KEGG   Cupriavidus necator H16: H16_A0663Help
Entry
H16_A0663         CDS       T00416                                 

Gene name
h16_A0663
Definition
(GenBank) protein of unknown function, ImcF-related
  KO
K11891  type VI secretion system protein ImpL
Organism
reh  Cupriavidus necator H16
Pathway
reh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:reh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H16_A0663 (h16_A0663)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_A0663 (h16_A0663)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_A0663 (h16_A0663)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: CAJ91811
UniProt: Q0KDW0
Position
1:710248..714069
Genome map
AA seq 1273 aa AA seqDB search
MEFLKRIGAVLFSRQTLALIAVLMVAAAIWFIGPLLGFSSMHPLAGIGARVTLMVLLLAT
TLFWLLGWPVSTTGLAALCLLIWHAGPLLAIGASHPLEPSSVRILLIAAIVLVFVGYVLY
LLWQRARTDKTFVESLLNFGGKREEVVAKDEIARLNTAVQTALRQLKGMRSGSRVGRLFE
GRRYLYELPWYMMVGVPGAGKTTALLNAGLQFPIAGQMSAAARARDGTEQADWWFTNEAV
LIDTAGRYTAQEAGSAIDPAEWKGFLGLLRKYRARAPINGALVTISVEDLLWHSKEERVI
EAARIRARLAELREELGIQFPVYVLVTKVDQLAGFTDYCQYLTSEGRAQPLGFTFPVAGK
RRRGQPAIDVVAQCREEMWALVERLEAGQVGRLYEEFDLARRRALYALSDEFASVTEPLV
AMLEQVFLDSRYDDTERNSMLRGVYFTSAAQTGEAIVADASTVIRRVRGNGKSGAQDAAV
AEKSTGNRSYFLQDVFKRIIVPEAHLVKPNLRWEFRFRLLRLFGHALVLVISLWLAGALY
TSFGDNRSYLAVVQEKAKALAATVTAFYKKPQPDAMPEVLGAARDLPAYAGLDLVNPSAD
WRYGLYSVVPVLGAATLTHTRLQDNLLVPYLVRRVEAVLSTAVSQRDAKQAYDTLRVYLM
LHDKDKFNASDVRSWVRSDWATGNGADAFGGRVAVLEHLDSLLDGSRPVLSPYAKNEALI
RSARDFLDSDTSVERLYDRAKAAMMEEAPQDFTLVRAVGPQAGTVFTRASGEPLERGIPG
LFTYAGYHDLFNVRLPEFVARAQAVDIWVMGRGTGPGAQKKTADNAVGRLTGNDPLTREI
RRLYLSEYARNWEKFLGDIRTVTGSNLAFDLEILRNFAAPDSPLARLGRAAVQETTLSRT
LEPEEKSLAEKALSALDKKADKASALSVRAEARQERELVDNRFAALREVVTGQADAAAPG
ARDTAGKPQLDTIAGIVNAYYTSLVVANNALSTRNLPPPADAGEQLRMEAAKLPAPFKAV
LTDLVVQGARDVNKGVGDILIAQMDAVIGESCRGAIDGKYPFTPTSMQDVDPEDFARVFA
AGGVLDDFFQKVLAPHVDTTISPWRYKLTAPDVPPVAGPSLVPFQRAREIREVFFRDPGA
KKMAWKVDLKVVELDPEIVELNMDFDGQSQRYVHGPVIPLKVTWPGPRGGQGAEITASPR
IRPDTSTLAANGPWALMRVIAKGRLAGSASASHFMAEYDFDGRRAKLDINTGSLANPWTT
GLLQGFQCPGRSG
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atggaatttctgaaacgtatcggcgctgtgctgttctcccggcagacgctcgcgctcatt
gccgtgctcatggtcgcggcagctatctggttcatcgggccgctgctcgggttcagtagc
atgcatccgctggcgggcatcggcgcgcgcgtcacgctcatggtgctgttgctggcaacg
acgctgttctggttgcttggctggccggtctccacgacaggcctcgccgcgctgtgtctg
ctgatctggcatgcggggccgttgcttgcgattggcgccagccatccgctggagccgagc
tcagtccgcattctgctgatcgcggcgattgtgctcgtgttcgtcggctatgtgttgtac
ctgctttggcagcgcgcacgcacggacaagacttttgtcgagagcctgctgaactttggc
gggaagcgcgaggaggttgtggccaaggatgaaatcgccaggctgaacacggcggttcag
actgccctgcgacaactcaagggcatgcgtagcggcagccgggtcggtcgcctgttcgaa
ggccgccgctacctctatgaactgccctggtacatgatggttggcgtgccgggggccggc
aagacgacggcgttgctgaacgccggactgcaattccctatcgcgggtcagatgagtgcg
gcggctcgcgcacgggatggcaccgagcaggcagattggtggttcaccaatgaggcggtt
ctgatcgacacggcaggccgctatacggcgcaggaagcgggttcggcgatcgacccggca
gaatggaagggattcctcggcctgctgcgaaaatatcgcgcccgcgccccgatcaacggc
gcgctggtgacgatcagcgtggaggacctgctttggcactccaaagaggagcgggtgatc
