KEGG   Cupriavidus necator H16: H16_A0647
Entry
H16_A0647         CDS       T00416                                 

Gene name
h16_A0647
Definition
(GenBank) Uncharacterized protein conserved in bacteria
  KO
K11896  type VI secretion system protein ImpG
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_A0647 (h16_A0647)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_A0647 (h16_A0647)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAJ91795
UniProt: Q0KDX6
Position
1:complement(687410..689320)
AA seq 636 aa
MSNRSTPADTMDPQLLDYYNRELVYMRELAGEFAKQHPKVAKRLGMQGIEVADPYVERLI
EAFCFLSARTEIKLDAEFPRFTQRLLEVIYPNYVAPTPSIAVAQFRPSQNEGDFAHGVEV
PRGTEVNAAAAPGEKTACQFRTTQPLTLWPVEITEARLTGIPPDVRGPERYVPAHVTVQG
ALRLRLRCTRGATFDQLPGLDHLPVYLRGDDLIASQLFELLHSAGVATLIGHPGAMSERP
CAVAQDAVSYVGMGPGEGALPLQWNSFHGHNLLHEYFACPQRFYFFGLNKLAQGLSRIRG
KEAEIVVLLSKPPRDLTSKVDREQFALFCTPVVNLFPKRTDRIEVTPGRAEFHLVADRQH
PLDYEIHTVRQLCAQRSEHSAGIDFQPLFTTLNSDEGNHGRYFSLRRERRLISEQARKYG
TRTAYVGTELFVSLVDQNEAPYPDALRYLSVESLVTNRDLPNLVPRNGRHDLTPAASIPV
DGIGLIRAPSAPRPPYADGEMAWRLIRLLGFNYLSLTDLEHRSGGQGLRDMLRLFVANDD
LAHQGQIQSLIGANVKPVMRRLPGNGPLIYGRGIQCQLTVDEGGFSGISPYLFGVVLEHF
LARHVSVNVFTQTELHSMQRGLVHRWPVRMGGRSAV
NT seq 1911 nt   +upstreamnt  +downstreamnt
gtgtccaatcgatccacgccagctgacaccatggatccgcaactgctcgattactacaat
cgcgagctcgtctatatgcgcgagctggccggggaattcgccaaacagcacccgaaggtc
gcgaaacggctgggcatgcagggcatcgaggtggccgacccctacgtcgagcgcctgatc
gaggcgttctgcttcctgtcagcgcgtaccgagatcaagctggacgcagagttcccacgc
ttcacccagcggctgctggaggtgatctaccccaactatgtggcgccgacgccatcgatt
gcggtcgcgcagttccgacccagccagaacgagggcgattttgcgcatggcgtggaggtt
ccgcgcggcacggaggtcaacgcggcggcggcgcctggagagaagacggcctgccagttc
aggaccacgcagccgttgacactgtggccggttgagatcaccgaagcgcggctcactggc
attccgcccgatgtcagggggccggagcgctatgtgcccgcccatgtgacagtacagggt
gcactgcggttgcgcctgcgctgtacgcgaggcgcgaccttcgaccagctgcccggcctg
gaccacctgccggtctatctgcgcggcgatgacctgatcgcctcacaactgttcgaactg
ttgcacagcgccggtgtggcgacgctgatcggacaccccggggccatgagcgagcgcccc
tgcgcagtggcgcaggatgctgtcagttacgtgggaatgggaccgggcgaaggcgcgctg
cctttgcagtggaacagcttccacgggcacaacctgttgcatgagtacttcgcttgccca
cagcgcttctatttcttcggcctcaacaagctcgctcagggcctgagccggatccgcggc
aaggaagccgagatcgtcgtgctgctgtcaaagccgccccgggatctgaccagcaaggtc
gaccgcgaacagttcgcgctgttttgcacaccggtggtcaatctgtttccaaagcgcacc
gatcgcatcgaggtcacgccgggccgcgccgagtttcacctggtcgccgaccggcagcat
ccgcttgactacgaaatccacaccgtcaggcagctctgcgcacaaaggtccgagcacagc
gcaggcatcgacttccagccgctctttaccaccctgaatagtgatgaaggcaaccacggc
cgctacttttccctgcggcgcgagcgtcggctgatctctgagcaggctcgcaagtacggc
acacgcacggcatacgtcggcaccgagctgttcgtgtcgctggtggaccagaacgaagct
ccctacccggacgccttgcgctacctgtcagtggaatcgctggttacaaatcgcgatctg
cccaatcttgtaccgcgcaatggccggcacgacctgaccccggcagcttccatccccgtg
gacgggatcggcctgatccgcgcgccgtcggcaccacggccgccctatgcggacggagaa
atggcctggcgcctgatacggctgctgggcttcaactacttgtcgctgaccgacctggag
catcgctcaggcggccagggcctgcgtgacatgctgcggcttttcgtggcgaacgacgac
ctcgcgcaccaggggcaaatccagagcctgatcggcgcgaacgtgaagccagtcatgcgc
cggctgccaggcaacgggcccttgatctacggccgcggcatccagtgccagctcacggtg
gacgaaggcggcttctccggcatcagcccatatctgttcggcgtggtgctggagcatttc
ctggcgcgccacgtctcggtcaatgtcttcacgcaaaccgaactgcactccatgcaacgc
ggcctggtgcatcgttggcccgtgcgcatgggcggccgcagcgccgtgtag

DBGET integrated database retrieval system