KEGG   Cupriavidus necator H16: H16_A0872Help
Entry
H16_A0872         CDS       T00416                                 

Gene name
h16_A0872
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
reh  Cupriavidus necator H16
Pathway
reh00071  Fatty acid degradation
reh00072  Synthesis and degradation of ketone bodies
reh00280  Valine, leucine and isoleucine degradation
reh00310  Lysine degradation
reh00362  Benzoate degradation
reh00380  Tryptophan metabolism
reh00620  Pyruvate metabolism
reh00630  Glyoxylate and dicarboxylate metabolism
reh00640  Propanoate metabolism
reh00650  Butanoate metabolism
reh00900  Terpenoid backbone biosynthesis
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
reh01212  Fatty acid metabolism
reh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H16_A0872 (h16_A0872)
   00630 Glyoxylate and dicarboxylate metabolism
    H16_A0872 (h16_A0872)
   00640 Propanoate metabolism
    H16_A0872 (h16_A0872)
   00650 Butanoate metabolism
    H16_A0872 (h16_A0872)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H16_A0872 (h16_A0872)
   00072 Synthesis and degradation of ketone bodies
    H16_A0872 (h16_A0872)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H16_A0872 (h16_A0872)
   00310 Lysine degradation
    H16_A0872 (h16_A0872)
   00380 Tryptophan metabolism
    H16_A0872 (h16_A0872)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H16_A0872 (h16_A0872)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H16_A0872 (h16_A0872)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H16_A0872 (h16_A0872)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reh04147]
    H16_A0872 (h16_A0872)
Enzymes [BR:reh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H16_A0872 (h16_A0872)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H16_A0872 (h16_A0872)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C DSBA ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAJ92019
UniProt: Q0KDA2
Position
1:961215..962411
Genome map
AA seq 398 aa AA seqDB search
MSSNVLIAGVGMVPFRRPGQSDPYDVMAEKAVRTALADAGIDYSLVDQAFASFVYGDSCS
GERALYRVGMTGIPITNVNNNCASGSSALYLARQAVLAGAAECALAVGFEQMQPGALDRV
FPGHADPLERHRESVAVAMGFGEAERALPPALMMFGSQLEWTARELHIPDEVFARIAVKA
RAHARHNPYAIFRDPLTVEAVLAAPTVWGRLRKLYACPPSCGAAAVIVCSEPFARRHGLR
MDVAILAHEIGSDISADLDPPNVPDALSRGAARRTADRAYAMAGVAPLDIDVAEVHDCFV
SNELLTYACLGFCEEQDLERFVVEGRNTYGGQVVVCPSGGLLSKGHPLGATGLAQITELA
TQLRGSAGQRQVEGARTALQHNGGLGTAVSVAILQRQG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatgtactgatcgccggcgtcgggatggtgccgttcaggcgccccggccag
agcgacccctatgacgtgatggccgaaaaggcggtgcgcaccgccctggccgatgccggc
atcgattacagcctggtggaccaagctttcgcgagcttcgtctacggagactcgtgctcg
ggggaacgcgcgctctaccgggtcggtatgaccggcatcccgatcaccaacgtcaacaac
aactgtgcttcgggttcttcggcgctgtacctggcgcggcaggcagtgctggcaggcgcg
gcggaatgcgcgcttgcggtcggctttgagcaaatgcagcccggcgcgttggaccgggtg
tttccaggccatgccgatccgctggagcgccaccgcgagagcgtggcggtggcgatgggc
tttggtgaagcggaacgcgcgttgccgccagcgctgatgatgttcggctcgcagctcgaa
tggacggcgcgcgaactgcatatcccggacgaggtgttcgcgcgcattgcggtcaaggcg
cgcgcacatgccaggcacaacccctacgcgatcttccgcgacccgctcacagtcgaagcg
gtgctggccgcccccacggtctgggggcgcctgcgcaagctctacgcctgcccgccgagc
tgtggcgccgccgccgtgattgtgtgcagcgagccgtttgcgcgacgccacgggctgcgt
atggacgtggcgatcctcgcgcacgaaataggcagcgatatttctgccgacctcgatccg
cccaacgtgcccgatgcgctgagccggggcgcggcgcgccgcacggctgaccgcgcatac
gccatggccggcgtggcgccgctggacattgacgtggcggaagtgcacgactgcttcgtc
agcaacgagttgctcacctacgcgtgcctgggcttctgcgaagagcaagaccttgagcgc
ttcgtggtcgagggacgcaacacctacggcggccaggtggtggtgtgtccgtcaggtggc
ttgttgtccaaggggcacccgctgggcgcgaccgggctggcgcagatcaccgagctcgcc
acccaattgcgtggcagcgccggccagcggcaggtcgagggcgcccgcacggcgctgcag
cacaacggcgggttgggcactgcggtatcagtcgcgatcctgcagcgccagggctga

DBGET integrated database retrieval system