KEGG   Rhizobium sp. IE4771: IE4771_PD00592Help
Entry
IE4771_PD00592    CDS       T03310                                 

Gene name
ltaE-2
Definition
(GenBank) low-specificity threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rei  Rhizobium sp. IE4771
Pathway
rei00260  Glycine, serine and threonine metabolism
rei01100  Metabolic pathways
rei01110  Biosynthesis of secondary metabolites
rei01120  Microbial metabolism in diverse environments
rei01130  Biosynthesis of antibiotics
rei01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IE4771_PD00592 (ltaE-2)
Enzymes [BR:rei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     IE4771_PD00592 (ltaE-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIC31146
UniProt: A0A060IHU5
Position
pRetIE4771d:633548..634594
Genome map
AA seq 348 aa AA seqDB search
MIFSSDNWSGAHPAIGESLMAHAAGYASGYGTSDLDRKVEQKFAEIFERNVAVFFVGTGT
AANSLALATANRAGGVAFCHREAHVIADECGAPGFFSHGARLKPVDGPRGKMVAARLEAE
IRRFPLDNVQGGQPTVVSLTQATESGTVYSLAEIDAIAAVSKAHSLPLHMDGARFANALI
SLDTTPAEMTWKRGVDLVSFGGTKNGCWCAEALVLFDLSKAQEMHFMRKRAGQLFSKSRF
VSAQFDAYFAGDLWLDLARHANAMAARLAEGITASKTSRLAWQADTNEVFPILKKDVAAK
LRQRGAIFYDWPVPQDLVGSFAPDEGLHRLVTSFATRADDVDLFVSAC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatattttcatccgacaactggtccggcgcccatcccgcgattggcgagagcctgatg
gcgcatgccgccggctatgcgtcgggctacggtaccagcgacctcgaccgaaaggtggaa
cagaaattcgcggagattttcgaaaggaatgtcgccgtctttttcgtcggcaccggaacg
gccgccaactcgctggcgcttgcgacagccaaccgtgcaggcggtgtcgccttctgccat
cgcgaggctcacgtcattgccgacgaatgtggcgcgccggggttcttttcgcatggcgcc
cgcctcaagccggttgacggaccgagaggcaagatggtggccgctcgcctcgaggccgag
attcggcgcttcccactcgacaatgtccagggcggtcagccgacggtagtatcgctgacg
caggcgacggaaagcggcacggtctattcgctcgcggaaatcgacgcgatcgccgccgtt
tccaaggcgcacagtctgccgctgcatatggatggtgcccgcttcgccaatgcgcttatc
agcttggatacaacgcctgccgaaatgacctggaagcgaggcgttgacctcgtctccttc
ggcggcacaaagaacggctgctggtgtgccgaagcgctggtgctcttcgatctctcgaag
gcgcaggaaatgcacttcatgcgaaagcgcgccggccaactcttttcgaaatcgcgcttc
gtttcggcgcaattcgacgcctactttgccggcgatctctggctggacctcgcccgccac
gccaatgccatggctgcgcgacttgccgagggcatcaccgcctccaagacgagccgcctg
gcttggcaggccgacaccaacgaagtcttcccgatcctaaagaaggatgtcgcggcgaaa
ctccgccaacggggtgcaatcttctacgactggcccgttccgcaggacctcgtcggaagc
ttcgcgccggatgaaggtctccatcgcctggtaaccagttttgcaacgcgggccgacgat
gtcgatcttttcgtatcggcttgctga

DBGET integrated database retrieval system