa aaagggcgct gtggccgcgg gtcgagcacg gccagcaaca gcagcggtgc
   218941 cagcaccatc agcagtcaca gctggcaatg gtaccgcgta acaccaccaa cgcctccaca
   219001 agcggaatgt caacgcgctc ctcatccgta atgaagacga cccgtgtgtc gataaaaaag
   219061 agaacgcgtg tacagggctt cattgtaacc gtgttgcttc ttgccaataa caaagtgcac
   219121 tgaaacacat atataggcaa aacgctttga aacaatcatg aacagaccgc gggatctgat
   219181 ccctacgctt catgacccgt gcacccaaac cgaactcaga tggcgaaggg ttttaaccga
   219241 gtctcatgcc ctgtggtgca actgcgggga ctggacacca catgtggagt gcgtagacga
   219301 tgcgtatttc caactgcggt ggcgcagtcg ccaagagcgc accgccctgc gctggcgcag
   219361 gcagatgcac aggttgcaca acctctggtg catgtgcgga aactggcggg aacacgcgct
   219421 gcaccgccgg ggacgcttca cagactcgtc atccggatcg tcagcgtcat catcgggtga
   219481 atcagccgaa aacacattcg tgtggtggaa atgcttgcgc aagtggaaca ttctatggcg
   219541 acacagctat gacttctttg atattcccgt gccgcctgag tctgaacgtg aaacgcccgc
   219601 gtactcggac tcgggatcgg agggaacgcc atgtacgagc atgatagaga tacacaggcc
   219661 acaagattgc cccatcgtca tggatgtacg tccaaggtac cgggaaaccg ctgtgtaacc
   219721 tcgtcacgaa gttgtgcaag catgtacaag catgtgagag ggcgactgtg acatcagttg
   219781 gaagggttta taaagcatgt aaccccaagg gactgcagag gcgactcact tgagtgacac
   219841 ttggctcggt gccgttgtga atgtggcacg cgatcgctgc ccatacacca agtggtgtcg
   219901 ctagcgcggc tcgcgctctg aacaacgcac tgtcagacct tgtctgccgt atctctatgc
   219961 tgtgtgctcg gcgccgacgg cgggctgtga ctcaggagac agcaacggcc ggatcatctg
   220021 aagccaaaca ggctgaacag aaccaggaac agccacagac aagcccttca acctcgttcc
   220081 tgggtcgcgc tctggtcctc gtcggtcaac agctcctggc ggcaaaccag gcagcctgcc
   220141 ctccgccgtc ttggctgtgg aaataagaac aaacgccacc tagcagattc tgccgacaaa
   220201 cagcatgtgc tccacgtcct atatccgtat gggcatttgg gtcacattgg tgattatcat
   220261 gactattgta tttttataaa cgacgttgtg taaaccaata aactacgtat acgctcatag
   220321 tgtctatgca tgtttattca agctcgagag cagacataga aaaccaaaca gtgtatgagt
   220381 ataaaaacag gaaagttaca tattatatat tagcagcttt ggcgtctgag aactggagag
   220441 aatccaggta gtatgtccag gtagcaggga tttccgaatc cacgtgtgtt gctggtatcc
   220501 ccaaagtggt tgtcatggaa tgtgcttttc atggcctgcc agtaggcttc catggttcgg
   220561 ggggcttctg caggaggggg agaaggtgtg tcagtgttca tctcctggtg aagatagtta
   220621 gcgcaggtgt cccaacacga ttgaagcatg tcttcggcgg tgctagttgg cgccggaggt
   220681 ctctgtccct gcgctttgtt cgtgcattgt gaccgtccgc agcagaacgt agacagaaag
   220741 gcattccaac cacggcggag ggttctgtgg aattttgtga gcgctcccat gtctgttagg
   220801 aagagcaatc aagcgagcac cactgccaat gggaagggct tggaataaag tgtgctggac
   220861 aagtgtgtag gcttgtagtt atagtctcta gcacggggtg atgagaacac catcggtgga
   220921 atacttggga aagacggaag ggtcacggtc acggggctga atgggcaaag gccgtcggaa
   220981 cggacgattg gcgcgagcgc gatggttgca aatgcggcgt tgcatgaccg tattaggtcc
   221041 gcggacgctc tggggatccc aatggggatt gtagtcaccg gccgcccagg tgcggtacgg
   221101 caaaagatta aacgagtcgt cttcgccagg atcttcgtct tcctcggggc cgctgggaag
   221161 tttccaatag cgcaaatcat agcgcagcgc gcgcgacaca agcgcttggt cgctctgcgg
   221221 aatcggttcc tgaccggctt ctgccggtag agcaagagct tgggcatcgc gaacgcgcca
   221281 gccgtcctcg tctcttgatt gacaggtgga cgtgtcggta tccaaccgcc atctggccgg
   221341 ccgtgttaaa aacgcaaatt gactgggcaa atcacggggg ccacctgagg gacgtggcca
   221401 gagatacaaa gcatccggtc gcgggcgttc ccaaacataa gggtcctgat cgggcagcaa
   221461 gcgaacagcc gcctgatcag aactggcggc tgcgtagccc gcagttagag cagctagcaa
