LOCUS       NC_043093                571 bp    DNA     linear   VRL 20-DEC-2020
DEFINITION  Bovine adenovirus 10 isolate Ma268 hexon gene, partial cds.
ACCESSION   NC_043093
VERSION     NC_043093.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Bovine adenovirus 10 (BAdV-10)
  ORGANISM  Bovine adenovirus 10
            Viruses; Varidnaviria; Bamfordvirae; Preplasmiviricota;
            Tectiliviricetes; Rowavirales; Adenoviridae; Mastadenovirus; Bovine
            mastadenovirus C.
REFERENCE   1  (bases 1 to 571)
  AUTHORS   Sibley,S.D., Goldberg,T.L. and Pedersen,J.A.
  TITLE     Detection of Known and Novel Adenoviruses in Cattle Wastes via
            Broad-Spectrum Primers
  JOURNAL   Appl. Environ. Microbiol. 77 (14), 5001-5008 (2011)
   PUBMED   21622778
REFERENCE   2  (bases 1 to 571)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 571)
  AUTHORS   Sibley,S.D., Goldberg,T.L. and Pedersen,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-MAR-2011) Soil Science, University of Wisconsin, 1525
            Observatory Drive, Madison, WI 53706, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JF699138.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..571
                     /organism="Bovine adenovirus 10"
                     /mol_type="genomic DNA"
                     /isolate="Ma268"
                     /isolation_source="dairy cow urine, aggregate 2"
                     /host="Bos taurus"
                     /db_xref="taxon:39788"
                     /clone="8"
                     /country="USA"
                     /collection_date="Jan-2010"
                     /acronym="BAdV-10"
     gene            1..571
                     /locus_tag="FK839_gp1"
                     /db_xref="GeneID:40524867"
     CDS             <1..>571
                     /locus_tag="FK839_gp1"
                     /codon_start=2
                     /product="hexon"
                     /protein_id="YP_009664773.1"
                     /db_xref="GeneID:40524867"
                     /translation="ASEYLSAGLVQFARATDSYFSLGNKFRNPTVAPTHDVTTERSRR
                     LQLRFVPVDKEDTQYTYKTRFQLTVGDNRVLDMGSTYFDIRGVIDRGPSFKPYSGTAY
                     NNLAPRSAPNNCFFKNDNGGHPDVAYAQLPFVGTREQQNLMVLNAEGQRVAADPIYQP
                     EPQYGVDAWPQNRLGDFNAGRALKSDVTHL"
ORIGIN      
        1 tgcttccgaa tacttgtctg ccggtctagt gcagtttgcg cgcgcaacag attcatattt
       61 tagcttgggt aacaaattta gaaacccaac tgtagcgccc actcatgatg tgacaacaga
      121 aagatcacga cgtctacaat tgcgttttgt tcccgttgac aaagaagata ctcaatatac
      181 atataaaaca cgtttccagc taacagtagg cgataataga gttttagata tgggcagtac
      241 ttattttgat attagaggag tgattgacag agggccgagt tttaaaccat acagcggcac
      301 agcgtataac aatcttgctc ctaggtctgc tccaaataat tgttttttta agaacgataa
      361 tggaggacat ccagatgttg cttacgccca acttcctttt gtgggaacta gagaacaaca
      421 aaacttaatg gtgctaaatg cagagggtca acgagttgcg gctgatccaa tttatcagcc
      481 tgaaccacaa tacggagtag acgcgtggcc acaaaataga ctaggagatt ttaatgcagg
      541 aagagctcta aagtctgatg tgacccatct t
//