KEGG   Cupriavidus necator H16: H16_B0875Help
Entry
H16_B0875         CDS       T00416                                 

Gene name
h16_B0875
Definition
(GenBank) maleylpyruvate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
reh  Cupriavidus necator H16
Pathway
reh00350  Tyrosine metabolism
reh00643  Styrene degradation
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    H16_B0875 (h16_B0875)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    H16_B0875 (h16_B0875)
Enzymes [BR:reh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     H16_B0875 (h16_B0875)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_5 Phage_GPL
Motif
Other DBs
NCBI-ProteinID: CAJ95667
UniProt: Q0K2V7
Position
2:992254..992895
Genome map
AA seq 213 aa AA seqDB search
MQLYSFFNSSTSYRVRIALALKGLPYDYLPVNIRTGQHREPEYVGSINPSATVPALVDGS
FALGQSFAIIDYLDALQPVPRLLPQDPVQRARVLELATLIGCDIHPVNNLRVLRYLQDVL
KVTPEQKDAWYRHWIDEGMAGVERLLAQHGHGRWCFGDAPTLADVTLVPQVANALRMGCD
LSRYQRAMAVYAHASVHPAFAQAAPAHQPDYTA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctatagtttcttcaacagctccacgtcctaccgggtgcgcatcgcgctggcc
ctcaagggcctgccgtacgactacctgccggtcaatatccgcaccggccagcaccgcgag
ccggaatatgtcggaagcatcaacccgtccgcgaccgtgcccgcgctggtggatggcagt
tttgcgctcggacagtcgttcgcgatcatcgactacctggacgcgctccagccggtgccg
cgcctgctgccgcaagacccggtgcagcgcgcgcgggtgctggaactggccacgctgatc
ggctgcgacatccacccggtcaacaacctgcgcgtgctgcgctacctgcaggacgtgctg
aaggtcacgcccgagcagaaggatgcctggtaccgccactggatcgatgaaggcatggcc
ggcgtggagcgcctgctggcgcagcacgggcatggcaggtggtgcttcggcgatgcgccg
acgctcgctgacgtcacgctggtgccgcaagttgccaacgccctgcgcatgggctgcgac
ctgagccggtaccagcgcgcgatggcggtctacgcacacgccagcgtccatcccgccttt
gcccaggccgcgccagcgcaccagcccgactacaccgcctga

DBGET integrated database retrieval system