KEGG   Cupriavidus necator H16: PHG356
Entry
PHG356            CDS       T00416                                 

Gene name
trbI
Definition
(GenBank) putative channel-forming protein
  KO
K20533  type IV secretion system protein TrbI
Organism
reh  Cupriavidus necator H16
Pathway
reh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:reh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PHG356 (trbI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:reh02044]
    PHG356 (trbI)
Secretion system [BR:reh02044]
 Type IV secretion system
  Trb secretion system protein
   PHG356 (trbI)
SSDB
Motif
Pfam: TrbI G2BR
Other DBs
NCBI-ProteinID: AAP86105
UniProt: Q7WWY6
Position
pHG1:complement(369877..370806)
AA seq 309 aa
MPDTKKPVLTAADLNGGGKAAPTVDAKKNEEDDLFTAPVFKSGARKSQLNQGRVPAGIAD
VSDPAQMRAIQQAVAARQGAANAAALAQDNATPQQVSGDRQFLRDAGSMSTLRTGFDGKL
PKCTVSRGFVIPATFAGGLNSDKPGEFRATVSQDIYDTVQGTCKVIPAGSTLVGMYSADI
AVGQERLLTAFVRMQLPNGKTVPLLGMQGADPDGTAGNSGDVNNHFLRIFSGALVIGALS
LRFNDNPTTTTVGPAGLVAYGNAAGQIATQTAQTILNRNQNIRPTITTDPGQRMMVQVKH
DIVLEAYRD
NT seq 930 nt   +upstreamnt  +downstreamnt
gtgccggacaccaagaagccggtattaactgctgccgatctgaacggcggtggaaaagct
gcgcccacggtagatgccaagaagaacgaggaggatgatctattcacggcgccggtgttc
aagtccggcgcgcgcaagtctcaactgaatcaagggcgtgtgcctgccgggattgcggat
gtctcggaccctgcgcaaatgcgtgcgatccagcaagcggtggccgctcgccagggcgcg
gcgaatgcggccgcgcttgcacaggacaacgcgacgccacagcaagtctccggtgaccgg
cagttcctgcgcgacgccggcagcatgagcaccttgcgaaccggcttcgatggcaagttg
ccaaaatgcacggtcagccgaggcttcgtcatccccgcaacgttcgccggtggcctgaac
tcggacaagcccggcgagttccgcgccaccgtatcccaggacatctacgacaccgtgcag
ggtacctgcaaggtgatccctgccggcagcacgctggtcggtatgtatagcgcggacatt
gctgtcgggcaggagcgccttctcacggcgttcgtgcgcatgcaactgcccaacggcaaa
accgtgccgctcctggggatgcagggtgccgatccagatgggaccgccggtaatagcggc
gacgtcaataaccacttcttgaggatcttcagcggtgcgctggtgatcggtgcgctgtcg
cttcgtttcaacgataacccgacgacgaccaccgtcgggccggccggtctggtcgcttat
ggaaacgccgcgggtcaaattgccacgcagacggcacagaccatcctgaaccgcaaccag
aatatccggccgaccatcacgaccgatcccgggcaaaggatgatggtccaggtcaagcat
gacatcgtgctggaggcctatcgtgactaa

DBGET integrated database retrieval system