gaagcggccaggattcgggcgcgcctggccgaactgcgcgaggaactgggcatccagttt
cctgtctacgtgctggtgaccaaggtcgatcagcttgccggcttcacggactattgccag
tacctgaccagcgaaggccgtgcccagcctttggggttcacctttccggttgcgggaaag
cggcggcggggacagccagcaatcgatgttgttgcgcagtgccgtgaggagatgtgggcg
ctggtggagcggctggaagccgggcaggtcggacggctgtatgaggagttcgatctggcc
cgacgccgggcgctctacgcgctgagcgacgagttcgcgagcgtgacggagccgcttgtc
gcgatgctggagcaggtattccttgactcgcgctatgacgacaccgagcggaattccatg
ttgcgcggcgtgtatttcaccagtgcggcgcaaaccggggaagcgatcgtcgcggatgcg
agcaccgtgatccggcgggtgcgtggcaacgggaagtctggcgcccaggacgccgccgtc
gcggaaaagtcaaccggcaaccgcagctacttcctgcaggacgtcttcaagcgcatcatc
gtgcccgaggcgcacctggtgaagccgaacctgcgctgggagttccgcttccgcctgttg
cgcctgtttggccatgcgctggtgctggtcatttccctgtggctagccggagcgctctat
acgagctttggcgacaatcgcagctatctggcggtggtgcaggagaaagccaaggcgctg
gccgccacggtaacggcgttttacaagaagccgcagcctgatgcgatgccggaggtgttg
ggagcggcccgcgacctgcctgcctacgccggcctggatctggtcaatccttctgctgat
tggcgctatggcctgtacagcgtggtgccggtgctgggcgccgcgaccttgacccatacc
aggttgcaggacaacctgctggtgccgtacctggtgcgccgggtcgaagcggtgctgtca
acggcggtcagtcagcgcgacgccaagcaggcctacgacacgctgcgggtctacctgatg
ctgcatgacaaggacaagttcaacgcatccgacgtgcgtagctgggtgcgcagcgactgg
gcgacgggcaacggggcggatgcctttggtggccgcgtggcggtgctggagcatctggac
agcctgctcgatggcagccggccggtcttgtcgccctacgcaaagaacgaggcactgatc
cgctcggcgcgcgatttcctggacagcgatacctcggtcgaacgcctgtatgaccgcgcc
aaggcggccatgatggaagaggcaccgcaggatttcacgctggtgcgcgcggtcggtccc
caggccggcacggtctttacccgggccagcggcgagccgctggagcgcggtattccgggg
ctttttacctatgccggctaccacgacctgttcaatgtccgtttgccggagtttgtcgcc
agggcgcaggcggtcgacatttgggtgatggggcgtggaacagggcctggcgctcaaaaa
aaaacggctgacaatgccgtcggccggctcacgggcaatgatccgctcacgcgcgagatc
cggcgcctttacctgagcgaatatgcccggaactgggagaagtttctgggtgacatccgg
accgtgacgggaagcaacctggcctttgacctggagatcctgcgcaactttgccgcgccg
gattcaccgcttgcccggctgggcagggccgcggtgcaagaaacgacgctcagccgcacg
ctcgagcccgaggaaaagtcccttgcggagaaggcgttgtcagcgctggacaagaaggcc
gacaaagccagcgcactgagcgtgcgtgccgaggcccgtcaggaacgcgagctggtcgat
aaccgcttcgccgcgctgcgcgaagtggttaccggccaggccgacgcggcggcgccaggc
gcgcgggacaccgccggcaagccgcaactggatacgattgccggcatcgtcaatgcttac
tacaccagtctggtagtggccaataacgcgctgagcacccggaacctgccgccgcccgcg
gatgcaggcgagcagttgcgcatggaggcggcgaagctgccggcgcccttcaaggcggtg
ctgaccgacctggtcgtgcagggcgccagggacgtcaacaagggtgttggcgatatcctg
attgcgcagatggacgccgtcatcggcgagagctgccgcggcgccatcgacggcaagtat
ccgttcacgccgacgtcgatgcaggacgtggacccggaagactttgcacgcgtcttcgcc
gcgggcggagtgttggacgactttttccagaaggtgttggcgccgcacgtggataccacc
atctcgccttggcgctacaagctgaccgcccccgacgtgccgcccgtggctggcccgagt
ctggtgccgttccagcgcgccagggaaatccgggaagtgttcttccgggatccgggagcg
aagaagatggcctggaaggtcgacctgaaggtggtggaactcgatcccgaaatcgtcgag
ctgaacatggacttcgacggacagagccagcgttacgtgcacggtccggtcatcccgctc
aaggtgacctggccgggaccgcggggcgggcaaggggccgagatcactgccagcccccgg
attcgtccggatacctcgacgctggccgccaacggcccgtgggccctgatgcgggtgatt
gccaagggcaggctcgccggctccgctagcgccagccacttcatggccgaatatgacttc
gacggccgcagggcgaagctcgatatcaataccggcagcctcgccaacccctggaccacc
gggctgctgcagggcttccagtgtcccgggagatccgggtga

DBGET integrated database retrieval system