KEGG   Cupriavidus necator H16: H16_A0661
Entry
H16_A0661         CDS       T00416                                 

Gene name
h16_A0661
Definition
(GenBank) Bacterial protein of unknown function
  KO
K11893  type VI secretion system protein ImpJ
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_A0661 (h16_A0661)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_A0661 (h16_A0661)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: CAJ91809
UniProt: Q0KDW2
Position
1:707618..708961
AA seq 447 aa
MSWYNKVVWSEGLFLRPQLFQQQERYLEHYAHKRSAALSPFFWGFHHFSIDAEALSLGKL
VVSSAAGIFQDGTPFDAPAHTAVPAPLALQAEHLNQIICLAVPIRTPNAEETNFDDATDS
LARYRAFEQELLDANSIAQGPKLVQLADLRLRLLPEKELSESWLGLPLTRVTEIRADGSA
RLDAALIPPVNVYTASALLQTWLTEIHGLLHLRADAMAERLSAATMRGGDAAEVSEYLIL
QLLNRYEPILTHLLKAKAASPEVLYLHLAALSGELSTFVRTQTRRPAEHAAYRHDAPHLC
LKPLVDDLRFLLNVVLERAAQRIEITEQSHGIRTAVLDPGEIGRFATFVLAVTAQVPADL
LQQQFPAQTKVGPSARLAELVRSHLPGIPLQSLPVPPRQIPFNAGHVYFELSQQHPLWDQ
VAQYGGLALHVAGTFPELRMELWGVRQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagctggtacaacaaggtcgtctggagcgagggactgttcctgcgcccgcaactcttt
cagcagcaggagcgctatctggaacactacgcgcacaagcgtagcgccgcgctcagcccg
ttcttctggggctttcaccatttctcgatcgatgctgaagcgctctcgctgggtaagctg
gtggtctccagtgccgctggaatcttccaggacggtacgccctttgacgctccggcacat
acggcagtgccggcgccgcttgcgcttcaggccgagcacctgaatcagatcatctgtctg
gcggtgccgatccgcacgccaaatgcggaagaaacgaatttcgatgatgccacggattcc
ctggcgcgataccgtgcctttgagcaggaattgctggatgcgaattcgatcgcacaggga
ccaaaactggtgcagttggcagacttgcgtcttcggcttttgccggagaaggaactctcc
gagtcctggcttggcctgccgttgacaagagtgacggaaatccgcgccgatggcagtgcc
agactggatgcagcgctgattccgccggtcaatgtctacacggccagtgcattgcttcaa
acatggcttaccgaaatccacggcctcctgcatctcagggccgatgcgatggccgagcgc
ctgtctgctgccactatgcggggcggggatgctgccgaagtatcggaatacctgatcctc
caattgctgaaccggtacgagccgattctgacccacctgctgaaggccaaggccgcgtcg
ccagaggtgttgtacctgcacctggcggcattgtcgggggaactgtcgacgttcgtgcgc
acccagacccgtcggccggctgagcatgcggcttatcggcacgatgctccgcatctttgc
ctgaagccattggttgacgacctgcgcttcctgctcaatgtggtgctggaacgcgctgcg
cagcggattgaaatcacggagcagtcacatgggatccgaacggcggtgctcgatccgggc
gagatcggccgtttcgcgacctttgtgctggcggtgaccgcgcaggttccggcggatctg
ttgcagcagcagtttccggcccagaccaaggtggggccgtctgcgcggttggcggaactg
gttcggtcccatcttcctggaattccgctgcagtcattgccggtgccgccacggcagatc
ccgttcaatgctggccatgtctactttgaactgtcccagcagcacccgctctgggaccag
gtggcgcagtacggtgggctggcgctgcacgtagcggggacctttcctgagttgcgtatg
gaactgtggggagtgcggcaatga

DBGET integrated database retrieval system