KEGG   Rhizobium sp. IE4771: IE4771_PC00401Help
Entry
IE4771_PC00401    CDS       T03310                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00051  Fructose and mannose metabolism
rei01100  Metabolic pathways
rei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    IE4771_PC00401
Enzymes [BR:rei01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     IE4771_PC00401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C Kin17_mid
Motif
Other DBs
NCBI-ProteinID: AIC30525
UniProt: A0A060IES7
Position
pRetIE4771c:complement(439331..440608)
Genome map
AA seq 425 aa AA seqDB search
MTRITDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDAPDLAGHGLTFTIGRGND
ICCMAIEAMRHLVVGTELSEVLAHPGKFWRHLTSDSQLRWIGPEKGAIHLATGAVVNAVW
DLLAKQAGKPVWRLVAEMSPEEIADIVDYRYLTDVLTRDEAIAILKKAEAGKAERIATLE
KEGYACYTTSAGWLGYEDEKLRRLCKEAIDAGFNHIKMKVGRDLDDDIRRLRIAREVIGP
DRYLMIDANQVWDVGQAIDWVKALAFAKPFFIEEPTSPDDVAGHRKIRQAIGPVKVATGE
MCQNRIMFKQFIAEGAIDIVQIDSCRMGGLNEVLSVLLIAAKFALPVWPHAGGVGLCEYV
QHLSMIDYIAVSGTKDGRVIEYVDHLHEHFLDPCRIENAAYMPPTLPGFSIEMKPASISS
YTFQG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatcaccgaccttcgcgtcttcgatctccgctttcccacgtcgcaaagcctc
gatggatccgacgcgatgaatcccgatccggactattcggcggcctatgtcattctcgac
acggatgcgcctgatcttgccggccatggcctgaccttcaccatcggccgcggcaacgac
atttgctgtatggcgatcgaagcgatgcgccacctcgtcgtcggcaccgagctcagtgag
gtgctcgcccatcccggcaaattctggcggcatctgaccagcgacagccagctgcgctgg
attggcccggaaaagggcgccattcatctggcgaccggcgccgtcgtcaacgccgtctgg
gatctgctcgccaagcaggcgggcaaacccgtctggcggctcgtcgccgaaatgtcgccg
gaagaaatcgccgatatcgtcgattaccgctacctcaccgacgtcctgacgcgcgatgaa
gcgatcgctattctcaagaaggcagaagccggcaaggccgaacgtatcgccaccctcgaa
aaggagggctatgcctgctacacgacctcggccggctggctcggttatgaggacgagaaa
ctgcgccgcctctgcaaggaggcgatcgacgccggcttcaaccatatcaagatgaaggtc
ggccgcgatctggatgacgatatccgccggttgaggatcgcccgcgaggtgatcggcccc
gaccgctacctgatgatcgacgccaaccaggtctgggatgtcggccaggcgatcgactgg
gtcaaggcgcttgctttcgccaagcctttcttcatcgaggaacccaccagccccgatgac
gtcgccggccaccgcaagatccgacaggcaattgggccggtgaaggtcgcgactggcgag
atgtgccagaaccgcatcatgttcaagcagttcatcgccgagggcgcgatcgacatcgtc
cagatcgattcctgccggatgggcgggctgaacgaggtcctgtcggtgctgctgatcgcc
gccaagttcgccctgccggtctggccgcatgccggcggcgtcggcctctgcgaatatgtg
cagcacctgtcgatgatcgattacatcgcggtgtcaggcaccaaggatggccgcgtcatc
gaatatgtcgatcacctgcacgagcatttcctcgacccctgccggatcgaaaacgccgcc
tatatgccgccgaccctgccgggcttctccatcgagatgaaaccagcttcgatcagcagc
tatacgtttcaaggctga

DBGET integrated database retrieval system