KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_PF00464
Entry
REMIM1_PF00464    CDS       T02778                                 

Definition
(GenBank) type VI secretion system IcmF family protein
  KO
K11891  type VI secretion system protein ImpL
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    REMIM1_PF00464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rel02044]
    REMIM1_PF00464
Secretion system [BR:rel02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   REMIM1_PF00464
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C DUF4199 Perilipin
Other DBs
NCBI-ProteinID: AGS26129
UniProt: S5SXC6
Position
pRetMIM1f:complement(491148..494624)
AA seq 1158 aa
MNPISYFYTLRSYVEAYAGLLGRRFISIIWVAAICVVIWFYGYLAAYGDFKPLASATARL
TLIGVVIAAWLAYLLFTVIRDGRRDKQLVEGIERDAEAEAAASQQAEVGEIHSRLKEALQ
LLRRITKRRFGYIYELPWYVIFGAPGSGKTTALTNSGLKFPLGDALGSNSVKGVGGTRNC
NWWFTDEAILIDTAGRYTTQDDLNGTAKAGWEGFLGLLRKYRRSQPINGALVTLSIGDLL
TRDPEAQREEIRAIRQRLSELDELLHARVPVYLLLTKADLLTGFVEFFDGFNKSDREQVW
GTTFGLDESYKAANLPERFTEEFTLLQQRVDAMLIERLQQEPNPELRGRIFRFPAELASL
KERLHEVTTELCSGSKLVEAPLLRGIYFASGTQREETAATPRMRRSYFLSRLFKEVIFGE
ASLVARDKRLSGRQLLFRRAAYASAVLLLAMVLTSWTATYFQNTAALAGAERRIDAYEQL
VRGVPVRDVSDADFLRILPALDNLAAVTTDFSRTRVWPVSLGLDQEGKVASRQREAYQRA
LNTLLLPRMLVQLQKEMTETTDVNRTFDALKLYGMLGGLGPVNVDFASLEAEDMFTRLYP
DEGRAAARKALIAHAGAMARGALPPIELDKTLIAKAREIIRSQNIASRAYEILAEHRASR
ALPGWSPAGALGPLGEQAFERTSKAPLGESIPGLFSATGYRTVVLPEISEAAREALDEQW
VRGLPNPAGVTVDTVAQATLQLYFDKFDQRWSTLLTDIRVKPSQTISDAAETTRILAGKP
GPVETIANSIAAATDLRGPSAEIASAAGDSLTDATTALSSAANAPDPFGPLREALKAPAG
QSPLPDQSKQTPRSGIGQLEPILQKVQEQLSRATTSTAEVAKVFDVDSQLTDANQDLLQQ
ARKLPAPVDTWMAGLAADVGSLAVKSARSRISDAWAAEGAGFCSNVVAGRYPFDRKSARD
VAMSDFVRLFGPQGLFKTFFKEKLEAFVDTSASPWGWKGTFGAASIPSAAIAQFENADKI
NRAFFPAGSKDPLITINVKPVSLTDAASAVMLEIEGERVVYFHGPIQSKSISWPSAEASN
TSRIAFQPGGWQQAMTENGDWSPFRLFDDANVTIQGDDLFRAKFEQDGRAAEFDVQFGSV
LNPFRLEALGAFSCPAQF
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgaatcccataagttatttctatacgctgcgttcttatgtggaggcctatgccggcctt
ctcggccgccgcttcatctcgatcatatgggtggcggcgatctgcgtcgtcatctggttc
tacggctatctcgccgcctatggcgactttaagccgctggcgagcgccacggcgcggctg
acgctgatcggcgtcgtcatcgccgcctggctcgcctacctcctcttcaccgtgatccgc
gacggccgccgcgacaagcagctcgtcgaagggatcgagcgtgacgccgaggccgaagcg
gcggccagccagcaggctgaggtcggcgagatccacagccggctgaaggaggcgttgcag
ctcctgcgccgcatcaccaagcgacgcttcggctatatttacgagctgccctggtacgtg
atcttcggcgcgccgggctccggcaagacgacggcgctcaccaattccggcctcaaattc
ccgctcggcgacgcactcggcagcaattcggtgaagggcgtcggcggcacgcgcaactgc
aattggtggttcaccgacgaggccatactcattgataccgccggccgctacaccacccag
gacgatctgaacggcaccgccaaggccggctgggagggctttctcggcctcctcagaaaa
taccgccggtcgcagccgatcaacggcgcgctggtgacgctatcgatcggcgacctgctg
acacgcgatcccgaagctcagcgcgaggagatcagagcgatccgccagaggctgtccgag
ctcgacgaactcctgcatgcacgcgtgccggtctatctgctcctgaccaaggccgatctc
