KEGG   Rhizobium sp. IE4771: IE4771_PD00538Help
Entry
IE4771_PD00538    CDS       T03310                                 

Gene name
bglS-2
Definition
(GenBank) beta-glucosidase 2
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00460  Cyanoamino acid metabolism
rei00500  Starch and sucrose metabolism
rei01100  Metabolic pathways
rei01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IE4771_PD00538 (bglS-2)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    IE4771_PD00538 (bglS-2)
Enzymes [BR:rei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     IE4771_PD00538 (bglS-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like PA14
Motif
Other DBs
NCBI-ProteinID: AIC31092
UniProt: A0A060IBK4
Position
pRetIE4771d:complement(570447..572912)
Genome map
AA seq 821 aa AA seqDB search
MIDSILDQMTLEEQVSLLSGADFWTTVPVERLGVPKIKVTDGPNGARGAGSLVAGVKATC
FPVAIALGASWNPELIHQMGAALARQAKSKGAAVLLAPTVNIHRSGLNGRNFECYSEDPM
LTAELAVAYIEGVQGEGVAATIKHFAGNESEIERQTMSSEIDERTLREIYLPPFEQAVRR
AGVMAVMSSYNRLNGTYTSEHHWLLTKVLREEWGFGGIVMSDWFGSHSTAETINAGLDLE
MPGPARDRGEKLVAAVLEGKVDAATVRAAARRILVLLERVGAFEKKPDLTERAVDLPEDR
ALIRRLGAEGAVLLKNDGILPLARTSLDRIAVIGPNAASARVMGGGSAQIAAHYTVSPLE
GIRAALSNANSISHAVGCRHNRLIDVFKGKIAVEYFNGRGCKGDPLHVETVDKGEFFWFE
LPSGELDPAAFSARMTMQFVPEESGEHVFGMTNAGLARLFVDGRLTVDGHAGWTRGENYF
GTANDEQRGTLMLEAGRSYEITVEYEPSTATEEGINLIAVRFGVEKPLGEVDIESAVETA
RNADVALLFVGRDGEWDTEGLDLPDMRLPGRQEELIERVAAANANTVVVLQTGGPVEMPW
LGKVRAVLQMWYPGQELGNAVADVLFGDVEPGGRLPQTFPKALADNAAITGDPAVYPGKD
GHVHYAEGVFVGYRHHDSRAVEPLFPFGFGLGYTRFIWDKPRLSVSEMDADGVTVSVDLT
NIGDRAGSELVQLYVRSPKSKVARPDKELRAFAKLSLQPGETGTAVLKVLPRDLAYFDPE
AGAFLAEPGDYQLVIAANAIDIKSVIDLRSPASYLLPPSHA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattccattctcgaccagatgacgctggaggagcaggtctcgctgttgtcgggc
gccgatttctggacgacggttccggtcgagcgtctcggcgtgccgaagatcaaggtgacg
gatggaccgaacggcgcgcgcggcgccggttcgctggtcgccggcgtcaaggcgacttgc
tttcccgtcgccattgcgctcggggccagctggaatcccgaacttatccatcagatgggt
gcagcccttgcgcgccaggcaaagagcaagggtgccgccgtgctgctcgcgcccacggtc
aatatccatcgctccggcctcaacggccgcaatttcgagtgttattccgaagatccgatg
ctgaccgcggaactcgccgtcgcctatatcgagggcgtgcagggcgaaggggtggcggcg
acgatcaagcacttcgccggcaatgagtcggagatcgagcggcagaccatgtcttccgaa
atcgacgagcggacgctgcgcgaaatttacctcccaccattcgaacaagccgtccgccgc
gccggcgtcatggcggtcatgtcctcctacaaccgcctgaacggcacctatacgagcgag
catcactggctgctgaccaaggtgctgcgcgaggaatggggttttggcggcatcgtcatg
tccgactggttcggctctcactcgacggctgagacgatcaatgccggcctcgatctcgaa
atgccgggcccggcgcgcgatcgcggcgagaaactggttgcggccgtgctcgagggcaag
gtcgatgccgcgacggtgcgcgctgcggcgcggcgcatattggttttgctcgagcgggtc
ggcgcgttcgagaaaaaacccgatctcaccgagcgggcggtcgacctgccggaggaccgg
gcactgatccggcgtctcggcgcggaaggcgccgtgcttctgaagaacgacggcatcctg
ccgcttgccaggacctcgctcgatcgcatcgctgtcatcggaccgaatgcggcaagcgcg
cgggtcatgggcggcggcagtgcgcagatcgcggcgcattataccgtgagcccgctcgaa
ggcattcgcgcggctctctccaatgccaacagcatcagccatgccgtcggctgccgccac
aatcggctgatcgatgtgttcaagggaaagatcgcggtcgaatatttcaacggccgcggc
tgcaagggcgatccgctgcacgtcgaaacggtcgacaagggcgaattcttctggttcgaa
ctgccgtcgggcgagctcgatcccgccgctttctcggcccgcatgacgatgcaattcgtg
ccggaggagagcggcgagcatgtgttcggcatgaccaatgccgggttggcgcggctcttc
gtcgacggaaggctgacggtagacgggcatgcgggctggacgcgcggggagaattatttc
ggcaccgccaacgacgaacagcgcggcacgttgatgctcgaggccggccggtcatatgag
atcaccgtcgagtatgaaccatccacggcgacagaggaggggatcaacctcatcgccgtc
cgcttcggcgtcgaaaagccgcttggcgaggtcgacatcgagtcggcggtcgaaaccgcc
cgtaatgccgatgtggcgcttctctttgtcggccgcgacggcgaatgggatacggaggga
ctggacctgcccgacatgcggctgccgggccgacaggaggaactgatcgagcgggttgcg
gccgccaacgccaacacggtggtggtgctgcagaccggcggcccggtggaaatgccctgg
ctcggcaaggttcgcgccgtgctgcagatgtggtatccggggcaggaactcggcaatgcc
gtcgccgacgtgctgttcggcgacgtcgagccaggcggacgcctgccgcagaccttcccg
aaggcgcttgccgataacgccgccatcaccggtgatcccgccgtctatcccggcaaggac
gggcatgtgcactatgccgaaggcgtcttcgtcggctaccgtcaccacgacagccgcgct
gtcgagccgctctttcctttcggtttcgggcttggctatacgcgcttcatctgggacaag
ccgcgactgtcggtgagcgagatggatgctgacggcgtgaccgtcagcgtcgacctgacc
aatatcggcgatcgggcggggtcggaattggttcagctttatgtgcgttcgcccaaatcc
aaagtggcacggccggacaaggaactgcgcgcctttgcgaagctttcgctgcagcctggc
gaaacgggcacggcggtcctgaaggtcctgccgcgcgatctcgcttactttgaccctgag
gccggtgccttcctggcagagccgggtgactatcagctggttattgcagccaacgccata
gatataaaatccgtgatcgatctgcggtcaccggccagctatctgttgccgccgtcgcac
gcgtga

DBGET integrated database retrieval system