KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH02251Help
Entry
REMIM1_CH02251    CDS       T02778                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase (glycine-cleavage system T protein)
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00260  Glycine, serine and threonine metabolism
rel00630  Glyoxylate and dicarboxylate metabolism
rel00670  One carbon pool by folate
rel01100  Metabolic pathways
rel01110  Biosynthesis of secondary metabolites
rel01130  Biosynthesis of antibiotics
rel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    REMIM1_CH02251 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REMIM1_CH02251 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    REMIM1_CH02251 (gcvT)
Enzymes [BR:rel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     REMIM1_CH02251 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AGS22033
UniProt: S5RVY3
Position
2235678..2236814
Genome map
AA seq 378 aa AA seqDB search
MDDTAALKKTPLHALHLQLGARMVPFAGYDMPVQYPAGVMKEHLHTRTEAGLFDVSHMGQ
VIVKAKSGSYEDAALALESLVPVDILGLAEGRQRYGFFTDDTGGILDDLMITHLDDHLFV
VVNASCKDADLAHLRAHISDQCDITLLNRALIALQGPRAVEVLAELWADVAAMKFMDVRH
CRLHDVSCLVSRSGYSGEDGFEISVPADKAEDVAMRLLEHPDVQAIGLGARDSLRLEAGL
CLYGNDIDTTTSPVEAALEWAMPKARRAGGARAGGFPGSGRILSELENGAARRRVGLKPK
GKAPVRGHARLYADAEGQTEIGEVTSGGFGPSVDGPVAMGYVPVSHAAPGTLIYAEVRGK
YLPVTVSALPFITPTYKR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttggacgatactgctgccctcaagaaaaccccgctgcatgccctgcatctccagctcggc
gcccgaatggtgccgtttgccggttatgacatgccggtgcaatatcccgccggcgtcatg
aaggaacatcttcacacccgcaccgaggccggcctcttcgacgtctcccatatgggccag
gtcatcgtgaaggcgaagtcgggcagctacgaggatgcggcgctggcgctcgaaagcctg
gttccggtcgacatcctcggccttgccgaaggccgtcagcgctacggcttcttcaccgac
gacaccgggggcattcttgacgatctgatgatcacccatctcgacgaccatctctttgtc
gtcgtcaacgcctcctgcaaggatgctgacctcgcccatttgcgcgcccatatcagcgac
cagtgcgacatcaccctcctgaaccgcgccttgatcgcgctgcaggggccgcgcgcggtc
gaggttctcgccgaactctgggccgatgtcgcggcgatgaaattcatggatgtgcgccac
tgccgcctgcacgacgtttcctgtctggtctcgcgctccggctatagcggcgaggacggc
ttcgaaatctccgtcccggcggacaaggccgaggatgtcgccatgcggttgctcgaacat
cccgacgtccaggcgatcggcctcggtgcccgtgactcgctgcgtttggaagcgggcctc
tgcctttatggcaacgacatcgacaccaccacctcgccggtcgaggccgcactcgaatgg
gcaatgccgaaggcgcgccgcgccggcggcgcccgcgccggcggttttcccggctctggc
cgcattctctccgaactcgaaaacggcgccgcccgccgccgtgtcggcctgaagccgaaa
ggcaaggcgccggtgcgcggccatgctaggctctatgccgatgccgagggccagactgaa
atcggcgaagtcacctcgggcggcttcggccccagcgtcgatggtcccgtcgccatgggc
tacgtgccggtctctcatgcggcgcccggcacgctcatctacgccgaagtgcggggcaag
tatctgcccgtcaccgtcagcgccctgcccttcatcacaccgacctacaaacgataa

DBGET integrated database retrieval system