KEGG   Cupriavidus necator H16: H16_A0453Help
Entry
H16_A0453         CDS       T00416                                 

Gene name
aspS
Definition
(GenBank) Aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
reh  Cupriavidus necator H16
Pathway
reh00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:reh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H16_A0453 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:reh01007]
    H16_A0453 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:reh03016]
    H16_A0453 (aspS)
   03029 Mitochondrial biogenesis [BR:reh03029]
    H16_A0453 (aspS)
Enzymes [BR:reh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     H16_A0453 (aspS)
Amino acid related enzymes [BR:reh01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   H16_A0453 (aspS)
Transfer RNA biogenesis [BR:reh03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    H16_A0453 (aspS)
 Prokaryotic Type
   Other AARSs
    H16_A0453 (aspS)
Mitochondrial biogenesis [BR:reh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    H16_A0453 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA-synt_2d
Motif
Other DBs
NCBI-ProteinID: CAJ91603
UniProt: Q0KEG8
Position
1:476608..478416
Genome map
AA seq 602 aa AA seqDB search
MSSMRTHYCGLVTEQFSGQEVALTGWVQRRRDHGGVIFIDLRDREGLVQVVCDPDRPEMF
KAAEEIRNEFCIRVTGKVRPRPAGTENANLTSGKIEVLCHELTVLNPSVTPPFQLDDDNL
SETTRLTHRVLDLRRPQMQYNLRLRYKVAMEVRKFLDAQGFIDIETPMLGKSTPEGARDY
LVPSRVNPGHFFALPQSPQIFKQMLMVSGFDRYYQITKCFRDEDLRADRQPEFTQIDCET
SFLTEQEIRDLFEDMMRTVFKNAIDVDLDARFPVMEFREAMARFGSDKPDLRVKLEFTEL
TEVMKDVDFKVFSSPANSDNGRVVGLRVPGGGAISRGEIDAYTQFVGIYGAKGLAWIKVN
EVAKGRDGLQSPIVKNLHDAAIAEILKRTGAQDGDIIFFGADKAKVVNDSIGALRLKIGH
SDFGKANGLFEDTWKPLWVVDFPMFEYDEEDARWVAMHHPFTSPKDEHLEYLETDPGKCL
AKAYDMVLNGWEMGGGSVRIFRSDIQSKVFRALNINDDEARAKFGYLLDALQYGAPPHGG
LAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQAPSSVDEKQLRELHIRLRATEPKP
TA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccatgcgtactcactactgcggtctggtgaccgaacaattctcgggccaggaa
gtggccctgaccggctgggtccagcgccgccgcgaccatggcggcgtgatcttcatcgac
ctgcgcgaccgcgaaggcctggtgcaggtggtgtgcgacccggaccgccccgagatgttc
aaggccgccgaagagatccgcaatgagttctgcatccgcgtcaccggcaaggtccgtccg
cgtccggccggcaccgagaacgccaacctgacctcgggcaagatcgaggtgctgtgccat
gagctgaccgtgctgaacccgtcggtcacgcccccgttccagctcgacgacgacaacctg
tcggaaaccacgcgcctgacgcaccgcgtgctggacctgcgccgcccgcagatgcagtac
aacctgcgcctgcgctacaaggtggcgatggaagtgcgcaagttcctcgatgcgcagggc
tttatcgacatcgagaccccgatgctgggcaagagcacgcccgaaggcgcgcgcgactac
ctggtgccgtcgcgggtcaacccgggccatttcttcgcgctgccgcagtcgccgcagatc
ttcaagcagatgctgatggtctccggcttcgaccgctactaccagatcaccaagtgcttc
cgcgacgaagacctgcgtgccgaccgccagccggaattcacgcagatcgactgcgagacc
tcgttcctgaccgagcaggagatccgcgacctgttcgaggacatgatgcgcacggtgttc
aagaacgccatcgacgtcgacctggacgccaggttcccggtgatggagttccgcgaggcc
atggcccgcttcggctcggacaagcctgacctgcgcgtcaagctggaattcaccgagctg
accgaggtgatgaaggacgtcgacttcaaggtgttctcgagccccgccaacagcgacaac
ggccgcgtggtcggcctgcgcgtgccgggcggcggtgcgatctcgcgcggcgagatcgac
gcctacacccagttcgtcggcatctacggcgccaagggactggcctggatcaaggtcaac
gaagtggccaagggccgcgacggcctgcaatcgccgatcgtcaagaacctgcacgacgcc
gccattgccgagatcctcaagcgcaccggcgcccaggacggcgacatcatcttcttcggc
gccgacaaggccaaggtggtcaacgactcgatcggcgcgctgcgcctgaagatcggccac
tctgacttcggcaaggccaacggcctgttcgaagacacctggaagccgctgtgggtggtc
gacttcccgatgttcgagtacgacgaggaagacgcgcgctgggtggccatgcaccacccg
ttcaccagccccaaggacgagcacctggaatacctggagaccgacccgggcaagtgcctg
gccaaggcctacgacatggtgctgaacggctgggaaatgggcggcggctcggtgcggatt
ttccgttcggacatccagagcaaggtgttccgcgcgctcaacatcaatgacgatgaagcc
cgcgccaagttcggctacctgctggacgcgctgcagtacggcgcgcctccgcacggcggc
ctggccttcggcctggaccgcatcgtcacgatgatggccggcgccgactcgatccgcgac
gtgatcgccttcccgaaaacccagcgcgcccaggacctgctgacccaggccccgagctcg
gtcgacgagaagcaactgcgcgaactgcacatccgcctgcgcgccacggagcccaagccg
acggcctga

DBGET integrated database retrieval system