KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PB00069Help
Entry
REMIM1_PB00069    CDS       T02778                                 

Definition
(GenBank) acetyl-CoA acetyltransferase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00071  Fatty acid degradation
rel00072  Synthesis and degradation of ketone bodies
rel00280  Valine, leucine and isoleucine degradation
rel00310  Lysine degradation
rel00362  Benzoate degradation
rel00380  Tryptophan metabolism
rel00620  Pyruvate metabolism
rel00630  Glyoxylate and dicarboxylate metabolism
rel00640  Propanoate metabolism
rel00650  Butanoate metabolism
rel00900  Terpenoid backbone biosynthesis
rel01100  Metabolic pathways
rel01110  Biosynthesis of secondary metabolites
rel01120  Microbial metabolism in diverse environments
rel01130  Biosynthesis of antibiotics
rel01200  Carbon metabolism
rel01212  Fatty acid metabolism
rel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    REMIM1_PB00069
   00630 Glyoxylate and dicarboxylate metabolism
    REMIM1_PB00069
   00640 Propanoate metabolism
    REMIM1_PB00069
   00650 Butanoate metabolism
    REMIM1_PB00069
  09103 Lipid metabolism
   00071 Fatty acid degradation
    REMIM1_PB00069
   00072 Synthesis and degradation of ketone bodies
    REMIM1_PB00069
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    REMIM1_PB00069
   00310 Lysine degradation
    REMIM1_PB00069
   00380 Tryptophan metabolism
    REMIM1_PB00069
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    REMIM1_PB00069
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    REMIM1_PB00069
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    REMIM1_PB00069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rel04147]
    REMIM1_PB00069
Enzymes [BR:rel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     REMIM1_PB00069
Exosome [BR:rel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   REMIM1_PB00069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGS24191
UniProt: S5S9U7
Position
pRetMIM1b:67822..69009
Genome map
AA seq 395 aa AA seqDB search
MALQDPIVIVGAARTPIGSFQGELKEATAPELGATAIRAALERSRVSAEAVEEVVFGCVL
PAGLGQAPARQAAISAGLPFATGSTTVNKMCGSGMKAVMMAHDLIAAGNASVAVAGGMES
MTNAPYLLDRARGGYRLGHGRVVDHMFLDGLEDAYDKGRLMGSFAEDCAEAYQFTREAQD
NYAIASLTRAQKAIADGCFESEIVAVTVKSGKAEQVASRDEQPGKAKIDKIPTLKPAFRD
GGTVTAANSSSISDGAAALVLMRRSEAEHRGLVPLATVLGHATHSQAPNLFATAPIGALQ
KLSDRTGLALSDVDLFEINEAFAVVAMAAMRDLDLPHEKVNVHGGACALGHPIGASGGRI
LVTLLSALERYDLKRGMAALCIGGGEATAVAIERH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcaggatcctatcgtcatcgtcggcgcggcgcgcacgccgatcggcagtttc
cagggagagctgaaggaggcgacggcgccggagctcggagcaacggcgatccgcgctgca
ctggagcgcagccgtgtctcggccgaggcggtcgaggaggttgtcttcggctgcgtgctg
ccggcgggccttggccaggcgccggcacgtcaggcggcgattagtgccggtctacccttc
gcgacggggagcaccactgtcaacaagatgtgcggctcgggcatgaaagcggtcatgatg
gcgcatgacctgatcgccgccggcaacgcctcggtggcggttgcaggcggcatggaaagc
atgaccaacgcgccctatctccttgatagggcccgcggcggctacaggctcggccatggg
cgtgtcgtggatcatatgttcctcgacgggctggaggatgcttatgacaaggggcgcttg
atgggcagcttcgcggaggattgcgcggaggcgtatcagttcacgcgcgaggcgcaggat
aattacgccatcgcctccctgacgcgggcgcagaaggcgatcgccgacggctgtttcgaa
agcgagatcgtggcggtcacggtcaaatcgggcaaagccgagcaggtggcaagccgcgac
gagcagccaggcaaggccaagatcgacaagattccgacgttgaagcccgccttccgcgac
gggggcaccgtgactgcagccaattcgagctcgatctccgacggtgcggcagccctggtg
ctgatgcgccgctccgaggcggagcatcgcggccttgtcccgctcgccaccgtcctcggc
catgccactcattcgcaagcgcccaatcttttcgccaccgcgccgatcggcgcgctgcag
aagctttccgaccggacgggcctggcgctctcggatgtcgacctcttcgaaatcaacgag
gctttcgccgttgtcgccatggcggcgatgcgcgatctcgatctgccgcatgaaaaggtg
aacgtgcacggcggcgcctgtgccctcggccatccgatcggcgcatcgggcggccggatt
ctggtgacgctgctttcagcattggagcgctacgatctgaagcgcggcatggcggcactt
tgtatcggcggcggcgaggcgacggccgtcgccatcgagcggcactag

DBGET integrated database retrieval system