KEGG   Cupriavidus necator H16: H16_A3505Help
Entry
H16_A3505         CDS       T00416                                 

Gene name
tufB
Definition
(GenBank) translation elongation factor EF-TU (GTPase)
  KO
K02358  elongation factor Tu
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:reh03012]
    H16_A3505 (tufB)
   03029 Mitochondrial biogenesis [BR:reh03029]
    H16_A3505 (tufB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:reh04147]
    H16_A3505 (tufB)
Translation factors [BR:reh03012]
 Eukaryotic Type
  Elongation factors
   H16_A3505 (tufB)
 Prokaryotic Type
   H16_A3505 (tufB)
Mitochondrial biogenesis [BR:reh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    H16_A3505 (tufB)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   H16_A3505 (tufB)
  Exosomal proteins of breast cancer cells
   H16_A3505 (tufB)
  Exosomal proteins of colorectal cancer cells
   H16_A3505 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: CAJ94572
UniProt: Q0K5Z9
Position
1:complement(3778701..3779891)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLAAKFGGAAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGELGEVAIMNLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccatggcaagaccacgctgaccgcagcgattgccacggtgctggcagccaagttc
ggcggtgccgccaagaagtacgacgaaatcgacgcagcgccggaagaaaaggcacgcggt
attaccatcaataccgcccacgtcgagtacgaaacggccaaccgccactacgcgcacgtt
gactgcccgggccacgctgactatgtgaagaacatgatcacgggtgccgcccagatggac
ggcgcgatcctggtttgctcggctgctgacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcccgccaggttggcgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgagctgctgtcgaag
tacgagttccccggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgagctgggcgaagtggccatcatgaacctggccgacgcgctggacacc
tacatcccgacgccggagcgtgccgttgacggtaccttcctgatgcctgtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcgtagtgaag
gtcggtgaggaaatcgaaatcgtcggtatcaagccgacggtgaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccagggtcaagccggcgacaacgttggcctgctg
ctgcgcggcaccaagcgtgaagacgtcgagcgcggccaggtgctgtgcaagccgggttcg
atcaagccgcacacccacttcaccggcgaggtgtacatcctgtcgaaggacgaaggcggc
cgtcacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccaccgatgtg
accggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggtgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtggcaaagatcctcgactaa

DBGET integrated database retrieval system