KEGG   Cupriavidus necator H16: H16_B2433
Entry
H16_B2433         CDS       T00416                                 

Gene name
h16_B2433
Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
reh  Cupriavidus necator H16
Brite
KEGG Orthology (KO) [BR:reh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    H16_B2433 (h16_B2433)
Secretion system [BR:reh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H16_B2433 (h16_B2433)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CAJ97215
UniProt: Q0JYF9
Position
2:complement(2747374..2748885)
AA seq 503 aa
MAKNSAADNASAESKGSTTAAAERELTLLDRIVQEGNMAVEPSQSGYARKLIGQLASQIL
DEGMRTSPDKSLVATINERVAEIDRLLSDQLNAIMHDPAFQALEGAWTGLHDMVYGTETG
TSLKLRLLNVTKAELLKDLETAVDHDMSVLFKKIYEEEYGTFGGHPYTLLIGDYSFGRHP
QDVALLERISKVAAAAHAPFITSAAPSLFDLRAFTELGVTRDLAKIFESAELAQWRGFRE
TEDSRYVSLVLPSYAARLPYGARTNPVESFNFEEDVDGTDHSKYLWANSAYQLGLRITDA
HAKYNWSTAIRGVEGGGKVDGLVAHTYKTDEGDVALKCPTEVTITDRREKELNDLGFIAI
VNAKGSNSATFFGSQTANKPKVYNKDQANANAQLSARLPYVLAASRFAHYLKVIMRDKVG
SFQTRGDVERYLNNWIADYVLLNPSATPEAKSRFPLSAARVDVTEVPGKPGAYRATCFLK
PHFQMEELTASIRLVADLPAAAA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcaaagaactccgcagcggacaacgcgagcgccgaatcaaaggggagcaccacggcc
gcagccgagcgtgaactgacgctgctcgaccgtatcgtgcaggaaggcaatatggcggtg
gagccgtcgcagagcggctatgccaggaagctgatcggccagctggcctcgcagatcctt
gacgagggcatgcgcaccagcccggacaagagcctggtggcaaccatcaacgagcgcgtg
gccgagatcgaccgcctgctgagcgaccagctcaacgcgatcatgcacgaccccgcgttc
caggcgctggaaggcgcgtggaccggcctgcacgacatggtctacggcaccgagaccggc
accagcctgaagctgcgcctgctcaacgtgaccaaggccgagctgctgaaggatcttgaa
accgcagtcgaccacgacatgagcgtgctgttcaagaagatctacgaagaagagtacggc
accttcggcggccatccctacacgctgctgatcggcgactacagcttcggccgccatccg
caggacgtggcgctgcttgagcggatatcgaaggtggcagccgccgcccatgcaccgttc
atcaccagcgcggcgccgagcctgttcgacctgcgcgctttcaccgagctgggcgtgacg
cgcgacctggccaagatcttcgagagcgcggagctggcgcagtggcgcggcttccgcgaa
accgaggattcgcgctatgtgtcgctggtgctgccgtcctacgcggcgcgcctgccttac
ggcgccagaaccaatccggtcgagagcttcaatttcgaagaagacgtcgacggcaccgac
cacagcaagtacctgtgggccaactcggcctaccagctgggcctgcgcatcaccgacgcg
catgccaagtacaactggtcgaccgccatccgcggcgttgaaggcggcggcaaggtcgac
ggcctggttgcgcatacctacaagacggatgaaggcgacgtcgcgctcaagtgcccgacc
gaggtcaccatcaccgaccgccgcgagaaggagctcaacgacctgggcttcatcgccatc
gtcaatgccaagggctcgaacagcgccaccttctttggcagccagacggcaaacaagccc
aaggtctacaacaaggaccaggccaacgccaacgcgcagttgtctgcccggctgccgtat
gtgctggcggcttcgcgctttgcgcactacctgaaggtgatcatgcgcgacaaggtgggc
agcttccagacgcgcggggacgtggagcgctacctgaacaactggatcgccgactacgtg
ctgctcaatccctccgcgacgccggaggccaagtcgcgctttccgctgagcgccgcgcgc
gtcgacgtgaccgaggtgccgggcaagcccggcgcctaccgtgccacgtgtttcctgaag
ccgcacttccagatggaagaactgaccgcatcgatccgcctggttgcagacctgccggca
gcggcagcgtag

DBGET integrated database retrieval system