KEGG   Cupriavidus necator H16: H16_A0662
Entry
H16_A0662         CDS       T00416                                 

Gene name
h16_A0662
Definition
(GenBank) outer membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
reh  Cupriavidus necator H16
Pathway
reh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:reh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H16_A0662 (h16_A0662)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_A0662 (h16_A0662)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_A0662 (h16_A0662)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CAJ91810
UniProt: Q0KDW1
Position
1:708958..710235
AA seq 425 aa
MSKPLVSSDPQLDSQAAQPAKAGDRASPRAAAEASSQNDARKSVEQRVEEISRKANPLLA
AARPLLRALADMPTSLRQDQAAALKGILVGEAKDFQAVCERANIRREHVLAAQYCLCTAL
DEAANGMPWGRHTWANNSLLIQLHGENDGGEKVFQLLGRLASSAAEHMDVIEVIYHILSL
GFLGRYAGHADGDRQLDAIRQRLLHLISAARESVPRDLSPHWRGADAGRLSLLRTVPVWV
TASVLALAVFGQFAWYKYQLLFRTHDLEQQILAIGKATPPEPPKALRLAELLKDEIARGV
ISVQEDATRSAVTFRGDDMFGGGRAEVSDKVLPLLDKVAGEINKVSGKVTVVGHSDNVPI
KTAKYPSNQVLSEERAATVTEYLASKGVAKNRLEAIGKGDSEPLTDNKTPAARARNRRVE
IVVTP
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgagcaagccacttgtgtcgagtgatccccaattggactcgcaagcagcacagcctgcc
aaggcaggagatcgcgcgagcccacgcgccgcagcggaggcgagcagccagaacgacgcg
cgcaagtccgttgagcagcgggtggaagagatcagccgcaaggccaatcccttgcttgcg
gcagcgcggccgctgttgcgcgcactggccgacatgccgacatcgctgcgacaggatcag
gcggctgcactgaagggaattctggtgggggaagcgaaagattttcaggcagtctgcgag
cgcgccaatattcggcgcgagcacgttctggctgcacagtattgtctgtgcacggcgctg
gatgaggctgccaatggcatgccatgggggcgccatacctgggcgaacaacagcttgctg
atccagctgcatggcgaaaacgatggcggcgagaaggtgttccagttgttggggcggctg
gcgagctccgccgcagagcacatggacgtgatcgaggtgatctatcacatcttgtcactc
ggcttccttggccgctatgctggccacgccgatggcgatcgccagctcgacgccattcgg
cagcggttgttgcacctgatcagcgcggcacgcgaaagcgtgccgcgcgacctgtcgcca
cactggcgcggcgcggacgccgggcgcctcagcctgcttcgcacagtgccggtgtgggtc
acggcgtcggtgctggcactggcggtctttggccagttcgcctggtacaagtaccaactc
ttgttccgcacccacgatctcgaacagcaaatcctcgccatcggcaaggcaacaccgccg
gagccgcccaaggcgctgcgcctcgccgagttgctcaaggatgagattgcgcgtggggtt
atcagcgtacaggaggatgcgacccgcagtgccgtcacgttccgcggggatgacatgttc
ggcggtggccgcgccgaggtcagcgacaaggtcctgccgttgctggacaaggttgccgga
gaaatcaacaaggtatccggcaaggtgaccgtggtcggccacagcgacaacgttcccatc
aagacggcgaagtacccgtcaaaccaggtgctgtcggaagagcgtgctgcgaccgtgaca
gagtacctggccagcaagggcgtcgcaaagaatcggctcgaagcgattggcaagggcgat
tcggagccgcttaccgacaacaagacgccagccgcccgggcaaggaatcgccgggtcgaa
atcgttgtaacgccgtaa

DBGET integrated database retrieval system