KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01713Help
Entry
REMIM1_CH01713    CDS       T02778                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    REMIM1_CH01713 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rel03011]
    REMIM1_CH01713 (rplV)
Ribosome [BR:rel03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    REMIM1_CH01713 (rplV)
  Bacteria
    REMIM1_CH01713 (rplV)
  Archaea
    REMIM1_CH01713 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570
Motif
Other DBs
NCBI-ProteinID: AGS21524
UniProt: S5SI86
Position
1729365..1729754
Genome map
AA seq 129 aa AA seqDB search
MGKAKAERRLKDNEAQAVARTLRVSPQKLNLVAAAIRGKKVERALAELEFSRKRIAGAVK
KTLESAIANAENNHDLDVDALVVAEAYVGKSIVMKRFHARGRGRASRIEKPFAHLTIVVR
EVQAAEEAA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaaagccgaacgccggctgaaggacaacgaggcgcaagcagtcgcccgc
acgctccgcgtcagcccccagaagctcaacctggttgctgcggccatccgcggcaagaag
gtcgagcgtgcactcgctgagctggagttctcccgcaagcgcatcgcgggcgccgtcaag
aagacgctcgaatccgcgattgccaacgccgagaacaatcacgatctcgacgtcgacgcg
ctcgtcgtcgccgaagcctacgtcggcaagtcgatcgtcatgaagcgcttccacgctcgt
ggccgcggtcgcgcgtcgcgcatcgaaaagcccttcgcgcacctgacgatcgtcgttcgt
gaagtgcaggcagcagaggaggccgcataa

DBGET integrated database retrieval system