   221521 gccgacacgt aaaaagtggg ataagtcctc agctaggggg taaatgagtc catcgtacgt
   221581 acagtaacca tacacaactc cgagttcgtc aatgataata agcataacag ccagagggtt
   221641 tttctccaat aaacgaccat cgtcgtcaac ctccgcacgt tcatcagatg gcagttctgc
   221701 atggcatttg gggctgtgtg tggcagcagc agcggctgga gctggtgtgg gcacagttgg
   221761 aacgtctgag gcgggggcgt tgtggcgtga atgtttgttg ggtttgggtc ggcgtttgac
   221821 agtgttgcct tgataggcgg cgaggcgagc gtgttcccga ctggggttgc gggagcgtgt
   221881 gtcaaaccag ttggcgcgag cagcagccca ctcgctcagg tattccagcc acggatgtgt
   221941 agtaacgata cccagtaagt gaaacgtgca gcacaggcgt tcggaaataa agttacggac
   222001 ggctgcgacg atggaaccgg cgtgtggcca tttacagaaa ggttgccaac gttccacttc
   222061 ctcccaactt gtagttaaca gccaaggttg cggagtgcga cctggagttt gtaagcaaat
   222121 ggtgtggcca gctgcgctgt gacccacagc cgccgcagct gcggatgcgc tgggccacgt
   222181 acgagacagc agttcaacag gctcaggagg gtggacggtg aggggtggta gcgtcgggca
   222241 tgcatacacg cgggcgaggt ctccaatgcc gtggcgaaag aagtcatcgg catcagtagc
   222301 cgcgagatgt aaagtgtggc gagggagatc gaaaagaaac actcgaaagt ggcagccgat
   222361 ggcgagaaac aggccttcat gacggcacag ggttggcggg tcctgtggag tggggctcat
   222421 ttcatggact atggtggcga caaggacaat ccagtcgtcg gttggtgaaa gttggcgtaa
   222481 atcagtggcg ccgacgtcgc gcatgtgaga ccgcggagtg acgacggcat aaaagttggc
   222541 tgggcggccc agtggcagga gttggccagt ttggcgttgg caccatttgc gagtagcgcg
   222601 agcagtggtg ttggcaatga acgcatctgc ccaggcggta gccattatga ggaattcatc
   222661 cttagttaga gcgtgttgtt gcgctggaat ggaggccagg cgagtgcgcg tgtcaatgga
   222721 aggcagagtg agcgtggtgg gagctccggg agcatgtgcg ggaggatgca tggcagctgg
   222781 cgtttgtggt ggaggagtag gcaaggcctg catgaggcca gacatatggt ggagtggcga
   222841 cggtggatga ggacgccagt gatgtggagg cgcggggagg cggtgagagt gaggatccgg
   222901 gctgttgcgg aggcctgcgt agcgcagttg ttgccaggag tgtggcgaac ggtgagggcg
   222961 catggttatg taggagtgga gaggttcttt ggcgagaaac ccgggggcga gttatatatc
   223021 agtgtagggt caaggatggg gccgtgaggt gtagcgtgaa acggtgagtg ttactgcgag
   223081 taaataaagt gggtgtgtag agaggcagct gtgcgttagg ggcagtgatg gacagacgta
   223141 ggaggcagct ttcctcccca gggcgccgaa tgcgggtctg cctggcactc cggggttccg
   223201 tgcgtgcgtt gagggccggg ggggtgtttg tggcgggggg gtaaaaattg gcacgttgcc
   223261 agcttgtagg aggaaggcgg cgaaggagac acggagagaa acagcgagag acccgagcgg
   223321 ccgcgctccg tccgcgctcc gccaggcccg cagggaggat agatccgtac agcgagaccc
   223381 ctgcgagcct gcggcaaagc ggacggagcg cgggttcgca atcgcggcga cggatacata
   223441 cggcagatac acacacagag agaaattcac caggacgaaa gcgccgcgca cccggagccc
   223501 cccaggtccc ctccccgttc cccccttggc gtcgggccaa ggccgcgagg ggcgactgtc
   223561 cgacctcgtc tctgtgccaa cgccccgccc accctcgcct cccccctccc cctcgcgcct
   223621 gccgacaacc ggcgaacacg cgcgcggacg gagaggcgcc tggcgcctcg gcccaaagcg
   223681 tccctgtctc tgtgtcgcgc ccttcccggg aggggggccg ggggtcgagg cggggggcgt
   223741 caaaaatgcg ccgtctgtat gtgctgccgg ggcggcgcgg accgtgtttg tttgctcgcg
   223801 ctccctgctt ctgcttttct ccccgcgccg cgaaacccga ctccgccagc gcctcggacg
   223861 gtgagtcatc gctgccgcgt ctacaccgcc agcacacggt gaaacacaac ccgctttctt
   223921 gtcttcacgt tgaaattact aatggcaacg ttgaaaaata ccccacttgc tcgtctacac
   223981 cgccacatct ccacgctgac tcaactccac acgctgagtc aacaccgacg cgccccgcca
   224041 acacaagcac tgagagacgg gcag
//
DBGET integrated database retrieval system