KEGG   Ralstonia eutropha H16: H16_A3416Help
Entry
H16_A3416         CDS       T00416                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00340  Histidine metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    H16_A3416 (hisD)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     H16_A3416 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: CAJ94484
UniProt: Q0K687
Position
1:complement(3691387..3692727)
Genome map
AA seq 446 aa AA seqDB search
MNATEMENLPIRRLDSSKPGFAEALRQVLAFEAGEDEAIDRAAAQILADVKARGDAAVLE
YTRRFDRVEASSMGALEVSQQQLEAALEDLEPKRRAALEAAAARVRAYHEKQKIECGSHS
WEYTEADGTMLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEIIMVVPTPGG
VRNELVLAAAQIAGVDRVFTIGGAQAIGALAYGTATLPQVDKIVGPGNAYVAAAKRRVFG
TVGIDMIAGPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDAGYIARVEASIQ
RQLGTMPRREVIAASISGRGALIKVRDMEEACEIANAIAPEHLEISAENPRQWSEKIRHA
GAIFLGPYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIEVSEGGAQMLGQ
IAAELAYGEGLQAHARSAEYRFTKRS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaccgaaatggaaaacctgccgatccgccggctcgattccagcaagcctggc
tttgccgaggcgctgcgccaggtgctggccttcgaggctggcgaggacgaggccatcgat
cgcgccgccgcgcagatcctggctgatgtgaaggcgcgcggggatgccgcggtgctggaa
tacaccaggcgcttcgaccgcgtggaagcgtcgtcgatgggcgcgctggaggtatcgcag
cagcagctcgaagccgcgctcgaagacctcgaacccaagcgccgcgccgcgctggaggcc
gccgccgcgcgcgtgcgcgcctaccacgagaagcagaagatcgaatgcggcagccacagc
tgggaatacaccgaggccgacggcaccatgctgggccagaaggtgacgccgctggaccgc
gtcggcatctacgtgccgggcggcaaggccgcgtatccgtcgtcggtgctgatgaacgcg
atcccggcgcgcgtggcgggcgtgaaggaaatcatcatggtcgtgcccacgccgggcggc
gtgcgcaatgagctggtgctggccgccgcgcagatcgccggcgtcgaccgcgtgttcacc
atcggcggcgcccaggcgattggcgcgctggcctacggcacggcgacgctgccgcaggtc
gacaagatcgtcggcccgggcaatgcctatgtggccgcggccaagcggcgcgtgttcggc
accgtcggcatcgacatgattgccggcccgtccgagatcctggtgatctgcgacggcacc
accgaccccgactgggtggcgatggacctgttctcgcaggccgagcacgacgaactggcg
cagtcgatcctgctgtgcccggacgccggctatatcgcccgcgtcgaagccagcatccag
cgccagcttggcaccatgccgcggcgcgaggtgattgccgcctcgatctccggccgtggc
gcgctgatcaaggtgcgcgacatggaagaggcctgcgagatcgccaacgcgatcgcgccc
gagcacctggagatctcggccgagaacccgcgccagtggagcgaaaagatccgccacgcc
ggcgccatcttcctgggcccctataccagcgagtcgctcggcgattactgcgcgggcccg
aaccacgtgctgccgacctcgcgcaccgcgcgcttctcttcgccgctgggcgtctatgac
ttccagaagcgttcgagcctgatcgaagtgagcgagggcggggcgcagatgctcggccag
atcgccgccgagctggcctatggcgaaggcctgcaggcccacgcccgcagcgcggaatat
cgtttcaccaaacgcagttga

DBGET integrated database retrieval system