KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PB00133Help
Entry
REMIM1_PB00133    CDS       T02778                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00625  Chloroalkane and chloroalkene degradation
rel00680  Methane metabolism
rel01100  Metabolic pathways
rel01120  Microbial metabolism in diverse environments
rel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    REMIM1_PB00133 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    REMIM1_PB00133 (fdhA)
Enzymes [BR:rel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     REMIM1_PB00133 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C GIDA
Motif
Other DBs
NCBI-ProteinID: AGS24253
UniProt: S5S245
Position
pRetMIM1b:complement(141114..142304)
Genome map
AA seq 396 aa AA seqDB search
MSKNRGVVYLRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLILGHEITGEIIEKGVDVEMLEIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPARA
GGAYGYVDMGGWIGGQARYVTIPYADFNLLKIPDRDKAMAKIRDLTMLSDILPTGFHGAV
RAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMIGDFNKDRLAHAAKVGFEPIDLSKS
DRLGDMIAEVVGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGNLSLRFGLGWAKAQSFHTGQTPVLKYNRQLMQAILHDRLPIADIVN
AKVIPLDDAAAGYESFDHGAATKYVLDPHGEVAKAA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaatagaggcgtcgtctatctccggccgggaaaggtcgaagtccgcgatatc
gacgatccgaaactggaagcgcccgatggccgccgcatcgagcacggcgtgatcctgaag
gttatctccaccaatatctgcggctccgaccagcacatggtccgcggccgcacgactgca
atgccgggcctgatcctcggccatgaaatcaccggcgagatcatcgagaaaggcgtcgac
gtcgagatgctcgaaatcggcgacatcgtctcggtgcccttcaacgtcgcctgcggccgc
tgccgctgctgcaaatcccaggatacgggcgtctgcctgacggtaaatccggcccgcgcc
ggcggcgcttacggctatgtcgacatgggcggatggatcggcgggcaggcacgctacgtc
accattccctatgccgatttcaacctgctgaaaatcccggatcgggataaggcgatggcg
aagatccgcgatctcaccatgctttccgacattctgcccaccggctttcacggtgcagtg
cgcgcgggcgtcggggtcggctcgaccgtctatgtcgccggcgccggtcctgtcgggtta
gcggctgcggcttcggctcgcatcctcggtgccgccgtcgtcatgatcggcgatttcaac
aaggaccgcctggcgcatgccgcgaaggtcggtttcgaacccatcgatctttccaagagc
gatcgtctcggcgacatgattgccgaggtcgtcggcagcaacgaggtcgacagcgccatc
gacgcggtaggattcgaagcacgcggccattccggcggcgaacagccggcgatcgtgctc
aaccagatgatggagatcacccgcgccgcaggctcgatcggcatccccggcctctacgtg
accgaggacccgggcgcggtcgacaatgccgccaagcacggcaatctctcgcttcgcttc
ggtctcggctgggcaaaagcacaatccttccacaccggccagactccggtgctcaaatat
aatcgccagctcatgcaggcgattctccacgaccggttgccgatcgccgatatcgtcaac
gctaaggtcatcccgctcgacgatgccgccgctggatatgaaagtttcgaccatggcgcg
gcaacgaagtatgtcctcgatccgcacggcgaggtcgcgaaagccgcctga

DBGET integrated database retrieval system