KEGG   Ralstonia eutropha H16: H16_A0817Help
Entry
H16_A0817         CDS       T00416                                 

Gene name
dadA1
Definition
(GenBank) D-amino-acid dehydrogenase
  KO
K00285  D-amino-acid dehydrogenase [EC:1.4.5.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    H16_A0817 (dadA1)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.5  With a quinone or other compound as acceptor
    1.4.5.1  D-amino acid dehydrogenase (quinone)
     H16_A0817 (dadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox NAD_binding_8 Amino_oxidase ApbA FAD_binding_2 UDPG_MGDP_dh_N 3HCDH_N Trp_halogenase HI0933_like FAD_binding_3 AlaDh_PNT_C Thi4 GIDA ThiF NAD_binding_7 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: CAJ91964
UniProt: Q0KDF7
Position
1:complement(890926..892230)
Genome map
AA seq 434 aa AA seqDB search
MRVLVLGSGVIGVTSAWYLAKAGHEVTVVDREAGPALGTSFANAGQISPGYASPWAAPGV
PLKAIKWMFQQHAPLSIRPDGTLFQLQWMWQMLQNCSAERYAVNKERMVRLAEYSRDCIR
ALRAETGIAYEGRQQGTLQVFRTDEQLQGAAKDIAVLEEAGVPYQLLSREELAASEPALA
AVRHKLAGGLRLPNDETGDCALFTQRLAGMAELLGVKFLYNRSIDRLMTQGDAVTGAVVD
GQPMDADLVVVALGSWSTQLVKPFLRGMSNLPVYPLKGFSITVPLSDPSRSPVSTVLDET
YKVAITRFDDRIRVGGMAQIVGYDRSLDPAKRRTLEHVVTDLFPGAGDVSQAAFWTGLRP
MTPDGTPIVGPTQVRGLWLNTGHGTLGWTMACGSGKLLSDLVSGTSPAIRADDLSVGRYL
KPARHHLAPRPATA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttctcgtactaggcagcggcgttattggcgtcaccagtgcgtggtatctggcc
aaggccggtcacgaagtgaccgtcgtcgaccgcgaggccgggcccgcgctcggcaccagc
tttgccaacgcggggcagatctcgcccggctatgcgtcgccgtgggcggcgccgggcgta
ccgctgaaggcgatcaagtggatgttccagcaacatgccccgctcagcatccgtccggac
ggcacgctgttccagctgcaatggatgtggcagatgctgcagaactgcagcgccgaacgc
tacgccgtcaacaaggagcgcatggtacggctggccgaatacagccgcgactgcatccgc
gcgctgcgcgcggagacgggcatcgcttatgaaggccgccagcaaggcacgctgcaggtg
ttccgcaccgacgagcagctgcaaggcgcggccaaggacatcgccgtgctggaagaagcc
ggcgtgccttaccagttgctttcgcgcgaggaactcgccgcgagcgaaccggcgctggcc
gccgtccgccacaagctggccggcggcctgcgcctccccaacgatgaaaccggcgactgc
gcgctgtttacgcaacggctcgcgggcatggccgagctgctgggcgtgaaattcctgtac
aaccgctcgatcgacagactgatgacccagggcgatgccgtcaccggcgccgtggtcgac
ggccagccgatggatgccgacctggtggtggtggcgctgggcagctggtcgacgcagctg
gtcaagccgttcctgcgtggcatgtccaacctgcccgtgtatccgctcaagggcttctcg
atcacggtgccgctgagcgatccgtcgcgcagcccggtgtccaccgtgctggacgaaacc
tacaaggttgccatcacccgcttcgacgaccgcatccgggtgggcggcatggcgcagatc
gtcggctatgaccgcagcctggatccggccaagcgccgcacgctcgaacacgtggtcacc
gacctgttcccgggcgccggcgatgtcagccaggccgccttctggaccggcctgcgcccg
atgacgccggacggtacgccgatcgtcggcccgacccaggtgcgcggcctgtggctgaac
acgggccacggcacgctcggctggaccatggcctgcggctcgggcaagctgctctcggac
ctggtctctggcacgtcgccggcgatccgcgccgacgacctgtcggtgggccgctacctg
aagccggcgcgccatcacctggcgcccaggcctgccactgcctga

DBGET integrated database retrieval system