KEGG   Rhizobium sp. IE4771: IE4771_CH02937Help
Entry
IE4771_CH02937    CDS       T03310                                 

Definition
(GenBank) P-loop NTPase domain-containing protein
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
rei  Rhizobium sp. IE4771
Brite
KEGG Orthology (KO) [BR:rei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IE4771_CH02937
Enzymes [BR:rei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     IE4771_CH02937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 PIF1 Viral_helicase1 AAA_16 ATPase_2 AAA_33 TniB AAA_22 SH3_13 AAA NACHT AAA_11 TsaE UvrD_C NB-ARC AAA_24 AAA_18 AAA_5 ATPase AAA_28 PhoH
Motif
Other DBs
NCBI-ProteinID: AIC28032
UniProt: A0A060I2I2
Position
complement(2905434..2906561)
Genome map
AA seq 375 aa AA seqDB search
MQFAPQQDEALKAVSKWLNEGRSPLFRLFGYAGTGKTTLARHFAENVDGDVLFAAFTGKA
AQVLRSRGASNAKTIHSLIYRPRGEEAVEDEETGKTSIAPMFSINRQSPVAKAALIIVDE
CSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGYFTNQEPDYLLTDIHRQARDNPIIK
LAMQVREGNEVMYGDYGTAKVISKSEVTQQLVLDADQVLVGTNRTRRRYNQRLRELKGFN
ADYPQTGDKLVCLRNDPAKGLLNGSLWQVMTSSKETTKPGINLLVRPEDDDMDRGAAKIK
LLKQAFEDVEGEIPWNTRKRYDEFDYGYALTVHKAQGSQWNDVVLFDESWAFRDTRERWL
YTAITRAAETLTIVR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgcgccgcaacaagatgaagccctgaaggcagtttcgaaatggctgaacgag
gggcgctcgccgctctttcgcctgttcggctatgccggaaccggcaagacgacgcttgcc
cggcatttcgctgaaaatgtcgacggcgatgtgctgtttgccgccttcactggtaaggcc
gcgcaggtgctgcgctcgcgcggcgcctccaacgccaagaccatccattcactgatctac
cggccgcgcggcgaagaagcggtggaggacgaggaaaccggaaagacctcgatcgcgccg
atgttttcgatcaaccggcagagcccggtcgcgaaagccgcgctgatcatcgtcgacgaa
tgctcgatggtggacgaggcgctcggcaaggatctgatgagcttcggcacgccgatcctg
gtgctcggcgatcccggccagttgccgccggtgtcgggcggcggttacttcaccaatcag
gaaccggattacctcctgaccgatattcaccgccaggcgcgcgacaatccgatcatcaag
ctcgccatgcaggtgcgcgagggaaacgaggtgatgtatggcgattacggaacggcgaag
gttatttcgaagagcgaggtgacacagcagctggtgctcgatgccgaccaggtgctcgtc
ggcaccaacaggacgcggcggcgctataaccagcgcctgcgggagttgaagggttttaac
gccgattatccgcagaccggcgacaagctcgtctgcctgaggaacgacccggccaagggt
ctgctcaacggctcgctgtggcaggtcatgacctcgtcgaaggaaacgacgaaacccggc
atcaatctgctcgtccgccccgaggacgacgacatggatcggggggcggccaagatcaag
cttctgaaacaggccttcgaggatgtcgaaggcgagattccctggaacacccgcaagcgc
tacgacgagttcgactacggctatgcgctgaccgttcacaaggcgcagggctcgcaatgg
aacgacgtcgtgctcttcgacgagagctgggcctttcgcgacacgcgcgaacgctggctc
tataccgcgatcacgcgcgcagcggagacgctgacaatcgtgcgctga

DBGET integrated database retrieval system