KEGG   Ralstonia eutropha H16: H16_A2614Help
Entry
H16_A2614         CDS       T00416                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00260  Glycine, serine and threonine metabolism
reh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01130  Biosynthesis of antibiotics
reh01230  Biosynthesis of amino acids
Module
reh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H16_A2614 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H16_A2614 (trpB)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     H16_A2614 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAJ93696
UniProt: Q0K8H5
Position
1:complement(2821007..2822200)
Genome map
AA seq 397 aa AA seqDB search
MYDLPDSRGHFGPYGGTFVSETLVHALDELREAYAHYQKDPEFDAEYRRELKHFVGRPSP
IYHAQRWSETLGGAQIYFKREDLNHTGAHKINNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGAEDVKRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQCVIGEEAKVQMPEMTGRQPDAVIACVGGGSNA
MGIFYPYIEHQDVQLIGVEAAGDGLDTGRHAASLTGGTPGVLHGNRTYLLQDANGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
ACKLAPTLPKDKLLLVNLSGRGDKDMHTVAERAGLKL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacttgcccgattcccgtggccatttcggcccctatggcggcaccttcgtgtcc
gaaacgctggtccacgcgctcgatgagctgcgcgaggcctatgcgcactaccagaaggat
ccggagttcgatgccgaataccgccgcgaactgaagcactttgtcggccgcccgtcgccg
atctaccacgcgcagcgctggagcgagacgctcggtggcgcgcagatctacttcaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctg
gccaagcgcatgggcaagccgcgcgtgatcgccgagaccggggcagggcagcacggcgtg
gccaccgccaccattgccgcgcgcttcggcatggagtgcgtggtctacatgggggccgag
gacgtcaagcgccaggccgccaacgtctaccgcatgaagctgctgggcgccaccgtggtg
ccggtggaaagcggctcgcgcacgctcaaggacgcgctcaatgaagccatgcgcgactgg
gtcaccaacgtcgagaacaccttctacatcatcggcaccgtggccggcccgcatccgtac
ccgatgatggtgcgcgacttccagtgcgtgatcggcgaggaagccaaggtgcagatgccg
gagatgacgggccgccagccggatgccgtgatcgcctgcgtcggcggcggctccaatgcc
atgggcatcttctacccgtatatcgagcaccaggacgtgcagctgatcggtgtggaagcc
gccggcgacggcctcgacaccggccgccacgcggcctcgctgaccggcggcacgccgggc
gtgctgcacggcaaccgcacctacctgctgcaggacgccaacggccagatcatcgagacc
cattcggtgtcggccggcctggactacccgggcgtgggccccgagcatgcgtggctcaag
gacagcggtcgcgcgcagtacgtgccgatcacggatgaagaagcgctcaaggccttccac
gactgctgccgcatcgagggcatcatcccggcgctggaatcgagccacgccatcgcctat
gcctgcaagctggcgccgacgctgcccaaggacaagctgctgctggtgaacctgtccggc
cgcggcgacaaggacatgcacaccgtggccgagcgcgcggggctcaagctctga

DBGET integrated database retrieval system