KEGG   Cupriavidus necator H16: H16_A0431Help
Entry
H16_A0431         CDS       T00416                                 

Gene name
h16_A0431
Definition
(GenBank) Pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
reh  Cupriavidus necator H16
Pathway
reh00790  Folate biosynthesis
reh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H16_A0431 (h16_A0431)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reh04147]
    H16_A0431 (h16_A0431)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     H16_A0431 (h16_A0431)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H16_A0431 (h16_A0431)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: CAJ91581
UniProt: Q0KEJ0
Position
1:452130..452474
Genome map
AA seq 114 aa AA seqDB search
MSEDLAAQSCTPCRGGVPPLTPAEAEMLLQQAPGWELVDSATRIERRFTFGNFAQALAFV
NGVGQLAETQGHHPEISFGWGHATVSWRTKKIKGLHRNDFIMAVKTSELAEGIG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagacctggcagcgcaatcgtgcacgccttgccgtggcggcgtgccgccgctg
acgccggctgaagccgagatgctattgcagcaggcgccgggatgggagctggtcgatagc
gcgacgcggatcgaacggcgtttcaccttcggcaatttcgcgcaggcgctggcgttcgtg
aacggcgtcgggcaactggccgagacgcaggggcatcatcccgagatcagctttggctgg
gggcatgccacggtgtcgtggcggaccaagaagatcaagggcttgcaccggaatgatttc
atcatggcggtgaagacgagcgagctggcggaggggatcgggtga

DBGET integrated database retrieval system