KEGG   Cupriavidus necator H16: H16_A1854Help
Entry
H16_A1854         CDS       T00416                                 

Gene name
manC1
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
reh  Cupriavidus necator H16
Pathway
reh00051  Fructose and mannose metabolism
reh00520  Amino sugar and nucleotide sugar metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    H16_A1854 (manC1)
   00520 Amino sugar and nucleotide sugar metabolism
    H16_A1854 (manC1)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     H16_A1854 (manC1)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     H16_A1854 (manC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 DUF218 AraC_binding
Motif
Other DBs
NCBI-ProteinID: CAJ92957
UniProt: Q0KAL4
Position
1:2010860..2012389
Genome map
AA seq 509 aa AA seqDB search
MRTTDPLDVVDDTATDALAGQDRASPPALGMRLAAVVLAGGSGTRLWPLSRKHFPKQLID
IIGRDSLLQTTVRRLAGLHGSASADAAPIIVCGEAHRFMAAQQLAEAGVDARIVVEPVGR
NTAPALTLAALLACEQGNDSILVAMPADHVIADGKAFRLAVLRAARFAEQGAIATLGVPP
TRADTGFGYIRLGAQLEGMARRIDAFVEKPAAELAAQYLASGEYWWNSGIFVVRASTWLT
ALQQLQPAMHVACVSACTAGRSDGAFFYPHAASFTEVPSDSIDYAVMEHLARADALKGVV
VPLEAGWSDLGSWDAVWDAIDKDDDCNAARGRVMFEGASSCYAHSEGRLVACVGTVNLIV
VETADAVLVVDRSRVQAVKGLVERIARQHGPEAETHRKVQRPWGSYDSLDHGERFQVKRI
VVHPGAALSLQLHHHRAEHWTVVRGTARVTRGNEQFLLSENESTYIPIGVTHRLENPGKL
PLEIIEVQSGAYLGEDDIVRIADTYGRCG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaacggacccgctggatgtagtggatgacaccgccaccgatgcgctcgccggg
caggaccgggcatcgccgcccgccctgggcatgcggcttgcggcggtggtgcttgccggg
ggctccggcacccggttgtggcccctgtcgcgcaagcactttcccaagcagctgatcgac
atcattggccgcgattccctgctgcagaccaccgtacgccgcctggccggcctccatggc
agcgccagcgctgacgccgcgccgatcatcgtctgcggcgaagcacaccgtttcatggct
gcgcagcaactggccgaggcaggggtggacgcgcgtatcgtcgttgagccagtcgggcgc
aatacggcgccggcactgacgctcgccgcgctgctggcctgcgagcagggcaacgacagc
atcctcgtcgccatgcccgcggaccacgtgattgccgatggcaaggcgttccgcctcgcc
gtactgcgcgcggcacgctttgcagaacaaggggccatcgccacactcggggtgccgcct
acgcgcgccgacacgggcttcggctatatccggctcggtgcgcagctcgaaggcatggca
cgccggatcgacgcgttcgtggagaagcccgccgccgaacttgcggcgcagtacctcgcg
tccggcgaatactggtggaacagcggcatcttcgtggtgcgcgccagcacctggctgacc
gcgctgcaacagcttcagccggcgatgcacgtagcctgcgtgagcgcctgcacggccggc
cgcagcgacggcgcgttcttttatccgcacgcggcgtcgttcaccgaggtgccatcggac
tcgatcgactatgccgtgatggagcacctggcgcgcgccgacgcgctcaaaggcgttgtg
gtcccgctggaggcgggctggtctgacctcggttcttgggatgccgtatgggatgccatc
gacaaggacgacgactgcaatgccgcgcgcggccgcgtgatgttcgagggcgcctcctcg
tgctacgcccattcggagggacggctggtggcctgcgtgggtacggtcaatctgatcgtg
gtcgaaaccgccgatgccgtgctggtggtggaccgctcgcgggtccaggcggtcaagggc
ctggtcgagcgcatcgcgcgccagcatgggccggaggccgagacccatcgaaaggttcag
cggccatggggcagctatgactcgctcgaccatggcgagcgcttccaggtcaagcgcatc
gtggtgcatcccggcgccgctctctccttgcagttgcaccaccaccgcgcggagcactgg
acggtggtccgcggcaccgcgcgggtcacgcgtgggaacgagcagttcctgctcagcgag
aacgaatccacttacatccccatcggcgtgacgcaccggctcgagaaccccggaaagctg
ccgctcgagatcatcgaggtgcagtccggcgcgtatctcggcgaggacgacattgtccgc
atcgccgacacctacgggcgctgcggctga

DBGET integrated database retrieval system