KEGG   Ralstonia eutropha H16: H16_B2453Help
Entry
H16_B2453         CDS       T00416                                 

Gene name
h16_B2453
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00860  Porphyrin and chlorophyll metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
Module
reh_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H16_B2453 (h16_B2453)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     H16_B2453 (h16_B2453)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     H16_B2453 (h16_B2453)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Thi4 FAD_oxidored NAD_binding_9 Pyr_redox_2 HI0933_like AlaDh_PNT_C Pyr_redox GIDA Pyr_redox_3 FAD_binding_3 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: CAJ97235
UniProt: Q0JYD9
Position
2:2773783..2775108
Genome map
AA seq 441 aa AA seqDB search
MNQPISIVVVGAGISGLTAAYRLTAAGFTVQVLESQSAVGGRMAQRREGPISYNTGARLI
YPFGQAFHSLLAELDLTRALVPLRKLGANAAIGGDRYRVELMPGPRTLMTPGLDWRSRIR
MVAAGVGLARLRSRTDPDAAASYLEGDTETLADYISRTTTPAVLKQLIEPIFRGTRSWNP
EDISAAFYVSTMPHLLGKDTVYTLAEGMGQVTQELGRRVPVLCDARAYAIERHAEGQCIV
RYRRLGQEHELRANVVVCATEGAQAGKLIVDPLDAERSMLEAVRYNKLGVVHYALEGDIP
AELEFSGRQSTTRIATWQQLPAAPIAGRSHAQLYCQLTPEAAEEADRLGLADSLDTLIRS
EVRQRIPRFDSRVHTIVNQWIPYKLPIFYPGYCRKVADFLTWQSAARRSVYYCGDYLSQA
LLTGACASGDSIAKAILAHHG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacctatctccatcgtcgtcgttggtgccggtatttccggactcaccgcagct
taccggctcacggctgccggcttcaccgtccaggttctggaaagccaatcggccgtgggc
gggcgaatggcacaacggcgcgagggtcccatttcatacaacaccggtgcgcgcctgatt
tacccgtttggccaggcgtttcactccttgctcgccgaactggatctgacgcgtgcgctt
gtaccgctacgcaagctcggcgcaaacgccgcaatcggcggcgatcgttaccgtgtcgag
ctgatgcctggcccgcgcaccctcatgacgcccgggctggattggcgcagccggatacgc
atggtcgcggcgggagtaggtctcgcgcgcctgcgctcgcgtaccgatccagacgctgcg
gcctcatacctggaaggcgacaccgaaaccctggcggattacatcagccgaaccaccaca
cccgccgtactgaagcaactcatcgaacccatcttccgcggaacgcgtagctggaatccg
gaggatatttcggcggcattctacgtcagtaccatgccgcatctgctcggcaaggacacc
gtctacaccctggcagaaggcatggggcaggtgactcaggaactgggccgtcgggtgcca
gttctttgcgacgcaagggcctatgccatcgaacgacacgccgagggccaatgcatcgta
cgctatcggcgcctcggacaagaacatgagctgcgcgcgaatgttgtcgtctgcgccacg
gagggcgcccaagccggcaagcttatcgtcgatcctctcgacgcggagcgctcgatgctc
gaagcagtgcgatataacaagctgggtgtcgttcactacgcgctggaaggggatattcct
gccgagctggagttctcaggccgtcagtcaacgactcgcattgcgacctggcaacagttg
ccggcggcaccgatcgcaggacgttcgcacgcgcaactctactgtcagctgacacccgag
gcagccgaagaagcggatcgcctcggcctggccgattcgctcgacacccttatccggtcg
gaagtcaggcagcgcattccccgcttcgatagtcgagtgcacactattgtcaaccagtgg
attccgtacaagctgccgatcttctaccctggctattgccggaaggtggccgactttctc
acctggcagtctgccgcgagacgatccgtctactactgcggggattacctgtcccaagcg
ctcctgaccggagcttgtgcaagcggcgactcaatcgcaaaagcaatcctggcgcaccac
ggttag

DBGET integrated database retrieval system