KEGG   Cupriavidus necator H16: H16_A3647
Entry
H16_A3647         CDS       T00416                                 

Gene name
gidB
Definition
(GenBank) S-Adenosylmethionine-dependent methyltransferase involved in bacterial cell division
  KO
K03501  16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170]
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:reh03009]
    H16_A3647 (gidB)
   03036 Chromosome and associated proteins [BR:reh03036]
    H16_A3647 (gidB)
Enzymes [BR:reh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.170  16S rRNA (guanine527-N7)-methyltransferase
     H16_A3647 (gidB)
Ribosome biogenesis [BR:reh03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    H16_A3647 (gidB)
Chromosome and associated proteins [BR:reh03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    H16_A3647 (gidB)
SSDB
Motif
Pfam: GidB Methyltransf_31 MTS Methyltransf_25 Methyltransf_16 Methyltransf_23 Methyltransf_4
Other DBs
NCBI-ProteinID: CAJ94704
UniProt: Q0K5L7
Position
1:complement(3925355..3926056)
AA seq 233 aa
MTDDATQRRRLEAGLAQIGLALAPAQIDTLFAYLALLRKWNGVYNLTAIRHPDEMLTHHM
LDSLAAVPALAEAARAAEVGTPARGRVLDVGSGGGMPGLPLAIACPDVSVLMVDIVQKKT
AFLTQCRAQLGLSNAAAHWGPVEKLDDASGFAVITSRAFAELTDFVNLSGQLLAPHGKLI
AMKGVYPQAELDRMEAAGLMAQWQVDAVPRITVPGLDAERHLVVLSRRASAHA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaccgacgacgccacgcagcgccgtcgccttgaagccggtctggcccagatcggactg
gcgctggcgccggcccagatcgacaccttgtttgcctacctggcgctgctgcgtaaatgg
aacggcgtctacaacctgaccgcaatccgccaccccgatgagatgcttacgcatcacatg
ctggactcgctcgccgccgtgccggcactggccgaagccgcgcgtgccgcagaggtaggc
acgccggcgcggggcagggtattggacgtgggctcgggcggcggcatgcccggcctgccg
ctggccatcgcctgtcccgacgtgtcggtgctgatggtggacatcgtgcagaagaagacc
gccttcctgacccagtgccgtgcgcaactcgggctctccaatgccgcggcgcattggggg
ccggtggagaagctcgacgatgccagcggctttgccgtgatcacctcgcgcgcgtttgcg
gaactgactgatttcgtgaacctgtcgggccagctccttgcaccgcacggcaagctgatc
gccatgaagggggtttatccacaggccgagctggaccgcatggaagctgccgggctgatg
gcgcaatggcaggtcgatgcggttccccgcatcaccgtgcccgggctggatgccgagcgc
cacctggtggtgctgtcgcggcgcgcaagcgcccacgcatga

DBGET integrated database retrieval system