KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PA00031Help
Entry
REMIM1_PA00031    CDS       T02778                                 

Gene name
pdxA-2
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase 2
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Brite
KEGG Orthology (KO) [BR:rel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    REMIM1_PA00031 (pdxA-2)
Enzymes [BR:rel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     REMIM1_PA00031 (pdxA-2)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     REMIM1_PA00031 (pdxA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AGS23983
UniProt: S5S1D4
Position
pRetMIM1a:complement(29881..30867)
Genome map
AA seq 328 aa AA seqDB search
MDRNAKVAVTLGDPAGVGPEVIVKALAALPKEERRDFVIVGNVEALERADRVSGTALKFS
SADAASDDRIAVDEVPLGAALPEIGKVSPVAGDASVRYITRAVDLAISGQADVIVTAPIN
KEAMNLAGHHHDGHTGLLAHLTGSKSSFMLLASERLNTIHVSTHISLKGAIERAKTERVL
ATIEAGHNHFLRLGKKARIAVAGLNPHCGENGLFGTEDMEFLAPAVEQAQAKGIDVVGPI
SADTVFARAYNGAFDLVIAQYHDQGHIPIKLVAFETAVNVSLGLPIDRVSVDHGTAFDIA
GTGKANHVNMLSAIAYARLMARSPRRKA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaatgcgaaagtcgccgtgacgctcggtgatcccgccggcgtcggccccgag
gtgatcgtcaaggcactggcagcccttccgaaggaggagcgtcgcgatttcgtcatcgtc
ggcaatgtggaagcgctggagcgcgccgaccgcgtcagcggcaccgcgctgaaattcagt
tctgccgacgccgccagcgacgacaggatagccgtcgatgaagtcccactcggcgcagcc
ctgcccgagatcggcaaggtcagccccgtcgccggcgatgcgtcggtgcgctatatcact
cgtgctgtcgatctcgccatatcagggcaagccgatgtcatcgtcaccgcgccgatcaac
aaggaggcgatgaacctagccggccatcaccatgatggccataccgggctgctcgcccat
ctcaccggttcgaagagctccttcatgctgcttgcctccgagcggctgaacaccatccat
gtctcgacccatatttcgctgaagggcgcgatcgaacgcgccaagaccgagcgggtgctg
gcgaccatagaggccggccacaatcatttcctgcgtctcggcaaaaaggcgcggatcgcc
gttgccggcctcaatccgcattgcggcgaaaatggcctgttcggcaccgaggacatggaa
ttcctggcgccggcggtcgaacaggcgcaggccaagggcatcgacgtcgtcggcccgatc
tccgccgatacggtcttcgcccgcgcctataacggcgctttcgatctcgtcatcgcccag
tatcacgaccagggccacatcccgatcaagctcgtcgccttcgaaacggcggtcaacgtc
tcgctcggcctgccgatcgaccgcgtctcggtcgatcacggcaccgccttcgacatcgcc
ggcaccggcaaggccaaccacgtcaacatgctctcggccatcgcctatgccaggctgatg
gcgcgttcgccgcggcggaaggcgtaa

DBGET integrated database retrieval system