KEGG   Ralstonia eutropha H16: H16_A2217Help
Entry
H16_A2217         CDS       T00416                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00620  Pyruvate metabolism
reh00630  Glyoxylate and dicarboxylate metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01200  Carbon metabolism
Module
reh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H16_A2217 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    H16_A2217 (aceB)
Enzymes [BR:reh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     H16_A2217 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CAJ93314
UniProt: Q0K9K7
Position
1:complement(2408177..2409763)
Genome map
AA seq 528 aa AA seqDB search
MAITLPAGMKITGEILPAYEDILTPEALALVDKLHRAFEPRRQELLAARVERAKRLDAGE
IPDFLPETKSIREGDWKVAPIPQALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSN
TPNWHNQLQGQVNLKAAVRRTLTLESKGKQYKLNDKIATLQVRPRGWHLDEKHVTIDGKR
ISGGIFDFALFLFHNAREQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKNDKDFCLADRAKVTM
TAPFMRAYALLLLKTCHHRGAPAMGGMSALIPIKNDPEKNAIAMEGIISDKRRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFGKQRPDVQVKGADLLDFKPETPITEHGLRMNI
NVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKALVGGDTKTYDRAAEIFEQMSTSEDFAEFLTLPLYEEV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacgctgcccgcgggcatgaagattaccggcgagatcctgccggcctacgaa
gatatcctcacgccggaagccctggccctggtagacaagctgcaccgcgcctttgagccg
cgccgtcaggaactgctggccgcgcgcgtggaacgcgccaagcgcctggacgccggtgag
atccccgacttcctgccggaaaccaagagcatccgcgaaggcgactggaaggttgccccg
atcccccaggccctggaatgccgccgcgtggaaatcaccggcccggtcgaggccaagatg
gtcatcaacgccttcaactcgggcgctgacagctacatgaccgacttcgaggattccaac
acccccaactggcacaaccagctgcagggccaggtcaacctgaaggccgccgtgcgccgc
acgctgaccctggaatccaagggcaagcaatacaagctgaacgacaagatcgccaccctg
caagtgcgtccgcgcggctggcacctggacgagaagcacgtcaccatcgacggcaagcgc
atctcgggcggcatcttcgacttcgcgctgttcctgttccacaacgcccgcgagcagatc
gcccgcggcgccggcccgttcttctacctgcccaagatggaaagccatctggaagcgcgc
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggcctgccgcaaggcaccatc
aaggccaccgtgctgatcgaaacgatcctggcggcgttcgagatggacgaaatcctgtat
gaactgcgcgagcacagcgctggcctgaacgccggccgctgggactacatcttctcgtgc
atcaagaagttcaagaacgacaaggacttctgcctggccgaccgcgccaaggtcacgatg
accgcgccgttcatgcgtgcctacgcgctgctgctgctcaagacctgccaccaccgcggc
gctcccgccatgggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggaaggcatcatcagcgacaagcgccgcgatgccaccgacggctacgac
ggcggctgggttgcccacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgacaagcccaaccagttcggcaagcaacgccccgacgtgcaagtgaagggcgcc
gacctgctcgacttcaagccggaaacgccgatcaccgagcatggcctgcgcatgaacatc
aacgtcggcatccactacctgggcgcctggctggatggcaacggctgcgtgccgatccac
aacctgatggaagatgctgctactgccgagatctcgcgctcgcaggtgtggcagtggatc
cgctcgccgaagggcaagctggaagacggcaccaaggtgacggccgagctggtgcgcaag
ctgattccggaagagctggcgaaggtgaaggcactggtgggtggcgataccaagacctat
gaccgggctgccgagatttttgagcagatgtctacgtcggaggattttgctgagtttctg
acgctgccgctgtatgaggaagtttaa

DBGET integrated database retrieval system