KEGG   Cupriavidus necator H16: H16_A0804Help
Entry
H16_A0804         CDS       T00416                                 

Gene name
hldD
Definition
(GenBank) ADP-D-beta-D-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
reh  Cupriavidus necator H16
Pathway
reh00540  Lipopolysaccharide biosynthesis
reh01100  Metabolic pathways
Module
reh_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    H16_A0804 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:reh01005]
    H16_A0804 (hldD)
Enzymes [BR:reh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     H16_A0804 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:reh01005]
 Unusual sugar
  H16_A0804 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10 KR
Motif
Other DBs
NCBI-ProteinID: CAJ91951
UniProt: Q0KDH0
Position
1:877197..878192
Genome map
AA seq 331 aa AA seqDB search
MTIIVTGAAGFIGSNLVKGLNDRGETNVIAVDNLTRADKFHNLVDCEISDYLDKQDFLAR
FARGEFGKVRAVFHEGACSDTMETDGRYMMENNYRYTLSLMESCLEQGTQFLYASSAATY
GASQVFREDREFERPLNVYGYSKFLFDQIVRRRLPSALSQIVGFRYFNVYGPRETHKGRM
ASVAFHNFNQFRADGTVKLFGEYGGYAPGMQSRDFISVEDVVKVNLHFFDHPDKSGIFNL
GTGRAQPFNDIAATVVNTLREAEGKPRLSLDELVQEGLLEYVKFPDALRGKYQCFTQSDV
SKLRSAGYSEPFLSVEEGVARYCRWLIERAG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtcaccggcgccgctggctttatcggcagcaacctcgtcaaaggcctg
aacgaccgcggcgagaccaacgtcatcgctgtcgacaacctgacccgtgccgacaagttc
cacaacctggtcgactgcgagatctccgactacctggacaagcaggacttcctcgcgcgc
tttgcccgcggcgagttcggcaaggtgcgggcggtattccatgagggcgcgtgctccgac
accatggagaccgacggccgttacatgatggagaacaactaccgttacacgctgtcgctg
atggagagctgcctggaacagggcacgcagttcctgtatgcgtcgtcggcggctacctac
ggtgcttcgcaggtgttccgcgaagaccgcgagtttgagcgcccgctgaacgtgtacggc
tactccaagttcctgttcgaccagatcgtgcggcgccggctgccgtcggcgctgtcgcag
atcgtgggcttccgctacttcaacgtgtacggcccgcgtgaaacgcacaagggccgcatg
gcctcggtcgccttccacaacttcaaccagttccgcgccgacggcacggtgaagctgttc
ggcgagtacggtggctatgcccccggcatgcagagccgcgactttatctcggtcgaggac
gtggtcaaggtcaacctgcacttcttcgaccatccggacaagtccggcatcttcaatctc
ggcaccggccgcgcgcagccgttcaacgacatcgccgccaccgtggtcaataccctgcgc
gaggccgaaggcaagccgcgcctgtcgctcgatgaactggtgcaggaaggcctgctcgag
tacgtcaagttccccgatgcgctgcgcggcaagtaccagtgctttacgcagtcggatgtg
tcgaagctgcgcagcgccggctacagcgagccgttcctgagcgtcgaggaaggcgtggcg
cgctactgccgctggctgatcgaacgcgccggctga

DBGET integrated database retrieval system