KEGG   Rhizobium sp. IE4771: IE4771_PC00307Help
Entry
IE4771_PC00307    CDS       T03310                                 

Definition
(GenBank) acetyl-CoA acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00071  Fatty acid degradation
rei00072  Synthesis and degradation of ketone bodies
rei00280  Valine, leucine and isoleucine degradation
rei00310  Lysine degradation
rei00362  Benzoate degradation
rei00380  Tryptophan metabolism
rei00620  Pyruvate metabolism
rei00630  Glyoxylate and dicarboxylate metabolism
rei00640  Propanoate metabolism
rei00650  Butanoate metabolism
rei00900  Terpenoid backbone biosynthesis
rei01100  Metabolic pathways
rei01110  Biosynthesis of secondary metabolites
rei01120  Microbial metabolism in diverse environments
rei01130  Biosynthesis of antibiotics
rei01200  Carbon metabolism
rei01212  Fatty acid metabolism
rei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IE4771_PC00307
   00630 Glyoxylate and dicarboxylate metabolism
    IE4771_PC00307
   00640 Propanoate metabolism
    IE4771_PC00307
   00650 Butanoate metabolism
    IE4771_PC00307
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IE4771_PC00307
   00072 Synthesis and degradation of ketone bodies
    IE4771_PC00307
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IE4771_PC00307
   00310 Lysine degradation
    IE4771_PC00307
   00380 Tryptophan metabolism
    IE4771_PC00307
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IE4771_PC00307
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IE4771_PC00307
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IE4771_PC00307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rei04147]
    IE4771_PC00307
Enzymes [BR:rei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IE4771_PC00307
Exosome [BR:rei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IE4771_PC00307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIC30432
UniProt: A0A060I9C7
Position
pRetIE4771c:338867..340051
Genome map
AA seq 394 aa AA seqDB search
MSTRDIVIGYPVRTAIGTYNGTLKGIPATELGAIVVQETLRRAGLEAAEVGTMVMGNVIQ
AGNRMNPARQAAIGGGLPVEVPAMTVNRVCGSGAQAILTAALEIVAGDSDVAIAGGMENM
DRAPYLMDGGRWGYRMGPAQILDSMLTDGLNDAFSGQHSGWHTEDLVEKMQITRADQDAF
AARSQQNFTAARDAGLFAGEIVAVEVKGRKGAESFATDEAPRPDTTVESLARLRPAFRPE
GTITAGNAPGLNSAAAAMIVAERGFAEAKGIRPIGRIAGYGVAGVEPGMFGLGPVPAVRQ
ALARARWSLSDIERIEINEAFAAVPIAVARELGLPEDIINVEGGAIAHGHPIGATGAILV
TRLLHAMKREGLRRGVVTLCIGGGQGIALALETL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgcgacatcgtcattggctatccggttcgcaccgcgatcggcacctataat
ggcacgctgaaaggtattccggccactgaacttggcgcgatcgtcgttcaggaaaccttg
cggcgcgccggcctcgaagcagccgaggttggcacgatggtcatgggaaatgtcatccag
gcaggcaaccgaatgaacccagcgcgccaggccgcaatcggtggcggactacccgtcgag
gtgcccgcgatgaccgtcaatcgggtctgcggttcaggcgcgcaggcgatcctgaccgct
gcgctggagattgttgcgggcgacagcgacgtggccattgccggcggaatggagaacatg
gatcgcgcgccctatctgatggatgggggccgctggggctatcgcatgggccccgcccag
atcctcgacagcatgttgaccgacggactcaacgatgccttttccggacagcattcgggc
tggcacaccgaggatctcgtcgagaagatgcagatcacgcgcgccgatcaggacgccttc
gctgcccggtcgcagcagaatttcaccgccgcgcgagatgctggtctgttcgccggcgag
atcgtcgcggtcgaggtgaaaggccgcaagggtgcggaaagcttcgcaaccgatgaggcg
ccgcgccccgacacgacggtcgagtcgcttgctcgcttgcgtccggcctttcggcccgag
ggtacgattaccgccggcaacgcgccggggctgaacagcgccgctgcggcgatgatcgtc
gccgagcgcggcttcgccgaggcaaaaggcatcaggccgatcggtcggatagcgggctat
ggtgtcgccggcgtggagccgggcatgtttgggttgggtcccgttcctgcggtgcgtcaa
gcattggcaagagcgcgctggagcctttccgacatcgagcgcatcgagatcaacgaagcc
ttcgccgccgtgccgatcgcggtcgcccgtgagctcgggctgcccgaggatatcataaat
gtcgagggcggcgccatcgcccatggccatccaatcggcgcaaccggtgccatcctcgtc
acgcggctcctacatgcgatgaagcgggaaggtctgcgccgcggagtcgtcacgctctgc
atcgggggaggccagggcatcgcgctcgcgctcgagacgttatag

DBGET integrated database retrieval system