KEGG   Cupriavidus necator H16: PHG423
Entry
PHG423            CDS       T00416                                 

Gene name
cbbEp
Definition
(GenBank) ribulose-5-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
reh  Cupriavidus necator H16
Pathway
reh00030  Pentose phosphate pathway
reh00040  Pentose and glucuronate interconversions
reh00710  Carbon fixation in photosynthetic organisms
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01200  Carbon metabolism
reh01230  Biosynthesis of amino acids
Module
reh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:reh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PHG423 (cbbEp)
   00040 Pentose and glucuronate interconversions
    PHG423 (cbbEp)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHG423 (cbbEp)
Enzymes [BR:reh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     PHG423 (cbbEp)
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C
Other DBs
NCBI-ProteinID: AAP86172
UniProt: Q04539
Position
pHG1:complement(445981..446706)
AA seq 241 aa
MHATEPNTGHGSQRAIRLAPSILSADFARLGEEVCAIEAGGADLVHFDVMDNHYVSNLTI
GPLVCEAIRPLVSIPIDVHLMVEPVDALIPMFAKAGANLISFHPEASRHVDRTIGLIRDH
GCKAGLVLNPATPLSWLDHTLDKLDLVLLMSVNPGFGGQAFIPGVLDKVRQARARIDRQV
AAGGRPVWLEIDGGVKADNITEIARAGADTFVAGSAVFGAPDADGGYRGILHRLREAATI
T
NT seq 726 nt   +upstreamnt  +downstreamnt
atgcatgccaccgaacccaacaccggccatggcagccagcgcgccatccgcctggcgcca
tccatcctgtcggccgatttcgcgcgcctgggcgaagaggtgtgcgcgatcgaggccggc
ggcgcggacctggtgcacttcgatgtgatggacaaccactatgtgtccaacctgaccatc
ggcccgctggtgtgcgaggcaatccggccgctggtttcgatccccatcgacgtgcacctg
atggtggagccggtcgatgcgctgatcccgatgttcgccaaggccggcgccaacctcatc
agcttccatccggaagcgagccgccatgtggaccgcaccatcggcctgatccgcgaccac
ggctgcaaggccggcctggtgctgaacccggccacgccgctgagctggctggaccacacg
ctggacaagctcgacctggtgctgctgatgagcgtgaacccgggcttcggcggccaggcc
ttcattccgggcgtgctggacaaggtgcgccaggcacgggcgcgcatcgaccggcaagtg
gccgccggcgggcggccggtctggctggagatcgacggcggcgtcaaggccgacaacatc
actgagatcgcccgtgcgggcgccgacaccttcgtggccggcagcgccgtgttcggcgcg
ccggatgccgacggcggctaccggggcatcctgcaccgcttgcgcgaggccgccaccatc
acgtag

DBGET integrated database retrieval system