KEGG   Cupriavidus necator H16: H16_B0319Help
Entry
H16_B0319         CDS       T00416                                 

Gene name
pdxA3
Definition
(GenBank) 4-Hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H16_B0319 (pdxA3)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     H16_B0319 (pdxA3)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     H16_B0319 (pdxA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Spore_YtrH
Motif
Other DBs
NCBI-ProteinID: CAJ95119
UniProt: Q0K4F5
Position
2:356964..357965
Genome map
AA seq 333 aa AA seqDB search
MSDYLPVIGITMGDATGIGPEVIVKSLAHDSVRAQCRPLVIGDVRRLEVAGRLVGSPLKL
RAIQAPEEARFQSGTIDCIDLGLIPEGLPFGKLSAVAGDAAFRYIERAVALTRDEKIDAI
CTAPLNKEALHAGGHKFPGHTEMLAYLTGTPEVSMMLVAPKLRVIHVTTHIGLLDAIRKI
EPGLVQRTIERGHQTLQRAGIAAPRIGVCGINPHAGENGLFGHGEEEEKIIPAVEALRAR
GRDVEGPLPADTLFYRAGRGDFDLVVAMYHDQGHGPVKVLGLEAGVNITVGLPVIRTSVD
HGTAFDIAGKGIADERSLLEALRQGAELATRRA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactacctccccgtcatcggtatcaccatgggcgatgccacaggcatcggcccc
gaagtcatcgtcaagagcctcgcgcatgacagcgttcgtgcgcaatgccgcccgctcgtc
atcggcgacgtgcgccggctggaagtggccggccggctcgtcggctccccgctcaagctg
cgcgccatccaggccccggaggaagcgcgcttccagtccggcaccatcgactgcatcgac
ctgggcctgatcccggaaggcctgcccttcggcaagctgtccgccgtcgccggtgatgcc
gccttccgctacatcgagcgcgcggtggcgctcacccgcgacgagaagatcgatgcgatc
tgcacagcgccgctgaacaaggaagccctgcacgcggggggtcacaagtttcccggccac
acggaaatgctggcgtacctgaccggcaccccggaggtgtcgatgatgctggtggcgccg
aagctgcgcgtgatccacgtcaccacgcacatcggcctgctcgacgccatccgcaagatc
gagccggggctggtccagcgcaccattgagcgcggccatcagacgctgcagcgcgctggc
attgcagcgccgcgtatcggcgtgtgcggcatcaatccgcacgccggcgagaacggcctg
ttcggccacggcgaggaggaggaaaaaatcatcccggcggtcgaggccttgcgcgcgcgc
ggccgggacgtggaaggtccgctgcccgccgacacgctgttctatcgcgccggccgcggc
gacttcgatctggtggtggcgatgtaccacgaccagggccacgggccggtcaaggtgctc
ggcctggaggccggcgtcaacatcacggtgggcctgccggtcatccgcacgtcggttgat
cacggcaccgccttcgacatcgccggcaaggggatcgccgacgaacgcagcctgctggag
gcgctgcgccagggcgctgagctggccacgcgccgcgcctga

DBGET integrated database retrieval system