KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01751Help
Entry
REMIM1_CH01751    CDS       T02778                                 

Definition
(GenBank) alpha/beta hydrolase family protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00903  Limonene and pinene degradation
rel00930  Caprolactam degradation
rel01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    REMIM1_CH01751
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    REMIM1_CH01751
Enzymes [BR:rel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     REMIM1_CH01751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 DUF434
Motif
Other DBs
NCBI-ProteinID: AGS21559
UniProt: S5SID2
Position
1753663..1754706
Genome map
AA seq 347 aa AA seqDB search
MKARILSNADRRAPKRLGYLFHALVALILSAPLALGQEIGPQSQSSRAQVEKLLGLWKEH
FAGADSPQERRAAFAKLMETMPGPTRIQVRQVDADGVDGELMWPARLHHPIGKRAILYIH
GGGFSGGSIRTHGLFAGSLAKAASSDVLLINYRLMPEYTYPAQINDALTAYRWLLDNGYR
NENVVVAGDGAGGNIALETVLRQKQAAKPLPAAVIALSPITDLAATGGSMLANAGNDPLV
DKAWIETLRKTYLGSRPATDPQASPLYADMTGFPPLLLQVGSGEALLDDTLRLADKARRG
GVDVTTEVWAGMPHQWQLFPAMLDDADRSSQNIAEFAIRHFADRPEE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcggattttgtcaaatgctgatcgaagagcgccgaagcggctcggatatctg
tttcacgccctggtcgcgctgatcctatcggcaccactggcactgggacaggaaattggg
ccgcaaagccagtcctcgcgtgcgcaggtcgaaaaactgctcggcctctggaaagagcat
tttgctggggccgatagcccgcaagagcgcagggcggctttcgccaagctgatggaaacg
atgccggggccgacgcgcatccaggtccggcaggtcgatgccgacggtgtggatggcgag
ctgatgtggcccgcccggcttcatcacccaatcggcaaaagggcgattctctacatccat
ggtggcggcttttccggcggttccatccgcacgcacggcctgttcgccggttcgctcgcc
aaggctgcatccagcgacgtgcttctgatcaattatcggctgatgccggaatatacctat
cccgcccagatcaacgacgcgctgacggcctatcgctggcttctcgataacggctatcgc
aacgagaatgtcgtcgtggcaggagacggcgccggtggcaatatcgcgcttgagacggtg
ctgcggcagaagcaggcggcaaaacccctgccggcggccgtgattgcgctgagcccgatc
accgaccttgccgcgacgggcggatcgatgctggcgaatgccggcaacgacccgctggtc
gacaaggcgtggatcgagactttgcgtaagacctatctcggcagccggcctgcgaccgat
cctcaggcatcaccgctttacgccgacatgaccggattcccaccgctgctgctgcaggtc
ggttccggcgaagccctgcttgacgacacgctgcgccttgccgacaaagcgcgccggggg
ggcgtggatgtcaccaccgaggtgtgggcgggcatgccgcaccagtggcagctgtttccc
gcgatgctcgacgatgccgatcgctcaagccagaatattgccgagtttgcgatccggcac
tttgccgacaggccggaagagtag

DBGET integrated database retrieval system