KEGG   Ralstonia eutropha H16: H16_A1047Help
Entry
H16_A1047         CDS       T00416                                 

Gene name
tim
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00051  Fructose and mannose metabolism
reh00562  Inositol phosphate metabolism
reh00710  Carbon fixation in photosynthetic organisms
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
reh01230  Biosynthesis of amino acids
Module
reh_M00002  Glycolysis, core module involving three-carbon compounds
reh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A1047 (tim)
   00051 Fructose and mannose metabolism
    H16_A1047 (tim)
   00562 Inositol phosphate metabolism
    H16_A1047 (tim)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    H16_A1047 (tim)
Enzymes [BR:reh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     H16_A1047 (tim)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   H16_A1047 (tim)
  Exosomal proteins of bladder cancer cells
   H16_A1047 (tim)
  Exosomal proteins of melanoma cells
   H16_A1047 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAJ92189
UniProt: Q0KCT2
Position
1:1145822..1146559
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAGAAKATLAVCAPFPYLAQCQALLNGSQVAWGA
QDVSAEARGAFTGEVSASMVGEFGCTYVLVGHSERRTYHGETDQTVAAKALRALEFGIVP
VVCVGETLAQREAGETEAVVGRQLQAVLDALTVEQLSRVVLAYEPVWAIGTGKTATSEQA
QAVHAFLRGQVAARDAGVAERMAILYGGSVKPDNAAELFSMTDIDGGLIGGASLKSADFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaattggaagatgcatggcagcctggctgcaaacgcg
gcgctgctggagggcatcaaggctggcgcggccaaggcgacgctggcggtctgcgcgccg
ttcccctatcttgcacaatgccaggcgttgctgaatggctcgcaagtggcctggggcgca
caagatgtgtcggcagaggcgcgcggcgccttcaccggtgaagtctcggcatcgatggtg
ggtgagtttggctgcacttatgtgctggtcggccactcggagcgccgcacctatcatggc
gaaaccgaccagaccgtcgcggccaaggcgctgcgcgcgctggaattcggcatcgtcccg
gtagtctgcgtgggtgaaacactggcccagcgcgaggcgggcgaaaccgaagcggtggtc
ggcaggcagctgcaggccgtgctggacgcgctgacggtggagcagctgagccgcgtggtg
ttggcctatgagccggtctgggcgatcggcaccggcaagaccgccaccagcgagcaggcg
caggcggtgcacgcgttcttgcgcggccaggttgccgcgcgcgacgcgggcgtggccgag
cgtatggccatcctgtacggcggcagcgtcaagccggacaatgcggccgaactgttttcc
atgaccgatatcgacgggggcctgattggcggcgcctcgctgaagtcggcagattttctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system