LOCUS NC_040439 1700 bp ds-RNA linear VRL 13-SEP-2019
DEFINITION Chicken picobirnavirus strain PBV/CHK/M3841/HUN/2011 segment RNA2,
complete sequence.
ACCESSION NC_040439
VERSION NC_040439.1
DBLINK BioProject: PRJNA485481
KEYWORDS RefSeq.
SOURCE Chicken picobirnavirus
ORGANISM Chicken picobirnavirus
Viruses; Riboviria; Orthornavirae; Pisuviricota; Duplopiviricetes;
Durnavirales; Picobirnaviridae; Picobirnavirus.
REFERENCE 1 (bases 1 to 1700)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (13-SEP-2019) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence is identical to MH327934.
##Assembly-Data-START##
Sequencing Technology :: ABI PRISM; Sanger dideoxy sequencing
##Assembly-Data-END##
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..1700
/organism="Chicken picobirnavirus"
/mol_type="genomic RNA"
/strain="PBV/CHK/M3841/HUN/2011"
/isolation_source="faecal sample"
/host="chicken"
/db_xref="taxon:1930304"
/segment="RNA 2"
/geo_loc_name="Hungary"
/collection_date="2011"
gene 45..1643
/locus_tag="EXI53_s2gp1"
/db_xref="GeneID:41703991"
CDS 45..1643
/locus_tag="EXI53_s2gp1"
/note="ORF1"
/codon_start=1
/product="RNA-dependent RNA polymerase"
/protein_id="YP_009551574.1"
/db_xref="GeneID:41703991"
/translation="MPKEIVSLKLLDNYFKSSTSLKSYLGNVRRGQPKVYETPFARGE
STKSLLSKWDKVLVSIKDKWPSLYSYEQDLRSKVGPMSIMKPLKERMADIESYYEDVK
LPSSPISDRAIKAVIAEWKRIKGMHVRSQRTTVDLMKKSTNSGSPYFTKRRNVVDDTI
PCVVYPYKRTVAQILNKSSWDACAILGWRGQEGGPSEEDTKQRVVWMFPFAVNIRELQ
VYQPLIELAQRENLVPAWVSMEAVDREITLLFDTKNEKDLIVCTDFSKFDQHFNKSLQ
DAAYSVLSSILTKDATSSDWLRDVFPVKYMIPLALSMSEMRFGLHGMGSGSGGTNADE
TLAHRCLQYEAAQKSKSLLNPHSMCLGDDGIISYPGITVDDVVHAYSSHGQEMNKDKQ
YASTQDCIYLRRWHHKDYRVGGICVGVYSTYRALGRLRYLERYQNPKYWSDRMVALRQ
LSILENVKYHPLKEQFVEFCMKRDKYRLGIDIPGFLDNIEAEAQKAIEHMPDFLGYTK
TLQLEGKDLGIGDWWIVKYLKSHK"
misc_feature 165..1532
/locus_tag="EXI53_s2gp1"
/note="catalytic core domain of RNA-dependent RNA
polymerase (RdRp) of the family Picobirnaviridae of
positive-sense double-stranded RNA [(+)dsRNA] viruses;
Region: dsRNAv_Picobirnaviridae_RdRp; cd23185"
/db_xref="CDD:438035"
misc_feature order(600..623,645..662)
/locus_tag="EXI53_s2gp1"
/note="conserved polymerase motif F; other site"
/db_xref="CDD:438035"
misc_feature order(609..611,657..659,663..665,681..683,693..695,
708..710,717..719,747..749,753..761,831..833,1017..1028,
1035..1037,1122..1133,1248..1253,1302..1304,1326..1328,
1386..1391,1398..1403,1407..1412)
/locus_tag="EXI53_s2gp1"
/note="putative RNA binding site [nucleotide binding];
other site"
/db_xref="CDD:438035"
misc_feature 816..860
/locus_tag="EXI53_s2gp1"
/note="conserved polymerase motif A; other site"
/db_xref="CDD:438035"
misc_feature 1011..1082
/locus_tag="EXI53_s2gp1"
/note="conserved polymerase motif B; other site"
/db_xref="CDD:438035"
misc_feature 1107..1151
/locus_tag="EXI53_s2gp1"
/note="conserved polymerase motif C; other site"
/db_xref="CDD:438035"
ORIGIN
1 gtaaattttg ttttacaaat acatttaaga aaggaggtaa gcaattgcct aaagaaattg
61 tatctttaaa attgctggat aattatttca agtccagtac cagtctaaag tcatatcttg
121 gcaatgtccg tagaggacaa cccaaagtct atgaaacgcc gttcgctcga ggcgaatcta
181 ccaaatcttt actatcaaag tgggataaag tccttgtatc aataaaggac aaatggccct
241 ctttgtattc ttacgagcag gatttacgat ctaaagtagg tcccatgtct atcatgaaac
301 cattaaagga aagaatggca gatattgaat cttactatga agatgtaaaa cttccatctt
361 cgccgatttc cgaccgtgca attaaggcag tgattgcaga atggaaacgg attaaaggta
421 tgcatgtgcg tagccaacgc accaccgttg acctgatgaa gaaatcaact aattcaggtt
481 ctccgtactt caccaagaga cggaatgtag tggatgacac tattccctgt gtcgtatatc
541 catacaaacg cactgtcgcg caaatactca acaagtccag ttgggatgca tgcgcaattc
601 ttggatggag agggcaggaa ggcggcccca gcgaggaaga cacgaaacag cgtgtggttt
661 ggatgtttcc atttgctgtt aatattcgcg agcttcaagt atatcagcct ttgattgagt
721 tagctcagcg tgagaatctg gtccctgctt gggttagcat ggaagcagtt gatagggaaa
781 taacgctctt atttgacact aagaacgaga aagaccttat tgtgtgcaca gattttagta
841 aatttgatca gcactttaat aagtcgttgc aggatgctgc ttatagtgta ctgagtagca
901 tcttgaccaa agacgccact tcgagtgact ggttgagaga tgtattccca gtgaagtata
961 tgattccttt ggcactgagc atgtcagaga tgaggtttgg tcttcacggg atgggatccg
1021 gctcgggcgg aacgaatgcc gatgagacac tagcacacag gtgtctgcag tatgaggctg
1081 cacaaaaatc caaatcttta ttaaaccctc attcaatgtg cctgggtgat gatggcatta
1141 ttagttaccc gggaatcaca gtggatgatg tagttcatgc atactcctct catggtcaag
1201 agatgaataa agataagcag tatgcatcaa cccaagattg catataccta agaaggtggc
1261 atcacaagga ttaccgcgta ggaggtatat gcgtcggggt gtactcaact taccgcgcct
1321 taggtaggtt aagatacctc gagcggtacc aaaatccaaa atattggtca gatagaatgg
1381 ttgctcttcg acagctatct attctggaga atgtgaaata tcatcctctg aaagaacaat
1441 ttgttgaatt ttgcatgaaa agggataaat atcggctcgg gatagacatc ccaggctttc
1501 tggacaatat cgaagctgag gctcagaaag ctatcgaaca catgccggac tttttggggt
1561 acactaaaac tttacaacta gaaggtaagg atttaggtat tggtgattgg tggatcgtca
1621 aataccttaa gagccataag taaaggtaaa ttcgagatgg tgcagcaaac cattggaaca
1681 acatacagtt gttccaactg
//