KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00015Help
Entry
REMIM1_PF00015    CDS       T02778                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00071  Fatty acid degradation
rel00072  Synthesis and degradation of ketone bodies
rel00280  Valine, leucine and isoleucine degradation
rel00310  Lysine degradation
rel00362  Benzoate degradation
rel00380  Tryptophan metabolism
rel00620  Pyruvate metabolism
rel00630  Glyoxylate and dicarboxylate metabolism
rel00640  Propanoate metabolism
rel00650  Butanoate metabolism
rel00900  Terpenoid backbone biosynthesis
rel01100  Metabolic pathways
rel01110  Biosynthesis of secondary metabolites
rel01120  Microbial metabolism in diverse environments
rel01130  Biosynthesis of antibiotics
rel01200  Carbon metabolism
rel01212  Fatty acid metabolism
rel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    REMIM1_PF00015 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    REMIM1_PF00015 (vraB)
   00640 Propanoate metabolism
    REMIM1_PF00015 (vraB)
   00650 Butanoate metabolism
    REMIM1_PF00015 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    REMIM1_PF00015 (vraB)
   00072 Synthesis and degradation of ketone bodies
    REMIM1_PF00015 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    REMIM1_PF00015 (vraB)
   00310 Lysine degradation
    REMIM1_PF00015 (vraB)
   00380 Tryptophan metabolism
    REMIM1_PF00015 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    REMIM1_PF00015 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    REMIM1_PF00015 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    REMIM1_PF00015 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rel04147]
    REMIM1_PF00015 (vraB)
Enzymes [BR:rel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     REMIM1_PF00015 (vraB)
Exosome [BR:rel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   REMIM1_PF00015 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGS25687
UniProt: S5SUW1
Position
pRetMIM1f:13635..14840
Genome map
AA seq 401 aa AA seqDB search
MILSYAYQPDEDWQPVVVAAYRTPIGRAFGSLATVAAEDLLAPIIRRILAETGVGPDAID
DVLVGNAAGGGGNIGRLAALTADLPMAVPGVAIDRQCGSGLEAIIMAARLIQAKAGSCFL
AGGVESVSTAPWRVERPKANGAVPRFYGRARFSPETIGDPEMGVAAENVARQFGISRQRQ
DEFALRSHRLAVAAAEAGLFRPEIVEITTMRGPVEWDECPRPATSPEALANLKPVFLADG
SVTAGNACPVNDGACLVLVMSRGMARNLGIEKGLAFIDSAAAGVDPNLLGIGPVAATGKL
MQRQPDLSLSAIDVIEFNEAFAAQVLASLDQLEIPANAVNKEGGAIALGHPFGASGAILV
TRLYGQLIRGDGWTPGATGLAMIGIGGGIGLTALFEAVRLF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgtcctacgcctatcagcctgacgaggattggcagccggtcgtggtcgccgcc
taccgcacaccgatcggccgggccttcggctcgctggctacggttgcggccgaagacctg
cttgcgcccatcatccgccgcatccttgcggaaacgggcgtcgggcccgacgccatcgac
gacgtgctggtcggcaatgccgccggcggcggcggcaatatcggccggctggcggcgctg
actgccgacctgcccatggccgttcctggtgttgcgatcgaccggcaatgtggttcgggc
ctcgaagcaattatcatggccgcccggctgatccaggcgaaggccggttcgtgcttcctt
gccggcggcgtcgaaagcgtcagcaccgcgccatggcgcgtcgaaagaccgaaagccaat
ggtgccgtgcctcgcttttacggccgcgcacggttttcgcctgaaacgatcggcgacccc
gagatgggggtagccgctgaaaacgtcgcccgtcaattcggcatctcgcgccagcggcag
gatgaattcgccctgcgcagccatcggctcgctgtcgcagcggccgaagcgggcctcttc
cgccccgagatcgtcgagatcaccaccatgcgtggcccggtagagtgggacgaatgtccg
cgcccggccacctcgcccgaggcgctcgcgaacctgaagcctgtcttcctggccgatggc
tcggtgacggcaggcaatgcttgccctgtgaatgacggcgcctgcctggtgctcgtcatg
agccgcggcatggccagaaacctcggcatagaaaagggcctcgccttcatcgacagcgcc
gccgccggcgtcgatccaaacttgctcggaatcggaccggtcgccgcgaccggcaagctc
atgcagcgccagcccgacctctcgctttccgcaatcgacgtcatcgaattcaacgaggct
ttcgccgcccaggtcctggcgtcgctcgatcagctggagatccccgccaacgcggtcaac
aaagaaggcggcgctatcgcgctcggccaccccttcggcgcctccggcgctatcctggtc
acccggctctacggtcagctcatccgcggcgacggctggacaccaggcgcaaccggcctc
gccatgatcggcatcggcggcggcatcgggctcaccgcgttgttcgaggctgtccgcctt
ttctga

DBGET integrated database retrieval system