KEGG   Cupriavidus necator H16: H16_A3371
Entry
H16_A3371         CDS       T00416                                 

Gene name
coxL5
Definition
(GenBank) Aerobic-type carbon monoxide dehydrogenase homolog, large subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
reh  Cupriavidus necator H16
Pathway
reh00230  Purine metabolism
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    H16_A3371 (coxL5)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     H16_A3371 (coxL5)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Cadherin_5
Other DBs
NCBI-ProteinID: CAJ94440
UniProt: Q0K6D1
Position
1:3651369..3653660
AA seq 763 aa
MMTHAVIGHSVKRTDLLDKVTGNARYVADMPFPGLLFGKMKRCNLAHAKIHRIDTSRALA
LPGVKAVLTHENVPRVLHAGSPHPRSASVTCDQYILDDKVRYWGEGVAAVAAISEEIAER
AVELIEVEYETLPAVFTTEDAERSDAPRIHDREPGGNLVLPPVIIKRGDVEAGFAEADFI
LEGIYEGGRPTPAYMEPNVCTTSWDGNGNLTVWISTQTAFMVRGIMAEVLGLPLHKVRVL
VDHMGGGFGAKQDLFQQEFLCALLARETRRPVRMEYTREETFLGGRTRHPAKIWLKQGFR
NDGTITARQAKVVFNSGAYGSHGPGVTNVGTAAMVSLYRCDNVLLEGRCVYTNSPIAGAF
RGYGVVQTYYALDVQMDEAAEHLGLDPAGLKLKNAVREGDIAPSNHPLIGHGLEACIEKG
MELVDWPALRRRPRDTNGPIRTGWGLGCEMHGSSAYPGIKEQGNAIIKMNEDGTVVLLTG
AAGLGTGAHTALAQIVAEELTLPFEAVAVVHGDTDVVPWDIGAFASHTTYMVGKAAQMAA
GEIKRQLFDRAAKLMECEPEALTLTAGVIAVRDRDGPTLTVREAVMPRKGIPAAQLVGTA
TYHPTKSYSFAAHFVEVAVDTETGFITVQQVLPVHDVGKVIHPVAAAGQIEGGIQQGIGH
TLYEDYQIDMRTGRSLNANFVDYKMPLAMDMPPIHTVILEAAPDPGGPFGAKGVGEDPIV
AIGPAIANAVFDAIGVRFRHYPIKPEQVLQALAEKAAKEGATP
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgatgacccacgccgtgatcggacacagcgtcaagcgcaccgacctgctcgacaaggtc
accggcaacgccagatacgttgccgacatgcccttccccggcctgctgttcggcaagatg
aagcgctgcaacctcgcgcacgcgaaaatccaccgcatcgacacctcgcgtgcgctggca
ttgccaggcgtcaaagccgtgctgacccatgagaacgtgccgcgcgtgctgcacgccggc
tcgccccacccgcgctccgcctcggtgacctgcgaccagtacatcctggacgacaaggtg
cgctactggggcgaaggcgtcgccgcggtggccgccatcagcgaagagatcgccgagcgc
gcggtcgagctgatcgaagtcgagtacgaaacgctgcccgccgtcttcaccaccgaggac
gccgagcgctccgacgccccgcgcatccacgaccgcgaacccggcggcaacctggtgctg
ccgccggtgatcatcaagcgcggcgacgtcgaagcgggctttgccgaggcggacttcatc
ctcgaaggcatctacgaaggcggccgccccacccccgcctacatggagcccaacgtctgc
accaccagctgggacggcaacggcaacctgacggtgtggatctccacccagaccgccttc
atggtgcgcggcatcatggccgaggtgctgggcctgccgctgcacaaggtgcgcgtgctg
gtcgaccacatgggcggcggcttcggcgccaagcaggacctattccagcaggagttcctg
tgcgcgctgctggcgcgcgagacgcgccgcccggtgcgcatggaatacacgcgcgaggaa
accttcctcggcgggcgcacgcgccatccggcgaagatctggctcaagcaaggcttccgc
aacgacggcaccatcaccgcgcgccaggccaaagtggtgttcaactccggcgcctatggc
tcgcatggcccgggtgtgaccaatgtcggcaccgccgccatggtctcgctgtaccgctgc
gacaacgtgttgctcgaaggccgctgcgtctacaccaacagccccatcgccggcgccttc
cgcggctatggcgtggtccagacctattacgcgctcgacgtgcagatggacgaggccgcc
gagcacctgggcctggaccccgccgggctgaagctgaagaacgccgtgcgcgaaggcgac
attgcgccgtccaaccatccgctgatcgggcacggcctggaggcctgcatcgagaaaggc
atggaactggtcgactggcccgcgctgcgccggcgcccgcgcgacaccaacggcccgatc
cgcaccggctggggcctgggctgcgaaatgcacggcagcagcgcctatcccggcatcaag
gagcagggcaacgccatcatcaagatgaacgaggatggcaccgtggtgctgctgaccggc
gcggccgggctgggtaccggtgcgcataccgccctcgcccagatcgttgcagaagaactg
accctgccgttcgaagcggtggcggtcgtgcacggcgataccgacgtggtgccctgggac
atcggcgcctttgccagccacaccacctatatggtgggcaaggccgcgcagatggcggcg
ggcgagatcaagcgccagctgttcgatcgcgcggccaagctgatggaatgcgagcccgag
gccctgacactgaccgccggcgtgatcgccgtgcgcgaccgcgacggcccgaccctgacc
gtgcgcgaggccgtgatgccgcgcaagggcatccccgccgcgcagctggtgggcaccgcc
acctatcacccgaccaagtcgtattcattcgccgcgcattttgtcgaggtggcggtcgat
accgaaaccggcttcatcaccgtgcagcaggtgttgcctgtgcatgacgtcggcaaggtg
atccacccggtggctgccgcagggcagatcgaaggcggcatccagcaaggcatcggccat
acgctgtatgaggactaccagatcgatatgcgcaccgggcgctcgctcaacgccaacttc
gtcgactacaagatgccgctggcgatggacatgccacccatccacacggtgatcctggaa
gcggcccccgaccccggcggcccgttcggcgccaagggggtgggcgaggacccgatcgtc
gcgatcgggccggcgattgccaatgcggtgttcgatgccatcggcgtgcgcttccggcac
tacccgatcaagccggagcaagtgctgcaggcactggctgagaaggcagcgaaggaaggc
gccaccccatga

DBGET integrated database retrieval system