KEGG   Cupriavidus necator H16: H16_A3479Help
Entry
H16_A3479         CDS       T00416                                 

Gene name
rplV
Definition
(GenBank) LSU ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
reh  Cupriavidus necator H16
Pathway
reh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:reh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    H16_A3479 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:reh03011]
    H16_A3479 (rplV)
Ribosome [BR:reh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    H16_A3479 (rplV)
  Bacteria
    H16_A3479 (rplV)
  Archaea
    H16_A3479 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: CAJ94547
UniProt: Q0K624
Position
1:complement(3749873..3750202)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAGIVKKVVESAIANAEH
NEGADIDELKVKSIFVDKATSLKRFTARAKGRGNRIEKQTCHITVTLGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcgattcatcgcggtgcccgcatctccgcccagaagacgcgcctggtc
gctgaccagatccgtggtctgccgatcgagcgcgcgctcaatgtcctgacgttcagcccg
aaaaaggctgccgggatcgtgaagaaggtggtcgaatcggccatcgccaacgctgagcac
aacgaaggcgccgacatcgacgaactgaaggtcaaatcgatcttcgtcgacaaggcaacc
tcgctcaagcgcttcaccgcacgggcgaagggccgcggcaaccgcatcgagaaacaaacc
tgtcacatcactgtgacgctcggcaactaa

DBGET integrated database retrieval system