KEGG   Cupriavidus necator H16: H16_A1732Help
Entry
H16_A1732         CDS       T00416                                 

Gene name
h16_A1732
Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
reh  Cupriavidus necator H16
Pathway
reh00330  Arginine and proline metabolism
reh00360  Phenylalanine metabolism
reh00380  Tryptophan metabolism
reh00627  Aminobenzoate degradation
reh00643  Styrene degradation
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    H16_A1732 (h16_A1732)
   00360 Phenylalanine metabolism
    H16_A1732 (h16_A1732)
   00380 Tryptophan metabolism
    H16_A1732 (h16_A1732)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H16_A1732 (h16_A1732)
   00643 Styrene degradation
    H16_A1732 (h16_A1732)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     H16_A1732 (h16_A1732)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAJ92856
UniProt: Q0KAW5
Position
1:complement(1889821..1891302)
Genome map
AA seq 493 aa AA seqDB search
MKLAEYTALDGMGLHHLIATREVTAMEVALAALAAIEAVNPQVNAVLDYWPEEVEIQSAG
IVSVDPRPLGGVPFLLKDLGVTMQGRRSEMCSRLAMGTVAKEDSYVMTSFRQAGLITLGR
TTMPELAVSTTTEPVLYGPTRNPWSLQHGAGGSSGGAGAAVAAGIVPIAHATDGGGSIRV
PAACNGLFGLKPTRGRVSNGPHVDEVWNGLGVHFAVSRTVRDSAALLDGIHGGGVGEPYY
IAPPKDSYLSEIRQQPGNLKIGFMMNPFSAARTDTGVADALSKVARTLESLGHHVHEVAP
DLGVSWDAFVQCNAKIWAANAALRINDIAAATGRTVDEKHLEPATLALYRYGIEVGAVEL
LSALQVRNTVTRALGRFFGNYDILLTPTLPRLPPRIGEYNRIGTSVDGLDWIAHVLSQSP
FTALSNVTGTPAMSVPLSIDPQSDLPIGSHFMSGFGREHTLFRLAAQLEAACPWRERRPP
VWAGSIVNTTSQP
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgccgaatacaccgcccttgacggcatggggctgcatcacctcatcgccacg
cgagaagtgaccgcaatggaagtggcgctagccgcattggctgccatcgaggccgtcaat
ccccaagtaaatgctgtgctcgattactggcccgaagaggtggagatacagtcagctggc
atcgtgagtgtcgatccgagacccctaggtggcgtgccatttctcctcaaggatctcggc
gtcaccatgcagggacgcaggagcgaaatgtgcagtcgcctggcgatgggaaccgtcgca
aaggaagactcgtacgtaatgacgagcttccgtcaggcaggcctgattacgctcgggcga
acaaccatgccagaactggcggttagcacgacgacggaacccgtgctgtacggcccgacg
agaaatccctggagtctgcagcatggcgcgggcggatcgagcggcggtgcgggagcggcg
gtggccgccggtatcgttccgattgcgcatgcgacggacggcggcggatcgatacgggtg
ccggccgcctgcaacgggctgttcggtctgaagccgaccaggggacgcgtgtcgaacggg
ccccacgtggacgaagtatggaacgggctgggcgtgcattttgccgtgagccgaacggtg
cgcgatagtgcagcgctgcttgatggcatccacggcggcggcgtgggcgagccctactac
attgccccacccaaagacagctatctgtcggagatccgacagcagccgggaaatctgaag
atcgggttcatgatgaatccattcagtgccgcgcgtactgacacgggggttgcggatgcc
ttgagcaaggtggccaggacactcgagtccctgggtcatcatgtccatgaagtagcgcca
gacttaggtgtgagctgggacgcatttgtgcaatgcaatgcgaaaatctgggctgccaac
gcagcgctccggatcaacgacattgccgcagccacgggacgaacagtggatgaaaagcac
ctcgaaccggcaacgctcgcgctctatcgatacggcattgaggttggcgccgtagagctc
ctgtcggcattgcaggtcaggaataccgtcacacgggcgctggggcggttcttcggaaac
tacgacattctgctgacaccgacgttacccagacttccgcctcggattggtgaatacaac
cggataggaacatccgtcgatgggcttgactggattgcgcacgttcttagccagtcaccg
tttaccgcgttatcgaacgtgacgggaacgccagcaatgtcagtgccgctttccatcgac
cctcaatcggatctgccaatcggctcgcattttatgtctggcttcgggcgggagcacacg
ctgttccgtctggccgcacaattggaagcggcatgtccttggcgcgaacggcggccaccg
gtatgggcaggatcaatcgtcaacacgacgtcgcaaccgtag

DBGET integrated database retrieval system