KEGG   Cupriavidus necator H16: H16_A0652
Entry
H16_A0652         CDS       T00416                                 

Gene name
h16_A0652
Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_A0652 (h16_A0652)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_A0652 (h16_A0652)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAJ91800
UniProt: Q0KDX1
Position
1:694446..694979
AA seq 177 aa
MSVVNSSQKFIARNRAPRVQIEYDVEVYGSEKRIELPFVMGVLADLSGRPAEPLPAVADR
KFLEIDIDNFDERMKAMKPRVAFAVPNTLSGDGQLMVDMTFESIEDFSPAAVAGKVDALR
QLLEARTQLANLQTYMDGKSGAESLINQLLQDPALLQSLAKAPKPRAGDDEPQSPQS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtctgttgtgaacagttcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtacag
atcgagtacgacgtcgaagtctatggctcggagaagcgtatcgagctgcccttcgtgatg
ggcgtgctggccgacctgtcgggcaggccggccgagccgctgccggcggttgccgatcgc
aagtttcttgagatcgatatcgacaacttcgacgagcgcatgaaggccatgaagccgcgc
gtggcgtttgcggtgcccaacacgctgtccggcgacggccagctcatggtcgacatgaca
ttcgagagcatcgaggatttctcgcccgcggcggtagccggcaaggttgatgcgctcagg
caattgctcgaagcccgcacccagctcgccaacctgcagacctacatggatggcaagtcg
ggcgccgaatcgctgatcaaccagttgctgcaggatcccgcgctgctgcagtcgcttgcc
aaggcgcccaagcccagggccggcgacgacgaacctcagtcgccgcagtcctga

DBGET integrated database retrieval system