KEGG   Cupriavidus necator H16: H16_A2731Help
Entry
H16_A2731         CDS       T00416                                 

Gene name
h16_A2731
Definition
(GenBank) uncharacterized conserved protein
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
reh  Cupriavidus necator H16
Pathway
reh00790  Folate biosynthesis
reh01100  Metabolic pathways
Module
reh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H16_A2731 (h16_A2731)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H16_A2731 (h16_A2731)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1
Motif
Other DBs
NCBI-ProteinID: CAJ93810
UniProt: Q0K861
Position
1:complement(2949631..2950434)
Genome map
AA seq 267 aa AA seqDB search
MNDINPAFVMPDVQSSPDTRQIPIQRVGVKGVRYPVTLKTPAGIMPSVGTFNLDVHLPAD
QKGTHMSRFVALLEEERAPLELSSFRLMLDKMLEKLEAEAGRIEVTFPYFISKTAPVSGV
ESLLDYEVTLTGEVRDGAARVFLKALVPVTSLCPCSKKISQYGAHNQRSHITMNVELAGE
LPVEALVRMAEEEASCELWGLLKRPDEKFVTERAYENPKFVEDLVRDIAMRLNADDRIVA
YVLEAENFESIHNHSAYAVIERDKRVD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacatcaatcccgccttcgtcatgcccgacgtccagtcgagccccgacacccgc
cagatccccatccagcgtgtcggtgtcaaaggcgtgcgttaccccgtgaccctgaagacc
ccggccggcatcatgccgagcgtgggcaccttcaatctcgacgtgcacctgccggcggac
cagaagggcacgcatatgtcgcgcttcgtcgcgctgctggaagaagagcgcgcaccgctg
gagctgtccagcttccggctgatgctggacaagatgctggaaaagctggaagccgaggcc
ggccgcatcgaggtcaccttcccgtacttcatcagcaagaccgcgcctgtgtcgggcgtg
gagtcgctgctggactacgaggtcacgctgaccggcgaagtgcgcgacggcgccgcgcgc
gtgttcctgaaggcgctggtgccggtgaccagcctgtgcccgtgctcgaagaagatctcg
cagtacggcgcgcacaaccagcgttcgcatatcaccatgaacgtggaactggccggcgag
ctgccggtggaagcgctggtgcgcatggccgaggaagaggcctcgtgcgagctgtggggc
ctgctcaagcgccccgacgagaagttcgtcaccgagcgcgcctatgagaaccccaagttc
gtcgaggacctggtgcgcgatatcgccatgcgcctgaatgcggatgatcgcatcgtggcc
tatgtgctggaggcggagaactttgagtcgatccacaaccacagcgcgtatgcggtgatc
gagcgggacaagcgggtcgactga

DBGET integrated database retrieval system