KEGG   Cupriavidus necator H16: H16_B2418
Entry
H16_B2418         CDS       T00416                                 

Gene name
h16_B2418
Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_B2418 (h16_B2418)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_B2418 (h16_B2418)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: CAJ97200
UniProt: Q0JYH4
Position
2:complement(2731111..2732439)
AA seq 442 aa
MSERALPVDRVEWHEGMLLAPQHLQLLAGRLDSLVAWQTLAAAPFGWGVRRLEFDAGLLP
AGVVRVLQLEAIMPDGTAVSYARDDARQPPLELALEPFADALAGGMLALYLTLPVAAANR
KDGQVRRFRSVAGAPVEDEVSEAPPADIPRLLPSLALDAGARPSPLHVSLCLGAVYKDNE
IVRLGDRLPPLLEVARGSALWTAVASLVAQLRGKAAFVAKQTAIPSSRADDRLTQLELKD
RLRSLVTALPLLEAVLRTPHLHPLALYLALASVLGSLSLLKPGGLPPVPDDYEHADPMAV
FTPLLRALRETLAEVSEEYREHKFEFRHGAFDIVLQPDWIGERLVVGLRGQSERDLLAWM
SGAVVGSQSVYPSLRTRRVLGAVRRVVEHAEDLGVRSGSGYLLFEIEADPALVHANEAMV
IGNPNEGASVQRPQEMLLFVKG
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgtctgagcgcgcgctgccggtcgatcgggttgaatggcatgagggcatgctgctggcg
ccccagcatctccagctgctggccgggcggctcgattcgctggtggcgtggcagacactc
gcggccgcaccgtttggctggggcgtgcgccggctggagttcgacgccgggctgctgccg
gcgggcgtggtgcgcgtgctgcagctcgaagccatcatgccggacggcactgccgtgtcc
tacgcgcgcgacgatgcccgccagccgccgctggagctggcgctcgagccgtttgccgac
gcgcttgccggcggcatgctggcgctttacctgaccctgccggtggcggccgcaaaccgc
aaggacgggcaggtgcggcggttccgctcggtggcgggcgccccggtggaggatgaggtg
tccgaagcgccgcccgccgacattccgcgcctgctgccaagcctggcactcgatgccggc
gccaggccgtcgccgctccatgtgtcgctgtgcctgggcgcggtctacaaggacaacgag
atcgtgcggctcggcgaccgcctgccgccgttgctggaggtggcacgcggcagcgcgctg
tggacggcggtggcgtcgctggtggcccagctgcgcggcaaggccgcgttcgtggccaag
cagaccgcgatcccgtcatcccgggcggacgaccgcctgacccagctggaactgaaggac
cgcttgcgcagcctggtgaccgcgctgccgctgctggaggcggtgttgcgcacgccgcat
ctgcacccgcttgcactctacctggcgctggcctcggtgctggggtcgctcagcctgctc
aagccgggcggcctgccgccggtgccggacgactatgaacacgccgaccccatggccgtg
ttcacgccgctgctgcgcgcgctgcgcgagaccctggccgaggtcagcgaagagtaccgc
gagcacaagttcgagttccgccacggcgcgttcgacatcgtgctgcagccggactggatc
ggcgagcgcctggtggtgggcctgcgcgggcagtcagagcgcgacctgctggcctggatg
tcgggcgctgtggtgggctcgcagtcggtctacccgtcgctgcgcacgcggcgcgtgctg
ggcgcggtgcgccgtgtggtcgagcatgccgaggaccttggggtgcgttccggctcgggt
tacctgttgttcgagatcgaagccgatcccgcgctggtccatgccaacgaggcgatggtg
atcggcaatcccaatgaaggcgccagcgtgcagcggccgcaggaaatgctgctgttcgtc
aagggctga

DBGET integrated database retrieval system