KEGG   Ralstonia eutropha H16: H16_B1967Help
Entry
H16_B1967         CDS       T00416                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00790  Folate biosynthesis
reh01100  Metabolic pathways
Module
reh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H16_B1967 (folE)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H16_B1967 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF4175
Motif
Other DBs
NCBI-ProteinID: CAJ96749
UniProt: Q0JZS5
Position
2:2221620..2222369
Genome map
AA seq 249 aa AA seqDB search
MTSKDAAHRAKDSNAGDDAGHPHAPSVSARIRARLEAAQERFHANDNISHHIEPGEMEQL
QAEVQARLEDVLRALVIDVDNDHNTQETARRVAKMYLKEIFAGRYAKAPPVTEFPNVGQL
NELMIVGPLRVRSACSHHLCPIIGKLWVGVMPNQHSNLIGLSKYARLAEWIMCRPQIQEE
AVAQVADLLQEKMNPDGLAIVMEAEHFCMHWRGVRDTDAKMTNSVMRGSFLKDDSLRREF
LTLLNHNRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaaggacgcggcgcaccgcgcgaaggacagcaacgccggcgacgatgccggc
cacccccacgcccccagcgtctccgcccgcatccgcgcacggctcgaggccgcgcaggag
cgcttccacgccaacgacaatatttcgcaccacatcgagccgggcgagatggagcagctt
caggccgaagtgcaggcgcgcctggaggacgtgctgcgcgcgctggtgatcgacgtcgac
aacgaccacaacacccaggaaaccgcgcgccgggtcgccaagatgtacctgaaggagatc
ttcgccggccgctacgccaaggcgccgccggtgaccgagttccccaacgtcggccagctc
aacgaactgatgatcgtcggcccgctgcgcgtgcgcagtgcctgctcgcatcacctgtgc
ccgatcatcggcaagctgtgggtaggggtgatgccgaaccagcattccaacctgatcggc
ctgtccaagtacgcgcggctagccgaatggatcatgtgccggccgcagatccaggaagag
gcggtggcacaggtcgccgacctgctgcaggaaaagatgaatcccgacggcctggccatc
gtgatggaagccgagcacttctgcatgcactggcgcggcgtgcgcgacaccgatgccaag
atgaccaacagcgtgatgcgcggctcgttcctgaaggacgacagcctgcgccgcgagttc
ctcacgctgctgaaccacaaccgcggctag

DBGET integrated database retrieval system