ctgaccggcttcgtcgaattcttcgacggcttcaacaagagcgaccgcgaacaggtctgg
ggcacgaccttcgggctggacgaaagctataaggcggccaacctgccggaacgcttcaca
gaggaattcaccctgctgcagcaacgcgtcgacgccatgctgatcgagcgcctgcagcag
gagcccaatccggagctgcgcggccgcatcttccgcttccccgccgagctcgcctcgctg
aaggagcgcctgcatgaggtgacgacggagctttgctcgggctcgaaactggtggaggcg
ccgctcctgcgcggcatctatttcgcctccggcacccagagggaggagaccgccgccacg
ccgcgcatgcggcgcagctatttcctctcgcgcctcttcaaggaggtgatcttcggcgag
gcctcgctggttgcccgcgacaagcggctttccggccgacagctgctcttccgccgcgcg
gcttacgccagcgcggtcctgctgctggccatggtgctgaccagctggacggccacctat
ttccagaacaccgcggcgcttgcgggtgcggaaagacgcatcgacgcctatgagcagctg
gtgcgcggcgtgccggtgcgcgacgtctcagatgcggatttcctgcgcattctgccggcg
ctcgataatcttgctgccgtcactaccgatttttcgaggacgcgcgtctggccggtgagc
ctcggcctcgatcaggaaggcaaggtcgcgagccgccagcgcgaagcctatcagcgggcg
ctgaacacgctgctcctgccccgcatgctggtgcagctccagaaggagatgaccgagacg
accgacgtcaacagaaccttcgacgcgctgaagctctacggcatgctcggcgggctcggc
cctgtgaatgtggatttcgcctctttggaagcggaagacatgttcaccaggctctatccc
gacgaaggccgggccgctgcgcgcaaggcgctgatcgcccatgcgggagccatggcgcgc
ggcgcgctgccgcccatcgagctcgacaagacgctgatcgccaaggcacgcgagattatc
cgctcgcagaacatcgccagccgcgcctatgagatcctggcggaacaccgcgcttcccgc
gcccttcccggctggagtccggccggtgcgctcggtccgctcggcgaacaggcattcgag
cggacctccaaggcgccgcttggcgagagcatccccggcctcttttccgcgaccggctac
cggaccgtcgttctgccggagatcagcgaggccgcgcgcgaggcactcgacgagcagtgg
gtgcgcggcttacccaatcccgccggtgtcacggtcgacaccgtcgcccaggccacactt
cagctttacttcgacaagttcgatcaacgctggtcgaccctgttgaccgatatcagggtc
aaaccttcgcagacgatcagcgacgcggctgagaccactcgcatcctcgccggcaagccc
ggtcccgtcgagacgatcgcgaattcgatcgccgcggccaccgatctgcgcggccccagc
gccgagatcgcctcggctgccggagacagtttgaccgacgcaaccacggcgctgagcagt
gccgccaatgcgcccgatcccttcggcccgctgcgagaggcgttgaaggcgccggccggc
cagtcgccgctccccgaccaatcgaagcagacgccccgctcggggatcggacagctggaa
ccgatcctgcagaaagtacaggagcagctttcgcgggcgacgacctctaccgctgaagtg
gcaaaagtcttcgacgtcgatagccagttgacggacgccaaccaggacttgctgcagcaa
gcccggaagttgccggcgccagtcgatacatggatggcggggctcgccgccgatgtcggt
tcgctggcggtcaaatccgctcgttcgcgcatcagcgatgcctgggccgcggagggtgcc
ggcttctgctcgaatgtcgtggccggccgttatcccttcgatcgaaaatcggcgcgcgac
gtggcgatgagcgactttgtcaggctgttcggaccccaggggctgttcaagaccttcttc
aaggaaaagcttgaggccttcgtcgataccagcgcttcgccatggggctggaagggcacc
ttcggggcggcgagcattccgagcgcggcgatcgcccagttcgagaatgccgacaagatc
aaccgcgccttcttcccagccggcagcaaggacccgttgatcaccatcaacgtcaagccg
gtgtcgctgaccgatgccgccagcgccgtgatgctggagatcgagggcgaacgcgtcgtt
tatttccatggaccgattcagtcgaaatcgatcagctggccatcggcggaagccagcaac
acctcgcggatcgccttccagccgggcggctggcagcaggccatgaccgaaaacggcgac
tggtcgcccttccgcctcttcgacgatgccaatgtcacgatccaaggcgacgatcttttc
cgggcgaaatttgagcaggatggccgggcggcggagttcgacgtgcagttcggttcggtg
ctcaatccattccggctggaggcgctcggcgccttctcatgcccggcgcaattctga

DBGET integrated database retrieval system