KEGG   Cupriavidus necator H16: H16_A1882Help
Entry
H16_A1882         CDS       T00416                                 

Gene name
h16_A1882
Definition
(GenBank) Asp-tRNA Asn / Glu-tRNA Gln amidotransferase A subunit or related amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
reh  Cupriavidus necator H16
Pathway
reh00970  Aminoacyl-tRNA biosynthesis
reh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H16_A1882 (h16_A1882)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:reh03029]
    H16_A1882 (h16_A1882)
Enzymes [BR:reh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     H16_A1882 (h16_A1882)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     H16_A1882 (h16_A1882)
Mitochondrial biogenesis [BR:reh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    H16_A1882 (h16_A1882)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CAJ92983
UniProt: Q0KAI8
Position
1:2043340..2044767
Genome map
AA seq 475 aa AA seqDB search
MSEALCLASAAELQQRIRRKEISPVELTAAVLARAERLQPVLNCFITLCADEAMAAARAA
EAEVMSGRPLPPLHGIPFTAKDIVNTRGVRTTFGAVPMRDNVPAEDAVAVARLRAQGAIL
VGKTTTPEFGSKSLTDSPLFGRTRNAWHAERTSGGSSGGAAVAVASGMAPLAVATDGGGS
TRIPAACNGVVGIKQSQGVIPHSQAQDLFGNQTYVTPTTRTVADTGLMLQAMAGEHPCDP
WSIGVPAADYVAAAQPQGDLRGRCILYCLAPPGRPVSADVARAFEASLDKLRALGAELEP
FGGEGFDVEPVWRAINHTVWRTRFAPIVAQHREALSPTFVRQVESAAAFTAVEYQQAMFE
RSQLFLRVQALLGRADLLAMPTITRTALPLEQDLFGQIEIDGQDYPDVRANWFPWTMPFN
MTGHPAISLPCGFGGDGLPIGLQLVGQFRGDAQLLRVAALYESVHDLTGQWPTLP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcgctttgtcttgccagcgccgccgaactgcagcagcgcatccggcgcaag
gaaatctcgccggtggaactgaccgctgcggtgctggcgcgcgccgagcggctgcagccg
gtgctgaactgctttatcacgctgtgcgcggacgaggccatggccgcggcgcgcgcggcg
gaagcggaagtgatgtccggccggccgctgcctccgctgcacggcattccgtttaccgcc
aaggacatcgtcaacacgcgcggcgtgcgcacgacctttggcgccgtgccgatgcgcgac
aacgtgccggccgaagacgccgtggcggtggcgcggttgcgcgcgcagggcgcgatcctg
gtcggcaagaccaccacgccggaattcggctccaaaagcctgaccgattcgccgctgttc
gggcgcacccgcaatgcctggcacgccgagcgcaccagtggcggctccagcggcggcgcc
gcggtggcagtggccagcggcatggcgccgctggcggtggcgaccgatggcggcggctcc
acgcgcattcctgccgcctgcaatggcgtggtgggcatcaagcagagccagggggtgatt
ccgcacagccaggcgcaggacctgttcggcaaccagacctacgtgacgccgaccacgcgc
acggtggccgacaccggcctgatgctgcaggccatggccggcgaacacccgtgcgacccg
tggtcgatcggagtgcccgccgccgactacgtggccgcagcgcagccgcagggcgacctg
cgtggccggtgcatcctgtattgcctggcgccgccgggccgtccggtgtcggcggacgtg
gcgcgcgcgttcgaggccagcctggacaagctgcgcgcactgggcgccgaactggagccg
ttcggcggcgaggggttcgacgtcgagcccgtctggcgtgccatcaaccacaccgtatgg
cgcacgcgctttgcgccgatcgtggcccagcaccgcgaggcgctgagcccgaccttcgtg
cgccaggtggaatccgccgccgcattcaccgcagtggaataccagcaggcgatgttcgag
cgctcgcaactgttcctgcgcgtgcaggcgctgctgggacgcgccgacctgctcgccatg
cccaccatcacacgcaccgcgctgccgctggagcaagacctgttcggccagatcgaaatc
gacggccaggactatcccgatgtgcgcgcgaactggttcccgtggaccatgccgttcaat
atgactgggcatccggccatcagcctgccctgcggctttggtggcgacgggctgccgatc
gggctgcagctggtcgggcagttccgcggcgacgcgcagctgctgcgtgtggcggccttg
tacgaatcggtccatgacctcacgggccagtggcccaccctgccctga

DBGET integrated database retrieval system