KEGG   Cupriavidus necator H16: H16_A1884Help
Entry
H16_A1884         CDS       T00416                                 

Gene name
h16_A1884
Definition
(GenBank) Dehydrogenase, PQQ dependent
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H16_A1884 (h16_A1884)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     H16_A1884 (h16_A1884)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: CAJ92985
UniProt: Q0KAI6
Position
1:complement(2045805..2047811)
Genome map
AA seq 668 aa AA seqDB search
MRPPRLTAPLSVPASTARDWPSHGLDYAETRFSRLRQIDAANVRDLGLVWTYNLESTRGV
EATPLVVDGVMYVTASWSVVHAVDARTGKRLWTFDPKVDRSLGYRGCCDVVNRGVALYQG
KVFVAAYDGRLIALDAASGRKLWEKDTIIDRKYSYTITGAPRVFKGKVIIGNGGAEYGVR
GYITAYDAGTGEQKWRWFTVPGDPSKPFEDESMAAAAKTWDPSGKYWEAGGGGTAWDTLA
FDPELNLMYVGTGNGAPWSRSKRSPAGGDNLYLASIVALDPDTGKYVWHYQETPGDNWDY
TSTQPMILADLKLDGQMRKVILHAPKNGFFFVIDRTNGKFISAKNFVDVNWATGYDANGR
PIERPEARATDKPYDSVPGPYGAHNWHPMSFNPQTGLVYLPAQNVPINLMDDKAWNFNEG
KPGTPHGNVGWNTAKFLNAEPPKGKPFGRLIAWDPVQQKAAWTQEHVSPWNGGTLTTAGN
LVFQGTADGRFVAYDARSGDKLWESPTGTGVVAAPVSFELNGKQYVSVAVGWGGVYGQAQ
RATNRQGPGTVYTFALGGKAPLPAFAEYRTAKLLQGVKYDPAQVKAGTGLYVSNCVLCHG
VPGVDRGGNIPNLGYIDAAYIENLDKVVFKGPAMARGMPDFTGKLTPDDVEKIKAFIQGT
ADAVRPKP
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgccaaggttgacggcgcctttatcagtgcccgccagcaccgcccgcgactgg
cccagccacggcctggactatgccgagacccgcttcagccggctcaggcagatcgatgcc
gccaacgtgcgcgacctggggctggtgtggacctacaacctggagtcgacccgcggcgtg
gaggcaaccccgctggtggtggacggcgtgatgtacgtcaccgcgtcatggagcgtggtg
catgcggtcgatgcgcgcaccggcaagcggctctggaccttcgatcccaaggtggaccgc
tcgctcggctatcgcggctgctgcgacgtggtcaaccgcggcgtggcgctgtaccagggc
aaggtgttcgtggccgcctacgatggccggctgatcgcgctggatgccgccagcggccgc
aagctgtgggagaaagacaccatcatcgaccgcaagtactcgtacaccatcaccggcgcg
ccgcgcgtgttcaagggcaaggtcatcatcggcaacggcggcgccgaatatggcgtgcgc
ggctacatcaccgcctatgacgccggcaccggcgagcagaagtggcgctggttcacggtg
ccgggcgacccctccaagccgttcgaggatgagtcgatggctgcggcggccaagacctgg
gaccccagcggcaaatactgggaggcgggcggcggcggcacggcctgggacacgctggcc
ttcgaccccgagctgaacctgatgtacgtgggcaccggcaacggcgcgccatggtcgcgc
agcaagcgcagcccggccggcggcgacaacctctacctggcatcgatcgtcgcgctcgat
cccgacaccggcaaatacgtctggcactaccaggagaccccgggcgacaactgggactac
acctcgacccagccgatgatcctggccgacctgaagctcgatggccagatgcgcaaggtc
atcctgcacgcgcccaagaacggcttcttcttcgtcatcgaccgcaccaacggcaagttc
atctcggcaaagaactttgtcgacgtgaactgggccaccggctatgacgccaatggccgc
cccatcgagcggcccgaggcgcgcgccaccgacaagccttatgactcggtccccggtccg
tacggcgcgcacaactggcatccgatgtcgttcaacccgcagaccgggctggtctacctg
ccggcgcagaacgtgccgatcaacctgatggacgacaaggcctggaacttcaatgaaggc
aaacccggcacgccgcatggcaacgtgggctggaacaccgccaaattcctgaacgccgag
ccgcccaagggcaagcccttcggccggctgattgcgtgggacccggtgcagcagaaggcc
gcgtggacgcaggaacatgtgtcgccgtggaacggcggcacgctgaccacggccggcaac
ctggtgttccagggcaccgccgacggccgctttgtcgcctatgacgcgcgcagcggcgac
aagctgtgggagtcgcccaccggcaccggcgtggtggcggcgccggtcagcttcgagttg
aacggcaagcagtatgtgtcggtggcagtgggttggggcggggtctacgggcaggcccag
cgcgccaccaaccggcaggggccgggcacggtctacaccttcgccctcggtggcaaggca
ccgctgccggcctttgccgagtaccgcaccgccaagctgctgcagggcgtgaaatatgac
ccggcgcaggtcaaggcgggcaccggcctgtacgtcagcaactgcgtcctgtgccacggc
gttcccggcgtggaccgcggcggcaatatccccaacctgggctatatcgatgccgcctat
atcgagaacctggacaaggtggtcttcaaggggccggcgatggcgcgcggcatgcctgac
ttcacaggcaagctgacgccggacgatgtcgagaagatcaaggccttcatccaggggacc
gctgacgcggtgcggcccaagccctga

DBGET integrated database retrieval system