KEGG   Cupriavidus necator H16: H16_B2311
Entry
H16_B2311         CDS       T00416                                 

Gene name
rtxD1
Definition
(GenBank) RTX toxin membrane fusion protein
  KO
K11003  hemolysin D
Organism
reh  Cupriavidus necator H16
Pathway
reh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:reh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H16_B2311 (rtxD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:reh02000]
    H16_B2311 (rtxD1)
   02044 Secretion system [BR:reh02044]
    H16_B2311 (rtxD1)
Transporters [BR:reh02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   H16_B2311 (rtxD1)
Secretion system [BR:reh02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   H16_B2311 (rtxD1)
SSDB
Motif
Pfam: HlyD_3 Biotin_lipoyl_2 HlyD_D23 Biotin_lipoyl HlyD QRPTase_N PTS_EIIA_1 Spc7
Other DBs
NCBI-ProteinID: CAJ97093
UniProt: Q0JYT1
Position
2:complement(2613152..2614489)
AA seq 445 aa
MSEPMKPDQQAAADAFATAAMGIANRRPARMARIVAGSICGMAVLALVYATMAKMDVVVS
AQGKVIPSGKSKVVQPLEAGIVREIHVRDGEKVKAGDILVELDPTTTAADRDRLQRDQWE
AVAGVRRLTALLDGKPTMQAVEGLPADIARTQQALLTSALAEQRARLAALDAEIARKRAD
REGAAASLEQIRASLPLVSKKNDMREELVKTGHIAETGLIETRLELINLRKELALQTNRL
AEAGAGLNAAQQQRAQAVAEFSARHAAELAEESRKSATAELELVKATMRRDLQTLRAPID
GIVQQLAVTTVGGVVTQAQPVAIVVPENTALEVDAQVQNKDIGYVKRGQRVITKVETFDF
TRFGYIEGEVQWVGTDAINDQKLGPIYPVRIKLDTMATPNSVNGRKGTLTPGMSVTADIR
VDQRRMISYFLSPLMRYKDEALRER
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtctgagccgatgaagcctgaccagcaagcggcagccgatgcctttgccacggccgcc
atgggcatcgccaaccgccgtcccgcgcgcatggcacggatcgtcgctggcagtatctgc
ggtatggccgtccttgcgctggtctacgccacgatggcgaaaatggacgtggtggtctcc
gcgcagggaaaagtcattccctcgggcaagtccaaggtggtgcagccgctcgaagccggc
atcgtacgcgagatccatgtgcgcgacggtgagaaggtcaaggctggcgacatcctggtc
gaactcgacccgaccaccactgcagcagaccgtgaccggctgcagcgcgatcaatgggag
gccgtagccggggtgcgacggctgactgcgcttctcgacggcaagcccaccatgcaggcc
gtcgaaggcttgcctgcggatatcgcccggacgcagcaggcgctgctcaccagcgcgctg
gccgaacaacgcgccaggctggcggcgctcgacgctgaaattgcccgcaagcgtgccgac
cgggaaggggccgctgccagtctggagcagatccgcgccagcctgccgcttgtcagcaag
aagaacgacatgcgcgaggaactcgtcaagaccgggcatatcgccgaaaccggcctgatc
gagacgcggctggagctgatcaacctcaggaaggaactggctctgcagaccaaccggctg
gccgaagctggcgcgggcctcaacgccgcgcagcagcagcgcgcacaggcggtggcagag
ttcagcgcacggcatgcggcagagctggccgaggaaagccgcaagtctgccacggccgag
ctggagctggtcaaggcaacgatgcggcgtgacctgcagacgctgcgcgcaccgatcgac
ggcatcgtccagcaactggcggtgactaccgttggcggcgtggtgacccaggcgcagccg
gtggcgatcgtggtgcccgagaacactgcactggaagtggatgctcaggtgcagaacaag
gacatcggctacgtgaagcgcggccagcgggtcattaccaaggtggaaacctttgacttc
acccgcttcggatatatcgagggcgaagtgcagtgggtgggtaccgacgccatcaatgat
cagaagcttggccccatctatcctgtgcgcatcaagctcgacacgatggccacgccgaac
tcagtcaatgggcgcaaggggacgttgaccccggggatgagcgtgaccgcggatatccgc
gtggaccaacgccgcatgatttcctacttcctgtcgccgctgatgcgctacaaggatgaa
gccttgcgggagcggtga

DBGET integrated database retrieval system