KEGG   Cupriavidus necator H16: H16_B2427
Entry
H16_B2427         CDS       T00416                                 

Gene name
h16_B2427
Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
reh  Cupriavidus necator H16
Pathway
reh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:reh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    H16_B2427 (h16_B2427)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_B2427 (h16_B2427)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_B2427 (h16_B2427)
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: CAJ97209
UniProt: Q0JYG5
Position
2:complement(2738915..2740816)
AA seq 633 aa
MIPTQATQAGSFATLATPFGGDVLLLDGFAGREALSELFRFSLRMRSADKALDAGRIVGQ
RLTVTLQHPGGAPRYLNGIVTRFAHAGADHNHGFYTAELAPRLWLLTLGRDRAIYQNLSA
PQIIRRVLQSFDVAFEARITETRYPMREYCVQYDESPFDFISRLMEEEGIFYFFTFADGA
HTMVLADSPSAHPPGAHCADLAMHDMERPQAGAARMLAFGMARQLGAATQVLADYDYLQA
RTSQGTAQAGAAPVAQQYVFPGRHKDAADASRKAAIRAGAQQAQAQTGMGESACHHLAAG
IRFTLHGHVDPALDIAYVVRAVEHAWSGDAYGNTVSVLPLSVPFRAPLSTPRPLVAGTHT
ATVAGSQGEEIWTDAHGRIKLKFHWDRAPGANQDSSCWVRVAQAWAGAGWGHLFLPRMGQ
EVVVSYVDGDPDRPLVTGSVYNGQSGVPVPLPAMQTQSVIRSRASKGGSAGNELRMEDKA
GAEELFLRAQRAMTVSVADTLSTMVEAGGESHLVKAGDLALEVRSGNETHKVSGTRQVKA
DGDETHTSGAAFAHDVGGNYKLTVAGNLVIEVGGSIAFKAGTSLQCEAGTTLSSKAGTTL
SNEAMMVRQKASAAQTVESGGMLELKGALVKLN
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgatcccgacacaggccacccaggccggcagcttcgcgaccctggccacgccgtttggc
ggcgacgtgctgctgctcgacggctttgccgggcgcgaggcgctgtccgagctgttccgc
ttcagcctgcgcatgcgctcggcggacaaggcgctcgacgcgggccgcatcgtgggccag
cgcctcaccgtcacgctgcagcacccgggcggcgcgccccgctacctgaacggcatcgtc
acgcgctttgcccacgccggcgccgaccacaaccatggcttctacaccgcggaactggcg
ccgcggctgtggctgctgaccctcgggcgcgaccgcgccatctaccagaacctgtccgcg
ccgcagatcatccgccgcgtgctgcagtccttcgacgtggcgttcgaggcccgcatcacg
gaaacgcgctacccgatgcgcgagtactgtgtgcagtacgacgaaagcccgttcgacttc
atctcgcggctgatggaggaggaaggcatcttctacttcttcacgttcgcggacggcgcg
cacaccatggtgctggccgacagcccgtcggcccacccgcccggcgcgcactgcgccgac
ctggcgatgcacgacatggagcgcccgcaggccggcgcggcacggatgctcgccttcggc
atggcgcgccagcttggcgccgcgacgcaggttctggccgactacgactacctgcaggcc
cggacctcgcagggcaccgcccaggccggcgcggcgccggtggcgcagcagtacgtgttt
cccggccggcacaaggatgccgccgacgccagccgcaaggccgcgatccgggccggcgcg
cagcaggcccaggcgcagacgggcatgggcgagagcgcgtgccaccacctggccgcgggc
atccgcttcacgctgcacggccacgtcgatcccgcgctcgatatcgcctacgtggtgcgc
gcggtggagcatgcctggagcggtgatgcctatggcaataccgtgtcggtgttgccgctg
tcggtgccattccgcgcgccgctcagcacgccgcggccgctggtcgccggcacgcacacc
gcgaccgtggccgggtcccagggcgaagagatctggaccgatgcgcatggccgtatcaag
ctgaagttccactgggaccgtgcgcccggcgccaaccaggacagctcatgctgggtccgc
gtggcgcaggcctgggccggcgccggctggggccacctgttcctgccgcgcatggggcag
gaggtggtggtcagctatgtcgatggcgacccggaccggccgctggtgaccggcagcgtc
tacaacggccagtccggcgtaccggtgccgctgcccgccatgcagacgcagagcgtgatc
cgttcgcgcgcatcgaagggcgggtcggccggcaatgagctgcgcatggaagacaaggct
ggtgccgaggagctgttcctgcgcgcccagcgcgccatgacggtttcggtggcagacacc
ttgtccaccatggtggaggcgggcggcgaatcgcacctggtcaaggccggcgaccttgcg
ctcgaagtgcggtccggcaatgaaacacacaaggtgagcggcacgcgccaggtcaaggcg
gacggcgacgagacccacaccagcggcgcggcgtttgcgcacgacgttggcggcaactac
aagctcacggtggccggcaacctggtgatcgaggtcggtggatcgatcgcgttcaaggcg
ggaacctcgctgcagtgcgaggccggcaccacgttgagcagcaaggccggtaccaccctg
agcaacgaagccatgatggtccggcagaaggcgtcggccgcgcagacggtggaaagcggc
ggcatgctcgagctcaagggcgccctggtgaaactgaactga

DBGET integrated database retrieval system